Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Sklu_752.22002009141e-127
YBR217W (ATG12)1861684117e-51
Kwal_14.18111961723934e-48
Scas_686.181801723716e-45
CAGL0K06765g1811663473e-41
KLLA0C05720g1891703394e-40
AAR160W1891673204e-37
Scas_676.31165487615.6
KLLA0E21197g52667606.9
AEL337C1097112608.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Sklu_752.2
         (200 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Sklu_752.2 YBR217W, Contig c752 791-1393                              356   e-127
YBR217W (ATG12) [398] chr2 (657789..658349) Protein conjugated t...   162   7e-51
Kwal_14.1811                                                          155   4e-48
Scas_686.18                                                           147   6e-45
CAGL0K06765g 658479..659024 similar to sp|P38316 Saccharomyces c...   138   3e-41
KLLA0C05720g 510735..511304 similar to sp|P38316 Saccharomyces c...   135   4e-40
AAR160W [348] [Homologous to ScYBR217W (APG12) - SH] complement(...   127   4e-37
Scas_676.31                                                            28   5.6  
KLLA0E21197g 1886452..1888032 some similarities with sp|Q12196 S...    28   6.9  
AEL337C [2168] [Homologous to ScYOL034W - SH] (14613..17906) [32...    28   8.6  

>Sklu_752.2 YBR217W, Contig c752 791-1393
          Length = 200

 Score =  356 bits (914), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 181/200 (90%), Positives = 181/200 (90%)

Query: 1   MSKVLEXXXXXXXXXXXXXXXXXXXNIRGKASYMVQSKLELYSKRLSQLRMQSDDEEEDE 60
           MSKVLE                   NIRGKASYMVQSKLELYSKRLSQLRMQSDDEEEDE
Sbjct: 1   MSKVLESESDYDSSSSTQSARSSTDNIRGKASYMVQSKLELYSKRLSQLRMQSDDEEEDE 60

Query: 61  LSRPSQSDRSQGTIEDGPVPRQEIPLTTSLILNNLPPRTDEVIKEVEQQEESQTPEKIQI 120
           LSRPSQSDRSQGTIEDGPVPRQEIPLTTSLILNNLPPRTDEVIKEVEQQEESQTPEKIQI
Sbjct: 61  LSRPSQSDRSQGTIEDGPVPRQEIPLTTSLILNNLPPRTDEVIKEVEQQEESQTPEKIQI 120

Query: 121 KFQPIGSIRQISPQVCKISPTQSFSMVITFLRRKLKVSEVYCYINNSFAPTPQQNVGDLW 180
           KFQPIGSIRQISPQVCKISPTQSFSMVITFLRRKLKVSEVYCYINNSFAPTPQQNVGDLW
Sbjct: 121 KFQPIGSIRQISPQVCKISPTQSFSMVITFLRRKLKVSEVYCYINNSFAPTPQQNVGDLW 180

Query: 181 TQFKIQEELVVSYCSSVAFG 200
           TQFKIQEELVVSYCSSVAFG
Sbjct: 181 TQFKIQEELVVSYCSSVAFG 200

>YBR217W (ATG12) [398] chr2 (657789..658349) Protein conjugated to
           Apg5p, involved in autophagy and cytoplasm-to-vacuole
           protein targeting pathway [561 bp, 186 aa]
          Length = 186

 Score =  162 bits (411), Expect = 7e-51,   Method: Compositional matrix adjust.
 Identities = 85/168 (50%), Positives = 111/168 (66%), Gaps = 22/168 (13%)

Query: 33  YMVQSKLELYSKRLSQLRMQSDDEEEDELSRPSQSDRSQGTIEDGPVPRQEIPLTTSLIL 92
           + VQ++LEL+S+RLSQL + SD   + ++      D S GT E      QE  + T+   
Sbjct: 41  HTVQNRLELFSRRLSQLGLASDISVDQQVE-----DSSSGTYE------QEETIKTNAQT 89

Query: 93  NNLPPRTDEVIKEVEQQEESQTPEKIQIKFQPIGSIRQISPQVCKISPTQSFSMVITFLR 152
           +      DE           +  +KIQIKFQPIGSI Q+ P VCKIS +QSF+MVI FL+
Sbjct: 90  SKQKSHKDE-----------KNIQKIQIKFQPIGSIGQLKPSVCKISMSQSFAMVILFLK 138

Query: 153 RKLKVSEVYCYINNSFAPTPQQNVGDLWTQFKIQEELVVSYCSSVAFG 200
           R+LK+  VYCYINNSFAP+PQQN+G+LW QFK  +EL+VSYC+SVAFG
Sbjct: 139 RRLKMDHVYCYINNSFAPSPQQNIGELWMQFKTNDELIVSYCASVAFG 186

>Kwal_14.1811
          Length = 196

 Score =  155 bits (393), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 77/172 (44%), Positives = 118/172 (68%), Gaps = 7/172 (4%)

Query: 33  YMVQSKLELYSKRLSQLRMQSDDE----EEDELSRPSQSDRSQGTIEDGPVPRQEIPLTT 88
           + V+ +LE YS RL+ L + S ++     ++  +  S  D    T+E         P++T
Sbjct: 28  FTVRDELEQYSTRLNLLGLDSGEQITSSTQELRNLESSDDNDSSTVESNRA--HTAPVST 85

Query: 89  SLILNNLPPRTDEVIKEVEQQEESQTPEKIQIKFQPIGSIRQISPQVCKISPTQSFSMVI 148
           S IL +L    D+ +K++ ++E+ + P KI I+F+PIGS+ Q++PQ+ +IS +Q FS+V+
Sbjct: 86  SAILGHLSVAGDQALKKMAEREQ-ELPTKIPIRFKPIGSVPQVAPQLARISASQPFSVVV 144

Query: 149 TFLRRKLKVSEVYCYINNSFAPTPQQNVGDLWTQFKIQEELVVSYCSSVAFG 200
           TFL ++LK++ VYCYINNSF+P PQQ+VGDLW  F+I++ELVVSYCS VAFG
Sbjct: 145 TFLTKRLKLNNVYCYINNSFSPAPQQSVGDLWGHFRIKDELVVSYCSGVAFG 196

>Scas_686.18
          Length = 180

 Score =  147 bits (371), Expect = 6e-45,   Method: Compositional matrix adjust.
 Identities = 79/172 (45%), Positives = 110/172 (63%), Gaps = 37/172 (21%)

Query: 32  SYMVQSKLELYSKRLSQLRMQSDDE---EEDELSRPSQSDRSQGTIEDGPVPRQEIPLTT 88
           S  ++++LELYS+RLSQL ++   +   E D  S  SQ+++ +   E+GP          
Sbjct: 43  SLALRNRLELYSRRLSQLGLEETPQIPLETDNTSL-SQAEKEKIKNEEGPD--------- 92

Query: 89  SLILNNLPPRTDEVIKEVEQQEESQTPEKIQIKFQPIGSIRQISPQVCKISPTQSFSMVI 148
              +N+                      K++IKFQPIGS+ QI P VCKIS TQSFS +I
Sbjct: 93  ---VNSF---------------------KVKIKFQPIGSVPQIKPPVCKISATQSFSSII 128

Query: 149 TFLRRKLKVSEVYCYINNSFAPTPQQNVGDLWTQFKIQEELVVSYCSSVAFG 200
           +FLR++L++  VYCY+N+SFAPTPQQNVGDLWTQFK+ +EL++SYC +VAFG
Sbjct: 129 SFLRKRLRMENVYCYVNSSFAPTPQQNVGDLWTQFKVNDELIISYCGAVAFG 180

>CAGL0K06765g 658479..659024 similar to sp|P38316 Saccharomyces
           cerevisiae YBR217w APG12 Autophagy protein, start by
           similarity
          Length = 181

 Score =  138 bits (347), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 74/166 (44%), Positives = 101/166 (60%), Gaps = 22/166 (13%)

Query: 35  VQSKLELYSKRLSQLRMQSDDEEEDELSRPSQSDRSQGTIEDGPVPRQEIPLTTSLILNN 94
           V+++LE YS+RLSQL +   D  E   S   +    QG++      R +  L  S+    
Sbjct: 38  VENRLEQYSRRLSQLALV--DTNESSDSSEKEEVFVQGSL------RSQQSLKASI---- 85

Query: 95  LPPRTDEVIKEVEQQEESQTPEKIQIKFQPIGSIRQISPQVCKISPTQSFSMVITFLRRK 154
                     +      +  P+K+ IKFQ IGSI  I+P VC+IS  + FS++I+FL+RK
Sbjct: 86  ----------QSSSHGHTGAPQKVMIKFQSIGSITSITPSVCQISTNKPFSVIISFLQRK 135

Query: 155 LKVSEVYCYINNSFAPTPQQNVGDLWTQFKIQEELVVSYCSSVAFG 200
           LK+  ++CYINNSFAP P QNVGDLW QFK+ +EL+VSYC SVAFG
Sbjct: 136 LKMENIHCYINNSFAPVPSQNVGDLWNQFKVNDELIVSYCGSVAFG 181

>KLLA0C05720g 510735..511304 similar to sp|P38316 Saccharomyces
           cerevisiae YBR217w APG12 component of the autophagic
           system singleton, start by similarity
          Length = 189

 Score =  135 bits (339), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 69/170 (40%), Positives = 108/170 (63%), Gaps = 15/170 (8%)

Query: 35  VQSKLELYSKRLSQLRMQSDD----EEEDELSRPSQSDRSQGTIEDGPVPRQEIPLTTSL 90
           ++ KLE +S +L++LR+   +    +EE+ LS  ++S R + +     V R         
Sbjct: 31  IKGKLEEFSAKLNELRLADGNSDGGDEEESLSPDTKSQREESSENSENVSRS-------- 82

Query: 91  ILNNLPPRTDEVIKEVEQQEESQTPEKIQIKFQPIGSIRQISPQVCKISPTQSFSMVITF 150
              + PP T  ++  VE+ E+ ++  K++I+ QPIG+I QI P+VC+IS  Q F  +  F
Sbjct: 83  --TSRPPLTSSIVSSVER-EQLKSQVKVKIRLQPIGAIPQIQPRVCQISAHQQFLALTRF 139

Query: 151 LRRKLKVSEVYCYINNSFAPTPQQNVGDLWTQFKIQEELVVSYCSSVAFG 200
           L ++LK   ++CYINN+FAP+  QN+GDLWTQFK+ +EL+VSYC +VAFG
Sbjct: 140 LCKRLKRKHIHCYINNAFAPSLDQNIGDLWTQFKVNDELIVSYCETVAFG 189

>AAR160W [348] [Homologous to ScYBR217W (APG12) - SH]
           complement(632807..633376) [570 bp, 189 aa]
          Length = 189

 Score =  127 bits (320), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 77/167 (46%), Positives = 110/167 (65%), Gaps = 15/167 (8%)

Query: 35  VQSKLELYSKRLSQLRMQSDDEEEDELSRPSQSDRSQGTIEDGPVPRQE-IPLTTSLILN 93
           +Q++LE Y +RLS+L++            PS SD     IE   +  ++ +PL+TS+ L 
Sbjct: 37  LQNRLEEYHERLSRLQL------------PSSSDSECSDIEQESLELEQEVPLSTSVYLA 84

Query: 94  NLPPRTDEVIKEVEQQEESQTPEKIQIKFQPIGSIRQISPQVCKISPTQSFSMVITFLRR 153
               R+   +    +  E+  P K+ I+FQPIGS+ Q+ PQVC+IS  QSF  V+ FLRR
Sbjct: 85  GA--RSAGGLPSSSELSETPEPPKVAIRFQPIGSVGQVMPQVCRISSAQSFGAVLVFLRR 142

Query: 154 KLKVSEVYCYINNSFAPTPQQNVGDLWTQFKIQEELVVSYCSSVAFG 200
           +L++  V+CY++NSFAPTPQQNVG LW QFK+ +ELVVSYC++VAFG
Sbjct: 143 RLRLDTVHCYVSNSFAPTPQQNVGQLWEQFKVNDELVVSYCATVAFG 189

>Scas_676.31
          Length = 1654

 Score = 28.1 bits (61), Expect = 5.6,   Method: Composition-based stats.
 Identities = 25/87 (28%), Positives = 41/87 (47%), Gaps = 9/87 (10%)

Query: 40  ELYSKRLSQLRMQSDDEEEDELSRPSQSDRSQGT------IEDGPVPRQEIPLTTSLILN 93
           +L++K+   L  Q+D +   +++  SQS R+Q T      I+  P     I L  S +L+
Sbjct: 368 DLFTKQFESLLAQNDYQNAAKIAASSQSLRNQNTINRLKNIQAAPGAISPILLYFSTLLD 427

Query: 94  NLPPRTDEVI---KEVEQQEESQTPEK 117
                 +E I   + V QQ+  Q  EK
Sbjct: 428 KGKLNKEETIELARPVLQQDRKQLFEK 454

>KLLA0E21197g 1886452..1888032 some similarities with sp|Q12196
           Saccharomyces cerevisiae YOR119c RIO1 singleton,
           hypothetical start
          Length = 526

 Score = 27.7 bits (60), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 21/67 (31%), Positives = 29/67 (43%), Gaps = 3/67 (4%)

Query: 30  KASYMVQSKLELYSKRLSQLRMQSDDEEEDELSRPSQSDRSQGTIEDGPVPR---QEIPL 86
           K  Y     LE Y      L++  +DE EDE+ R     R+ G +E+    R    +  L
Sbjct: 341 KGDYRSSDDLETYVADNLPLKLTDEDEAEDEVFRSLHLIRNLGGLEERDFDRFTDGKFDL 400

Query: 87  TTSLILN 93
             SLI N
Sbjct: 401 LKSLIAN 407

>AEL337C [2168] [Homologous to ScYOL034W - SH] (14613..17906) [3294
           bp, 1097 aa]
          Length = 1097

 Score = 27.7 bits (60), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 25/112 (22%), Positives = 54/112 (48%), Gaps = 16/112 (14%)

Query: 32  SYMVQSKLELYSKRLSQLRMQSDDEEEDELSRPSQSDRSQGTIEDGPVPRQEIPLTTSLI 91
           ++ +++ LE  +K  ++++M + DE    + R + +D  +G     P   + + L    +
Sbjct: 865 TFTLENILETIAKLETEIQMINHDESSVTILRQTVTD-IKGLQAKLPTQMERLGLLRRGM 923

Query: 92  L---NNLPPRTDEVIKEVEQQEESQTPEKIQIKFQPIGSIRQISPQVCKISP 140
           L   NNL PR DE+++ + Q        + +  F  +GS    + ++C + P
Sbjct: 924 LDMRNNLEPRLDELVENISQ--------RFRKLFSNVGS----AGEICLLKP 963

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.313    0.129    0.357 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 5,821,567
Number of extensions: 249732
Number of successful extensions: 1255
Number of sequences better than 10.0: 60
Number of HSP's gapped: 1247
Number of HSP's successfully gapped: 60
Length of query: 200
Length of database: 16,596,109
Length adjustment: 96
Effective length of query: 104
Effective length of database: 13,272,781
Effective search space: 1380369224
Effective search space used: 1380369224
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 59 (27.3 bits)