Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Sklu_2433.1425025013120.0
Kwal_47.192042502373764e-44
AFR248C3042383701e-42
YFR043C2372433521e-40
KLLA0A01089g2332313128e-35
Scas_699.392612592232e-21
CAGL0C02079g2652612222e-21
Kwal_55.20124122094730.30
KLLA0F22385g145327671.5
AEL094C122191653.0
Sklu_1849.287464643.5
AAL133W567132643.5
YHR139C (SPS100)32653634.6
Sklu_1871.136353616.8
Scas_717.11128089617.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Sklu_2433.14
         (250 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Sklu_2433.14 YFR043C, Contig c2433 23715-24467                        509   0.0  
Kwal_47.19204                                                         149   4e-44
AFR248C [3440] [Homologous to ScYFR043C - SH] (884696..885610) [...   147   1e-42
YFR043C (YFR043C) [1725] chr6 complement(239101..239814) Protein...   140   1e-40
KLLA0A01089g 102036..102737 weakly similar to sp|P43615 Saccharo...   124   8e-35
Scas_699.39                                                            91   2e-21
CAGL0C02079g 213832..214629 similar to sp|P43615 Saccharomyces c...    90   2e-21
Kwal_55.20124                                                          33   0.30 
KLLA0F22385g 2091235..2095596 similar to sp|P22147 Saccharomyces...    30   1.5  
AEL094C [2412] [Homologous to ScYDR335W (MSN5) - SH] (446715..45...    30   3.0  
Sklu_1849.2 YGR140W, Contig c1849 1292-3916                            29   3.5  
AAL133W [54] [Homologous to ScYGR171C (MSM1) - SH] complement(11...    29   3.5  
YHR139C (SPS100) [2426] chr8 complement(378220..379200) Sporulat...    29   4.6  
Sklu_1871.1 YMR234W, Contig c1871 2568-3659                            28   6.8  
Scas_717.11                                                            28   7.9  

>Sklu_2433.14 YFR043C, Contig c2433 23715-24467
          Length = 250

 Score =  509 bits (1312), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 250/250 (100%), Positives = 250/250 (100%)

Query: 1   MTAELPEVEGIKTTKIPRNKILVVCSAEIENKVSIISSLFNTNVDSGCSILKNLSWQNKY 60
           MTAELPEVEGIKTTKIPRNKILVVCSAEIENKVSIISSLFNTNVDSGCSILKNLSWQNKY
Sbjct: 1   MTAELPEVEGIKTTKIPRNKILVVCSAEIENKVSIISSLFNTNVDSGCSILKNLSWQNKY 60

Query: 61  YKTNIDVYIDDYDSLDEWTREFQQSEYNDLREVLAGVILLFNYRSEQTFSHFLDIINSTS 120
           YKTNIDVYIDDYDSLDEWTREFQQSEYNDLREVLAGVILLFNYRSEQTFSHFLDIINSTS
Sbjct: 61  YKTNIDVYIDDYDSLDEWTREFQQSEYNDLREVLAGVILLFNYRSEQTFSHFLDIINSTS 120

Query: 121 QNDEKFYIACNVSSKIDAEEWESLSDNYIAHGLELINWEESGKNAFGDKLGLERIREIID 180
           QNDEKFYIACNVSSKIDAEEWESLSDNYIAHGLELINWEESGKNAFGDKLGLERIREIID
Sbjct: 121 QNDEKFYIACNVSSKIDAEEWESLSDNYIAHGLELINWEESGKNAFGDKLGLERIREIID 180

Query: 181 THEWTQCELDVKEQPTIGVGSLLQDESAEFTLEEVLEKLNEARSRYQSMNNKDEAEMFAQ 240
           THEWTQCELDVKEQPTIGVGSLLQDESAEFTLEEVLEKLNEARSRYQSMNNKDEAEMFAQ
Sbjct: 181 THEWTQCELDVKEQPTIGVGSLLQDESAEFTLEEVLEKLNEARSRYQSMNNKDEAEMFAQ 240

Query: 241 EISEELTKYF 250
           EISEELTKYF
Sbjct: 241 EISEELTKYF 250

>Kwal_47.19204
          Length = 250

 Score =  149 bits (376), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 81/237 (34%), Positives = 142/237 (59%), Gaps = 11/237 (4%)

Query: 18  RNKILVVCSAEIENKVSIISSLFNTNVDSGCSILKNLSWQNKYYKTNIDVYIDDYDSLDE 77
           R+KI+V  S  + ++  +IS LF  +      I  +L W  KYY   ID+YID +DSL +
Sbjct: 21  RDKIIVCFSNYVHDQAEVISDLFGISFKDDQRIHHDLEWTTKYYSVKIDLYIDSFDSLRD 80

Query: 78  WTREFQQSEYNDLREVLAGVILLFNYRSE----QTFSHFLDIINSTSQNDEKFYIACNVS 133
           W ++F  SE ++LR+VLAG++L+   + E    +TF+   D +     + E F++     
Sbjct: 81  WVQQFCNSECDELRDVLAGLVLVVPCKVEDADLETFTQLADCM----ADAESFFVVLKAR 136

Query: 134 SKIDAEEWESLSDNYIAHGLELINWEESGKNAFGDKLGLERIREIIDTHEWTQCELDVKE 193
           S    E  +S  +  +A+G+E++   +SG+N +G+ +G  R+REIIDT++W Q +L    
Sbjct: 137 SNPSEECTDSSENKLLANGVEIVCRGDSGRNEYGEVIGTNRVREIIDTYDW-QTQLLKLR 195

Query: 194 QPTIGVGSLLQDESAEFTLEEVLEKLNEARSRYQSMNNKDEAEMFAQEISEELTKYF 250
           QP+      L+D S+   L E++ +L EAR++Y +M++ +E E+FA++++ EL++ F
Sbjct: 196 QPS--ATKELEDTSSGLPLNEIMTRLQEARTKYLAMDSSEEREIFARDVAHELSEQF 250

>AFR248C [3440] [Homologous to ScYFR043C - SH] (884696..885610) [915
           bp, 304 aa]
          Length = 304

 Score =  147 bits (370), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 81/238 (34%), Positives = 130/238 (54%), Gaps = 12/238 (5%)

Query: 16  IPRNKILVVCSAEIENKVSIISSLFNTNVDSGCSILKNLSWQNKYYKTNIDVYIDDYDSL 75
           +PRNKIL++  A    +  +I  LFN        I++++ W NKYY+ ++D+YID Y+SL
Sbjct: 73  LPRNKILILAPAGKAYQAEVIRDLFNIEASESDRIVRDVKWSNKYYEVDLDLYIDSYESL 132

Query: 76  DEWTREFQQSEYNDLREVLAGVILLF-NYRSEQTFSHFLDIINSTSQNDEKFYIACNVSS 134
             W  EF   E  DLR+V+AG+ L+F      +TF   ++  + T   DE+  +AC++SS
Sbjct: 133 QTWGAEFCSDECADLRDVVAGIFLVFEETEDAETFQQLIEDCHFT---DERVLVACDLSS 189

Query: 135 KIDAEEWESLSDNYIAHGLELINWEESGKNAFGDKLGLERIREIIDTHEWTQCELDVKEQ 194
              AE   SL      H + L+ W E G N  G++ G ER+RE++D H W++  L +   
Sbjct: 190 ---AEHPASLERALEVHDVALVRWRERGTNELGEQQGRERVRELLDIHPWSERMLRMHAS 246

Query: 195 PTIGVGSL--LQDESAEFTLEEVLEKLNEARSRYQSMNNKDEAEMFAQEISEELTKYF 250
               +  L  LQ   A+  L+ V+ ++ +AR RY  + +   A+ +A  I+ ELT+  
Sbjct: 247 TAAALAELDPLQ---ADIPLDSVVTRIKQARERYLEITDVHAADEYAARIAHELTEQL 301

>YFR043C (YFR043C) [1725] chr6 complement(239101..239814) Protein of
           unknown function [714 bp, 237 aa]
          Length = 237

 Score =  140 bits (352), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 83/243 (34%), Positives = 139/243 (57%), Gaps = 20/243 (8%)

Query: 17  PRNKILVVCSAEIEN--KVSIISSLFNTNVDSGCSILKNLSWQNKYYKTNIDVYIDDYDS 74
           P+NKILV+ S    N  K   +  LF+ +  +G SI+K+ +W+N+YYK + D+YID    
Sbjct: 6   PQNKILVL-SDHPHNFLKTQFLQDLFHCS-STGISIVKDQTWENRYYKVHFDLYIDSCKE 63

Query: 75  LDEWTREFQQSEYNDLREVLAGVILLFNYRSEQTFSHFLDIINSTSQNDEKFYIACNVSS 134
           +  W  EF   E   LR V+AG+IL+ + R  +        + +  +N   F +  NV+ 
Sbjct: 64  IPVWVEEFITPECEPLRNVMAGIILITDIRQTKPQELLHQFMIAAHRN--TFVVLANVNE 121

Query: 135 KIDAEEWESLSD---NYIAHGLELINWEES----GKNAFGDKLGLERIREIIDTHEWTQC 187
           +++ +E + L++   N   + +E +NW+ S      N +G+KLGL+RI+EIIDTH+W  C
Sbjct: 122 EVEQDEIDELNEIWSNAFTNVIEFVNWKRSKPTVNHNDYGEKLGLDRIQEIIDTHDWLNC 181

Query: 188 ELDVKEQPTIGVGSLLQDESAEFTLEEVLEKLNEARSRYQSMNNKDEAEMFAQEISEELT 247
           E+    QP   +   + +   E  LE+++  L  AR +Y+S+ N  EA+ FA E+++EL+
Sbjct: 182 EV----QPATKIREEIPN---EMPLEQIIRNLQSARLKYKSIENSSEADAFANEMADELS 234

Query: 248 KYF 250
           +Y 
Sbjct: 235 RYL 237

>KLLA0A01089g 102036..102737 weakly similar to sp|P43615
           Saccharomyces cerevisiae YFR043c hypothetical protein
           singleton, hypothetical start
          Length = 233

 Score =  124 bits (312), Expect = 8e-35,   Method: Compositional matrix adjust.
 Identities = 75/231 (32%), Positives = 129/231 (55%), Gaps = 13/231 (5%)

Query: 21  ILVVCSAEIENKVSIISSLFNTNVDSGCSILKNLSWQNKYYKTNIDVYIDDYDSLDEWTR 80
           IL+  S EI+  ++ IS++F    D   SI +++ W+ KYY+T +D+YID YD L EW  
Sbjct: 8   ILLPESLEIQEHIAFISTIFQKQYDETESIARDVQWKTKYYETTLDLYIDTYDVLQEWVN 67

Query: 81  EFQQSEYNDLREVLAGVILLFNYRSEQTFSHFL-DIINSTSQN-DEKFYIACNVSSK-ID 137
           +F   E  +LR+V++G+I +F     +     L ++I+   ++   KF+I C  +   I+
Sbjct: 68  DFVSDECKELRDVISGIIFVFKDEDHKPPVECLKNLIDERIEDFTAKFFIGCYFNENVIE 127

Query: 138 AEEWESLSDNYIAHGLELINWEESGKNAFGDKLGLERIREIIDTHEW-TQCELDVKEQPT 196
            +E   L+ + +    E++NW +    +  DK+G ERI+EIID H W +  E   K Q  
Sbjct: 128 EDELYELNSDLLVQNFEIVNWFDKPDPSM-DKVGSERIKEIIDVHPWLSHPETLKKNQGQ 186

Query: 197 IGVGSLLQDESAEFTLEEVLEKLNEARSRYQSMNNKDEAEMFAQEISEELT 247
           I +  +         L+  + KL +A+ RYQ+ ++  EAE+F ++I +EL+
Sbjct: 187 INISPI--------DLDSFMTKLEQAKERYQTFDDSKEAELFIEKIIDELS 229

>Scas_699.39
          Length = 261

 Score = 90.5 bits (223), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 74/259 (28%), Positives = 136/259 (52%), Gaps = 42/259 (16%)

Query: 16  IPRNKILVVCSAEIENKVS------IISSLFNTNV--DSGCSILKNLSWQNKYYKTNIDV 67
           +P+NKILVV +   +N++        +   F+  +  DS  SI+K + W+NKY++  +D+
Sbjct: 6   VPQNKILVVFN---KNRIPQTLQREFLQRTFDLPIENDSSDSIIKGIIWKNKYFELQLDL 62

Query: 68  YIDDYDSLDEWTREFQQSEYNDLREVLAGVILLFNYRSEQTFSHFLD--IIN-----STS 120
           YID+++  +E+  E+   E ++LR V+AG+I++     + T+ HF D  ++N     S S
Sbjct: 63  YIDEFEDFEEFVYEYCLDEMSELRSVIAGIIII-----DDTY-HFEDNKLVNKLQTDSGS 116

Query: 121 QNDEKFYIACNVSSKI---DAEEW----ESLSD--NYIAHGLELINWEESGKNAFGDKLG 171
           +    F +  N        D  +W    ES+++  + IA  + L       KN+ GDK+G
Sbjct: 117 ETSSSFMVIGNFEGDYEEEDIAQWRFPSESMTNDEDIIAEYVPLDKHFRMEKNSLGDKVG 176

Query: 172 LERIREIIDTHEW-TQCELDVKE--QPTIGVGSLLQDESAEFTLEEVLEKLNEARSRYQS 228
           +  I+E +D HEW   C +   +  QPT    ++  D SA      ++ +L +AR  +Q+
Sbjct: 177 VPGIKEKLDLHEWNPNCNIQKLDQIQPTHPPSNMDVDISA------IINQLRDARINFQT 230

Query: 229 MNNKDEAEMFAQEISEELT 247
             +++EA+  A  ++E + 
Sbjct: 231 HKDQEEAKSIATALAESIV 249

>CAGL0C02079g 213832..214629 similar to sp|P43615 Saccharomyces
           cerevisiae YFR043c, hypothetical start
          Length = 265

 Score = 90.1 bits (222), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 70/261 (26%), Positives = 132/261 (50%), Gaps = 26/261 (9%)

Query: 2   TAELP-----EVEGIKTTKIPRNKILVVCSAEIE-NKVSIISSLFNTNVDSGCSILKNLS 55
             ELP     E E +   K+  NK+LVV   E    +  ++ ++F    D G +I+K LS
Sbjct: 13  ATELPVSSEDECEEVTDAKVLPNKVLVVFEGESTLFRDQLLDTVFGVQ-DQG-NIVKQLS 70

Query: 56  WQNKYYKTNIDVYIDDYDSLDEWTREFQQSEYNDLREVLAGVILLFNYRSEQTFSHFLDI 115
           W  KYY    D+Y+D+   +  W  E    +Y +LR++L  +I++ ++ S Q    +  +
Sbjct: 71  WDTKYYAVEYDLYVDECVDIHGWLNEVNSDDYEELRDLLTMIIIVRSFDSTQDTKEYNSV 130

Query: 116 INSTSQNDEKFYIACNVSSKIDAEEWESLSDNYI---AHGLELINW-EESGKNAFGDKLG 171
           +    Q +    I+ N +S   A + +   D ++   A  +E IN+ ++  +    +  G
Sbjct: 131 LYDFIQGNSVSVISVNTNS---ARQVKDTYDEFLELDASSIEFINYHDDRVEKETNECKG 187

Query: 172 LERIREIIDTHEWTQCELDVKEQPTIGVGSLLQDESAEFTLEEVLEKLNEARSRYQSMNN 231
           + R++EIIDTH WT C++ +K + +        D+  +  LE +++ L +A+  YQ ++N
Sbjct: 188 MARLKEIIDTHPWTDCKVVLKNKESTS------DKVNKPDLEYLIDTLKKAKIHYQKLSN 241

Query: 232 -----KDEAEMFAQEISEELT 247
                 +EAE FA +++ ++ 
Sbjct: 242 GSDGFSEEAEQFALQMATDIA 262

>Kwal_55.20124
          Length = 1220

 Score = 32.7 bits (73), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 26/94 (27%), Positives = 44/94 (46%), Gaps = 17/94 (18%)

Query: 87  YNDLREVLAGVILLFNYRSEQTFSHFLDII---NSTSQNDEKFYIACNVSSKIDAEEWES 143
           + DL+ V+AG++   +Y  + +F  FL  I   +S  + +E+F       S I   E  +
Sbjct: 634 FPDLQNVVAGIMPRLSYHEKISFKSFLLTIVLKSSLGEKEERF-------SAIVGPELSA 686

Query: 144 LSDNYIAHGLELINWEESGKNAFGDKLGLERIRE 177
            SD     GL  + W       F ++LG+ +I E
Sbjct: 687 WSDKSTVVGLTDLPW-------FMERLGIVQISE 713

>KLLA0F22385g 2091235..2095596 similar to sp|P22147 Saccharomyces
           cerevisiae YGL173c KEM1 multifunctional nuclease, start
           by similarity
          Length = 1453

 Score = 30.4 bits (67), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 18/27 (66%)

Query: 56  WQNKYYKTNIDVYIDDYDSLDEWTREF 82
           W+++YYK  +D  I+D DSL E T  +
Sbjct: 511 WKDQYYKDKLDFSINDTDSLKEMTENY 537

>AEL094C [2412] [Homologous to ScYDR335W (MSN5) - SH]
           (446715..450380) [3666 bp, 1221 aa]
          Length = 1221

 Score = 29.6 bits (65), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 27/91 (29%), Positives = 41/91 (45%), Gaps = 11/91 (12%)

Query: 87  YNDLREVLAGVILLFNYRSEQTFSHFLDIINSTSQNDEKFYIACNVSSKIDAEEWESLSD 146
           Y+DL  V+AG++         +F  FL  I  TS  D+K       S+ +D  E  + SD
Sbjct: 635 YSDLENVVAGIMPKLTSHETISFKSFLLSIALTSSMDDK---DSRFSAIVDP-ELAAWSD 690

Query: 147 NYIAHGLELINWEESGKNAFGDKLGLERIRE 177
                GL  + W       F ++LG+ +I E
Sbjct: 691 KSTVVGLTDLPW-------FLERLGIVKITE 714

>Sklu_1849.2 YGR140W, Contig c1849 1292-3916
          Length = 874

 Score = 29.3 bits (64), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 19/64 (29%), Positives = 30/64 (46%), Gaps = 6/64 (9%)

Query: 171 GLERIREIIDTHEWTQCELDVKEQPTIGVGSLLQDESAEF------TLEEVLEKLNEARS 224
           GLE++R ++D H      L   E+ T+ +GSL  D +         TL  V E + +A+ 
Sbjct: 174 GLEKLRFLVDFHFQHYGRLSFGERSTVSLGSLSTDRTTNALVYTFKTLSSVTEYVPDAQP 233

Query: 225 RYQS 228
              S
Sbjct: 234 HITS 237

>AAL133W [54] [Homologous to ScYGR171C (MSM1) - SH]
           complement(113951..115654) [1704 bp, 567 aa]
          Length = 567

 Score = 29.3 bits (64), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 35/132 (26%), Positives = 54/132 (40%), Gaps = 19/132 (14%)

Query: 39  LFNTNVDSGCSILKNLSWQNKYY--KTNIDVYIDDYDSLDE-----WTREFQQSEYNDLR 91
           LF T  D     ++  S Q  Y   K  +D     + SLDE     +TR  + ++ + + 
Sbjct: 54  LFTTGTDEHGLKIQTASEQQGYASPKVFVDKLCTHFISLDEQANIGYTRFIRTTDKDHIS 113

Query: 92  EVLAGVILL----FNYRSEQTFSHFLDIINSTSQNDEKFYIACNVSSKIDAEEWESLSDN 147
            VL    L     + Y+ E +  +        S +DE FY A  V   ID  E+  +  +
Sbjct: 114 NVLRLWELCKANGYIYKGEHSGWY--------SVSDETFYPATKVVQVIDGREFPVMDGS 165

Query: 148 YIAHGLELINWE 159
            +  G E IN E
Sbjct: 166 TVTEGAEYINTE 177

>YHR139C (SPS100) [2426] chr8 complement(378220..379200) Sporulation
           specific protein involved in spore wall formation, first
           appears at 12h of sporulation [981 bp, 326 aa]
          Length = 326

 Score = 28.9 bits (63), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 29/53 (54%), Gaps = 3/53 (5%)

Query: 95  AGVILLFNYRSEQTFSHFLDIINSTSQN---DEKFYIACNVSSKIDAEEWESL 144
           +G+I++ N+RS +T S F  I+ +TS+     E F     + S  DAE   +L
Sbjct: 85  SGIIIVTNWRSIETLSFFCSIVFNTSKTIVITENFLWGVPILSSSDAEGRGTL 137

>Sklu_1871.1 YMR234W, Contig c1871 2568-3659
          Length = 363

 Score = 28.1 bits (61), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 16/53 (30%), Positives = 26/53 (49%)

Query: 43  NVDSGCSILKNLSWQNKYYKTNIDVYIDDYDSLDEWTREFQQSEYNDLREVLA 95
           N D    ++KN     KYY+ N DV+ ++     EW +     E N++ + LA
Sbjct: 304 NADLVVPLIKNFIKVKKYYEVNKDVFANNGKYQIEWVKGHAGQEGNEIADELA 356

>Scas_717.11
          Length = 1280

 Score = 28.1 bits (61), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 28/89 (31%), Positives = 43/89 (48%), Gaps = 18/89 (20%)

Query: 13  TTKIPRN-----KILVVCSAEIENKVSIISSLFNTNVDSGCS-------ILKNLSWQNKY 60
           +T IPR+     KIL++ S+ I   VS ISSL N +  SG +       +L N+S     
Sbjct: 631 STIIPRDLAKEVKILLLRSSPIIYNVSNISSLLNISHPSGDTEVELKRKLLDNIS----- 685

Query: 61  YKTNIDVYIDDYDSLDEWTREFQQSEYND 89
            K N  ++ D    L +   E+++S   D
Sbjct: 686 -KVNPTIFKDQVRMLKDSINEYEESNTGD 713

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.313    0.131    0.371 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 8,845,173
Number of extensions: 405971
Number of successful extensions: 1350
Number of sequences better than 10.0: 44
Number of HSP's gapped: 1339
Number of HSP's successfully gapped: 45
Length of query: 250
Length of database: 16,596,109
Length adjustment: 99
Effective length of query: 151
Effective length of database: 13,168,927
Effective search space: 1988507977
Effective search space used: 1988507977
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 60 (27.7 bits)