Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Sklu_879.223323312281e-174
KLLA0C11649g2382217375e-99
YER163C2322306914e-92
Scas_576.42372266691e-88
CAGL0L11748g2362356342e-83
AFR184C2182235741e-74
KLLA0B09240g80040643.5
AGR338C82575617.0
AGR089C137044617.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Sklu_879.2
         (233 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Sklu_879.2 YER163C, Contig c879 312-1013 reverse complement           477   e-174
KLLA0C11649g complement(1005591..1006307) similar to sp|P32656 S...   288   5e-99
YER163C (YER163C) [1591] chr5 complement(503079..503777) Member ...   270   4e-92
Scas_576.4                                                            262   1e-88
CAGL0L11748g complement(1252608..1253318) similar to sp|P32656 S...   248   2e-83
AFR184C [3376] [Homologous to ScYER163C - NSH] (772555..773211) ...   225   1e-74
KLLA0B09240g complement(810178..812580) similar to sp|P31244 Sac...    29   3.5  
AGR338C [4649] [Homologous to ScYNL126W (SPC98) - SH] (1358867.....    28   7.0  
AGR089C [4399] [Homologous to ScYLR086W (SMC4) - SH] (901443..90...    28   7.7  

>Sklu_879.2 YER163C, Contig c879 312-1013 reverse complement
          Length = 233

 Score =  477 bits (1228), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 233/233 (100%), Positives = 233/233 (100%)

Query: 1   MTQDKGIWVLGYGSLIYKPPPHYRHRIPGIIYGFKRRFWQSSSDHRGTPQSPGRVATLIA 60
           MTQDKGIWVLGYGSLIYKPPPHYRHRIPGIIYGFKRRFWQSSSDHRGTPQSPGRVATLIA
Sbjct: 1   MTQDKGIWVLGYGSLIYKPPPHYRHRIPGIIYGFKRRFWQSSSDHRGTPQSPGRVATLIA 60

Query: 61  YDDIVKHPKFLKDLYHYKKSKVEKAEDLSIFGVAYYIPPQYAQEVTDYLNVREQDGYSVH 120
           YDDIVKHPKFLKDLYHYKKSKVEKAEDLSIFGVAYYIPPQYAQEVTDYLNVREQDGYSVH
Sbjct: 61  YDDIVKHPKFLKDLYHYKKSKVEKAEDLSIFGVAYYIPPQYAQEVTDYLNVREQDGYSVH 120

Query: 121 CVEIHLETTLSQEQELRDSLHLLPRHHITNKYVLRSIVYIGTVDNESFVGPEDIKTTASI 180
           CVEIHLETTLSQEQELRDSLHLLPRHHITNKYVLRSIVYIGTVDNESFVGPEDIKTTASI
Sbjct: 121 CVEIHLETTLSQEQELRDSLHLLPRHHITNKYVLRSIVYIGTVDNESFVGPEDIKTTASI 180

Query: 181 IADSHGPSGPNYEYLKLLHDSLTEVACSLGHKLSDVEDTYLDSLLDHVINDSH 233
           IADSHGPSGPNYEYLKLLHDSLTEVACSLGHKLSDVEDTYLDSLLDHVINDSH
Sbjct: 181 IADSHGPSGPNYEYLKLLHDSLTEVACSLGHKLSDVEDTYLDSLLDHVINDSH 233

>KLLA0C11649g complement(1005591..1006307) similar to sp|P32656
           Saccharomyces cerevisiae YER163c singleton, start by
           similarity
          Length = 238

 Score =  288 bits (737), Expect = 5e-99,   Method: Compositional matrix adjust.
 Identities = 135/221 (61%), Positives = 173/221 (78%)

Query: 5   KGIWVLGYGSLIYKPPPHYRHRIPGIIYGFKRRFWQSSSDHRGTPQSPGRVATLIAYDDI 64
           +GIWV+GYGSLIYKPPPH+++++ GI+YGFKRRFWQSS DHRGTP SPGRVATLI +D I
Sbjct: 6   EGIWVVGYGSLIYKPPPHWKYKVNGIVYGFKRRFWQSSIDHRGTPDSPGRVATLIPFDGI 65

Query: 65  VKHPKFLKDLYHYKKSKVEKAEDLSIFGVAYYIPPQYAQEVTDYLNVREQDGYSVHCVEI 124
             + +F KDL  +    V K +DL +  VAYYIPP++AQ VT++L+VRE++GY+ H + I
Sbjct: 66  TNNAEFEKDLRTWNSKVVAKQDDLKLLAVAYYIPPEHAQFVTEHLDVREKNGYTAHRIFI 125

Query: 125 HLETTLSQEQELRDSLHLLPRHHITNKYVLRSIVYIGTVDNESFVGPEDIKTTASIIADS 184
           HL+   S+  EL+  LH LP H  T K++L S+VYIGT DNE+F+GPEDI  TA +I+ +
Sbjct: 126 HLQPPKSEPLELQALLHKLPVHETTGKHILDSLVYIGTSDNEAFIGPEDINVTAKVISHN 185

Query: 185 HGPSGPNYEYLKLLHDSLTEVACSLGHKLSDVEDTYLDSLL 225
            GPSGPNYEYLKLLHDSLTE+A  LG  L ++ED+YLDSLL
Sbjct: 186 LGPSGPNYEYLKLLHDSLTEMADELGQSLEEIEDSYLDSLL 226

>YER163C (YER163C) [1591] chr5 complement(503079..503777) Member of
           the ChaC-like protein family, has moderate similarity to
           uncharacterized C. albicans Orf6.7p [699 bp, 232 aa]
          Length = 232

 Score =  270 bits (691), Expect = 4e-92,   Method: Compositional matrix adjust.
 Identities = 133/230 (57%), Positives = 169/230 (73%), Gaps = 4/230 (1%)

Query: 1   MTQDK-GIWVLGYGSLIYKPPPHYRHRIPGIIYGFKRRFWQSSSDHRGTPQSPGRVATLI 59
           MT D  GIWVLGYGSLIYKPP HY HRIP II+GF RRFWQSS+DHRGTP +PGRVATLI
Sbjct: 1   MTNDNSGIWVLGYGSLIYKPPSHYTHRIPAIIHGFARRFWQSSTDHRGTPANPGRVATLI 60

Query: 60  AYDDIVKHPKFLKDLYHYKKSK-VEKAEDLSIFGVAYYIPPQYAQEVTDYLNVREQDGYS 118
            Y+DI++   FLK++  Y +S  ++  +DL   GV YYIPP++AQEV +YLNVREQ+GY+
Sbjct: 61  PYEDIIRQTAFLKNVNLYSESAPIQDPDDLVTIGVVYYIPPEHAQEVREYLNVREQNGYT 120

Query: 119 VHCVEIHLETTLSQEQELRDSLHLLPRHHITNKYVLRSIVYIGTVDNESFVGPEDIKTTA 178
           +H VE+HLET    E EL ++L  LPRH+ + K VL + VYIGT+DNE+FVGPE +  TA
Sbjct: 121 LHEVEVHLETNREHEAELGEALEQLPRHNKSGKRVLLTSVYIGTIDNEAFVGPETVDETA 180

Query: 179 SIIADSHGPSGPNYEYLKLLHDSLTEVACSLGHKLSDVEDTYLDSLLDHV 228
            +IA SHGPSG NYEYL  L  +L ++   +  +   + D YL +LL+ V
Sbjct: 181 KVIAVSHGPSGSNYEYLAKLEQALAQM--PIMKERGRITDHYLTALLETV 228

>Scas_576.4
          Length = 237

 Score =  262 bits (669), Expect = 1e-88,   Method: Compositional matrix adjust.
 Identities = 130/226 (57%), Positives = 165/226 (73%), Gaps = 5/226 (2%)

Query: 5   KGIWVLGYGSLIYKPPPHYRHRIPGIIYGFKRRFWQSSSDHRGTPQSPGRVATLIAYDDI 64
           +G+WVLGYGSLIYKPPPHY++RIP  IYGF RRFWQSS DHRGTP SPGRV TLI YD+I
Sbjct: 10  QGLWVLGYGSLIYKPPPHYKYRIPATIYGFMRRFWQSSIDHRGTPDSPGRVVTLIPYDEI 69

Query: 65  VKHPKFLKDLYHYKKS--KVEKAEDLSIFGVAYYIPPQYAQEVTDYLNVREQDGYSVHCV 122
           V  P+F +DL  Y  +   ++ A DL+  GV YYIP ++A +V +YL+VREQ+GY++H V
Sbjct: 70  VSRPEFSQDLKLYSPNFDDIKGANDLTTLGVVYYIPTEFADQVREYLDVREQNGYTLHEV 129

Query: 123 EIHLETTLSQEQELRDSLHLLPRHHITNKYVLRSIVYIGTVDNESFVGPEDIKTTASIIA 182
           E+HL TT  QE+ L+  L  LP H+ T K +L++ VYIGTV NE+FVGPE I  TA +I+
Sbjct: 130 EVHLNTTGEQERALKHVLCKLPFHNETKKRILKTNVYIGTVTNEAFVGPEAIHDTAKVIS 189

Query: 183 DSHGPSGPNYEYLKLLHDSLTEVACSLGHKLSDVEDTYLDSLLDHV 228
            S GPSGPN EYLKLLHDS+  ++    ++L    D YL+ LL  V
Sbjct: 190 TSRGPSGPNIEYLKLLHDSIEFMS---DNELLPTSDIYLNKLLRQV 232

>CAGL0L11748g complement(1252608..1253318) similar to sp|P32656
           Saccharomyces cerevisiae YER163c, start by similarity
          Length = 236

 Score =  248 bits (634), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 129/235 (54%), Positives = 162/235 (68%), Gaps = 13/235 (5%)

Query: 1   MTQDK-GIWVLGYGSLIYKPPPHYRHRIPGIIYGFKRRFWQSSSDHRGTPQSPGRVATLI 59
           MT +K GIWVLGYGSLIYKPPPHY HRIP +IYGF RRFWQSS DHRGTP SPGRV TLI
Sbjct: 1   MTVEKCGIWVLGYGSLIYKPPPHYTHRIPAVIYGFMRRFWQSSVDHRGTPDSPGRVVTLI 60

Query: 60  AYDDIVKHPKFLKDLYHYKKSKVE----KAEDLSIFGVAYYIPPQYAQEVTDYLNVREQD 115
            +D+I+K P+FL+D   Y+         +  DL   GV YYIP   A EV +YL+VREQ+
Sbjct: 61  PHDEIMKTPRFLQDYVKYENHGNPITNLQPNDLHTIGVVYYIPADRADEVREYLDVREQN 120

Query: 116 GYSVHCVEIHLETTL--SQEQELRDSLHLLPRHHITNKYVLRSIVYIGTVDNESFVGPED 173
           GY++H VE+HL+ T   S +QEL  ++H LP H  T K VL + VYIGTV NE+FVGPE 
Sbjct: 121 GYTLHEVEVHLDLTESDSSDQELMAAIHQLPEHETTGKKVLTTNVYIGTVSNEAFVGPET 180

Query: 174 IKTTASIIADSHGPSGPNYEYLKLLHDSLTEVACSLGHKLSDVEDTYLDSLLDHV 228
           I+ TAS+IA + GPSG N++YL++L +S+  +      K  +  D YL+ L   V
Sbjct: 181 IEQTASVIATNVGPSGTNFDYLRMLCESMASM------KTCEETDKYLEHLFKEV 229

>AFR184C [3376] [Homologous to ScYER163C - NSH] (772555..773211)
           [657 bp, 218 aa]
          Length = 218

 Score =  225 bits (574), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 111/223 (49%), Positives = 145/223 (65%), Gaps = 24/223 (10%)

Query: 6   GIWVLGYGSLIYKPPPHYRHRIPGIIYGFKRRFWQSSSDHRGTPQSPGRVATLIAYDDIV 65
           G WV+GYGSLIYKPPPHY  R+ G+++GF+RRFWQSSSDHRGTP+ PGRVATL+      
Sbjct: 7   GAWVVGYGSLIYKPPPHYSQRVIGVVHGFRRRFWQSSSDHRGTPELPGRVATLV------ 60

Query: 66  KHPKFLKDLYHYKKSKVEKAEDLSIFGVAYYIPPQYAQEVTDYLNVREQDGYSVHCVEIH 125
                              A D  +  VAY+IP  +   VT YL+VREQDGY    V +H
Sbjct: 61  ------------------PAADARLLVVAYFIPAAHVAAVTAYLDVREQDGYLPQTVPVH 102

Query: 126 LETTLSQEQELRDSLHLLPRHHITNKYVLRSIVYIGTVDNESFVGPEDIKTTASIIADSH 185
           L        ELRD+L  LP   ++   V++S++YIG  D  +FVGPE+++ TA++IA +H
Sbjct: 103 LVAPPQPPHELRDALDALPCDSVSGLPVVQSVIYIGIPDAATFVGPEELQRTAAVIAHNH 162

Query: 186 GPSGPNYEYLKLLHDSLTEVACSLGHKLSDVEDTYLDSLLDHV 228
           GPSGPNYEYLKLLH +L  +A + G +L ++ED YLD LL+ V
Sbjct: 163 GPSGPNYEYLKLLHSALHSIAETFGARLCELEDHYLDELLEAV 205

>KLLA0B09240g complement(810178..812580) similar to sp|P31244
           Saccharomyces cerevisiae YBR114w RAD16 nucleotide
           excision repair protein, start by similarity
          Length = 800

 Score = 29.3 bits (64), Expect = 3.5,   Method: Composition-based stats.
 Identities = 14/40 (35%), Positives = 22/40 (55%), Gaps = 7/40 (17%)

Query: 78  KKSKVEKAEDLSIFGVAYYIPPQYAQEVTDYLNVREQDGY 117
           +++KVE+A+DL +       PP+      DY N  E+D Y
Sbjct: 454 RRTKVERADDLGL-------PPRIVTVRKDYFNEEEKDLY 486

>AGR338C [4649] [Homologous to ScYNL126W (SPC98) - SH]
           (1358867..1361344) [2478 bp, 825 aa]
          Length = 825

 Score = 28.1 bits (61), Expect = 7.0,   Method: Composition-based stats.
 Identities = 26/75 (34%), Positives = 35/75 (46%), Gaps = 11/75 (14%)

Query: 165 NESFVGPEDIKTTASIIADSHGPSGPNYEYLKLLHDSLTEVACSLGHK------LSDVED 218
           NESF    ++ T  S I    G   P  EYL  L      V  S G K      L ++ +
Sbjct: 675 NESF----NVITLKSGIKFIDGILKPRLEYLHQLRPDAATVGSS-GLKQYNIDELDNLHN 729

Query: 219 TYLDSLLDHVINDSH 233
            YLDS+LD+ + D+H
Sbjct: 730 DYLDSILDNKLLDAH 744

>AGR089C [4399] [Homologous to ScYLR086W (SMC4) - SH]
           (901443..905555) [4113 bp, 1370 aa]
          Length = 1370

 Score = 28.1 bits (61), Expect = 7.7,   Method: Composition-based stats.
 Identities = 17/44 (38%), Positives = 21/44 (47%)

Query: 41  SSSDHRGTPQSPGRVATLIAYDDIVKHPKFLKDLYHYKKSKVEK 84
           S S  R   +SPGR   LI    I      L+ LY  K+ KVE+
Sbjct: 62  SQSPPRSPNRSPGRAVELIQLSPIKNSRLELQRLYDTKQKKVER 105

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.318    0.138    0.417 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 8,588,770
Number of extensions: 377512
Number of successful extensions: 1000
Number of sequences better than 10.0: 13
Number of HSP's gapped: 995
Number of HSP's successfully gapped: 13
Length of query: 233
Length of database: 16,596,109
Length adjustment: 98
Effective length of query: 135
Effective length of database: 13,203,545
Effective search space: 1782478575
Effective search space used: 1782478575
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 60 (27.7 bits)