Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Sklu_2430.996696644800.0
Kwal_26.765574368513641e-176
YMR102C83487313061e-166
Scas_721.12885188012541e-158
CAGL0K03377g97892612501e-156
KLLA0B12804g85285011301e-140
ABL024W73477510641e-132
Scas_717.6890861610761e-131
YKL121W85280110701e-131
CAGL0K11638g5926745611e-61
AEL246C8152202055e-16
KLLA0E23529g8262221787e-13
Sklu_2431.127492211751e-12
Kwal_27.120537552211634e-11
Scas_721.328222191625e-11
CAGL0H08932g902721545e-10
YBR198C (TAF5)7982211536e-10
CAGL0M05335g8062271473e-09
Kwal_23.64297501161455e-09
CAGL0E00561g8361131456e-09
AGL234W6291161421e-08
YGL137W (SEC27)889721393e-08
KLLA0B01958g890671393e-08
Scas_629.126712401366e-08
YCR084C (TUP1)7131131359e-08
ADL082C569761294e-07
Scas_630.66212171277e-07
KLLA0F10263g6822211277e-07
CAGL0C03608g6431131268e-07
Scas_704.40608761251e-06
AFL118W832681242e-06
YIL046W (MET30)640761232e-06
CAGL0L00781g673771232e-06
YMR116C (ASC1)3191261193e-06
Kwal_23.5769627761213e-06
Sklu_2160.3760511205e-06
YNL006W (LST8)3032701151e-05
Sklu_2318.17112351171e-05
Sklu_2382.212611001162e-05
Scas_721.115*3181251132e-05
YDL145C (COP1)1201591152e-05
Scas_592.4*3181251122e-05
KLLA0F27511g623761142e-05
KLLA0D04840g3032641113e-05
Scas_624.111205591143e-05
KLLA0D02530g7071151133e-05
Kwal_23.53514741421114e-05
KLLA0E04741g459751098e-05
ADR077C1204591091e-04
Kwal_56.245261210591081e-04
KLLA0F04884g1212591082e-04
CAGL0I03718g1201591072e-04
Sklu_2442.23032631042e-04
CAGL0E02805g8401951062e-04
KLLA0E12287g326951033e-04
CAGL0K12188g535361034e-04
Scas_571.46011821034e-04
CAGL0D02090g2771391015e-04
AFR199C3341081025e-04
Scas_719.52628891035e-04
KLLA0A04928g8611651035e-04
YLR429W (CRN1)651891025e-04
KLLA0D07546g6471471026e-04
CAGL0M04279g9401821036e-04
Kwal_0.2123032591006e-04
YLR129W (DIP2)9432301019e-04
ADR090W1233911010.001
KLLA0F05159g1231701000.001
CAGL0H03729g303259970.002
AAL009C303264960.002
CAGL0A02772g441121970.002
KLLA0D16390g93669980.002
YBL008W (HIR1)840178970.002
CAGL0K00957g793261970.003
Scas_720.95515103950.003
YCR072C515100950.003
Kwal_56.24478129687960.004
Scas_658.1442153940.005
Scas_660.8510201940.005
Scas_713.50983171950.005
KLLA0E11297g512137940.005
Kwal_26.7570218109900.007
CAGL0B01529g36967920.007
Scas_711.11695266930.007
Scas_695.15327101920.007
Scas_707.2273090930.008
AER263C51362920.008
CAGL0L02629g79591930.008
Kwal_27.12667721253920.009
AEL314W715191920.009
AGL024W756120920.010
AGL196C93578920.010
Scas_702.16816175920.010
KLLA0F21406g705260920.011
CAGL0C02937g46778910.011
Kwal_27.12586509120910.013
Sklu_2173.251556900.014
YDL195W (SEC31)127376910.015
CAGL0D04884g56377900.016
KLLA0E21263g42974890.018
Sklu_2435.1357577890.019
Scas_719.3094076890.020
CAGL0J04818g654114890.021
AER114W633117890.022
YBR175W (SWD3)31594880.022
YFL009W (CDC4)779298890.022
Scas_512.353481880.023
Scas_718.6*54676880.029
AER255C46790870.029
ABL044C518206870.031
Scas_720.83d91578880.032
Kwal_23.503574475880.033
KLLA0C08547g51577870.033
CAGL0G04345g71170870.033
YPR178W (PRP4)465135870.035
Sklu_2291.499786870.036
Kwal_23.632451482870.036
Kwal_55.2114457077870.038
YKR036C (CAF4)659218870.039
AEL269C455225860.044
YCR057C (PWP2)92380860.051
Scas_465.41002242860.055
Scas_720.4575538850.060
KLLA0B02827g94277850.062
Kwal_33.1559171478850.063
YMR093W (UTP15)513168850.067
CAGL0G09845g500135840.068
YDR364C (CDC40)45544840.078
Kwal_55.21450503160840.078
YPR137W (RRP9)57377840.089
CAGL0J03476g51762830.10
Kwal_26.7736507166830.10
Kwal_56.23920937127830.11
YBR103W (SIF2)53539820.12
KLLA0E24508g32776820.12
Scas_581.362675820.13
Kwal_33.1547578386830.13
YPL126W (NAN1)896174820.14
AAR102C59177820.15
CAGL0J08998g128189820.18
CAGL0M08646g337194800.18
CAGL0K09284g91175810.19
YNL035C38952800.20
YKL213C (DOA1)715118810.21
YPL151C (PRP46)45178800.21
Kwal_47.1746580023800.24
Kwal_56.2303542452800.24
YDR142C (PEX7)37571790.25
Scas_631.17474239790.29
YGL004C (RPN14)41769790.32
YOR269W (PAC1)49478780.35
YER107C (GLE2)36565780.37
YGR200C (ELP2)78885780.39
Kwal_33.1513647379780.39
CAGL0M02277g427266770.43
Sklu_1880.347190770.46
Sklu_1963.231474760.52
CAGL0M09845g93677770.59
CAGL0C01441g100583770.61
KLLA0F15598g47879760.62
YKL021C (MAK11)468114760.65
Scas_601.238936760.68
YLR409C (UTP21)93977760.70
Scas_659.947579760.71
YJL112W (MDV1)714263760.72
Kwal_56.2416372925760.79
YMR146C (TIF34)34760750.80
YLL011W (SOF1)48979750.86
ACR137W42576750.87
CAGL0M06193g31674740.92
ADL322C50182750.93
Kwal_27.1223931674740.94
Scas_442.2*79545750.95
Scas_652.1634541741.00
KLLA0C08976g91160751.0
KLLA0E03982g37299741.1
AAL157C47979741.2
Scas_721.732575731.2
Sklu_1926.550939741.3
Kwal_23.624091378741.3
CAGL0K11836g52240741.4
CAGL0L10890g457145731.4
ADR264C34658731.4
Kwal_26.8975445111731.5
Scas_705.2571194731.6
CAGL0J01265g517203731.7
Scas_558.3725146731.7
YGL100W (SEH1)34941721.7
Scas_510.536257721.9
AGR168W82523731.9
AER448W714158731.9
Kwal_27.1155040752722.1
Scas_692.2548856722.2
Scas_680.1134766712.3
KLLA0E22814g136385722.3
Sklu_2406.1142678712.5
AGR238C83791722.6
Scas_646.1475550722.6
KLLA0D06787g43636703.1
AER337W445113703.3
CAGL0C00737g81681713.4
CAGL0G03399g36974694.0
CAGL0B00748g81261704.0
KLLA0D17028g701136704.0
Scas_692.29456113694.5
ACL116W80476694.8
AGR180W806186694.9
YCL039W (GID7)74598695.2
YOR212W (STE4)42342685.4
KLLA0F07205g54654685.6
Scas_685.1138467685.6
CAGL0J10340g33841685.8
Kwal_26.862842278686.0
ADL184W44934686.3
Kwal_47.1757243430686.5
Sklu_2420.2441238676.8
KLLA0F06754g34442677.3
KLLA0C07425g44445677.5
KLLA0A08866g42358677.6
AGL301C36165678.1
YDR030C (RAD28)50634678.2
ACR097W46778678.5
CAGL0M04081g455125678.9
Sklu_1701.1400117669.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Sklu_2430.9
         (966 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Sklu_2430.9 YMR102C, Contig c2430 15497-18397                        1730   0.0  
Kwal_26.7655                                                          530   e-176
YMR102C (YMR102C) [4060] chr13 complement(469847..472351) Protei...   507   e-166
Scas_721.128                                                          487   e-158
CAGL0K03377g complement(306529..309465) similar to sp|Q03177 Sac...   486   e-156
KLLA0B12804g 1117475..1120033 weakly similar to sp|Q03177 Saccha...   439   e-140
ABL024W [568] [Homologous to ScYMR102C - SH; ScYKL121W - SH] com...   414   e-132
Scas_717.68                                                           419   e-131
YKL121W (YKL121W) [3144] chr11 (213788..216346) Protein containi...   416   e-131
CAGL0K11638g complement(1123343..1125121) weakly similar to sp|Q...   220   1e-61
AEL246C [2260] [Homologous to ScYBR198C (TAF90) - SH] (172849..1...    84   5e-16
KLLA0E23529g 2088516..2090996 similar to sp|P38129 Saccharomyces...    73   7e-13
Sklu_2431.12 YBR198C, Contig c2431 17817-20066 reverse complement      72   1e-12
Kwal_27.12053                                                          67   4e-11
Scas_721.32                                                            67   5e-11
CAGL0H08932g join(871668..871685,872089..874779) highly similar ...    64   5e-10
YBR198C (TAF5) [381] chr2 complement(616084..618480) Component o...    64   6e-10
CAGL0M05335g complement(569132..571552) similar to sp|P38129 Sac...    61   3e-09
Kwal_23.6429                                                           60   5e-09
CAGL0E00561g 49750..52260 some similarities with sp|P16649 Sacch...    60   6e-09
AGL234W [4078] [Homologous to ScYCR084C (TUP1) - SH] complement(...    59   1e-08
YGL137W (SEC27) [1850] chr7 (249872..249889,250090..252741) Coat...    58   3e-08
KLLA0B01958g join(170646..170663,170896..173550) similar to sp|P...    58   3e-08
Scas_629.12                                                            57   6e-08
YCR084C (TUP1) [608] chr3 complement(260307..262448) General rep...    57   9e-08
ADL082C [1659] [Homologous to ScYIL046W (MET30) - SH] (538948..5...    54   4e-07
Scas_630.6                                                             54   7e-07
KLLA0F10263g 949926..951974 gi|2494900|sp|P56094|TUP1_KLULA Kluy...    54   7e-07
CAGL0C03608g 360681..362612 similar to sp|P16649 Saccharomyces c...    53   8e-07
Scas_704.40                                                            53   1e-06
AFL118W [3077] [Homologous to ScYGL137W (SEC27) - SH] complement...    52   2e-06
YIL046W (MET30) [2621] chr9 (268650..270572) F-box protein that ...    52   2e-06
CAGL0L00781g 95506..97527 similar to sp|P39014 Saccharomyces cer...    52   2e-06
YMR116C (ASC1) [4073] chr13 complement(499455..499877,500151..50...    50   3e-06
Kwal_23.5769                                                           51   3e-06
Sklu_2160.3 YGL137W, Contig c2160 2536-4818 reverse complement         51   5e-06
YNL006W (LST8) [4579] chr14 (620066..620977) Protein required fo...    49   1e-05
Sklu_2318.1 YKL213C, Contig c2318 605-2740 reverse complement          50   1e-05
Sklu_2382.2 YDL195W, Contig c2382 2146-5931 reverse complement         49   2e-05
Scas_721.115*                                                          48   2e-05
YDL145C (COP1) [723] chr4 complement(194572..198177) Coatomer (C...    49   2e-05
Scas_592.4*                                                            48   2e-05
KLLA0F27511g 2546533..2548404 similar to sp|P39014 Saccharomyces...    49   2e-05
KLLA0D04840g 413362..414273 highly similar to sp|P41318 Saccharo...    47   3e-05
Scas_624.11                                                            49   3e-05
KLLA0D02530g complement(212703..214826) gi|5679595|emb|CAB51777....    48   3e-05
Kwal_23.5351                                                           47   4e-05
KLLA0E04741g 428278..429657 similar to sp|P20053 Saccharomyces c...    47   8e-05
ADR077C [1818] [Homologous to ScYDL145C (COP1) - SH] (843171..84...    47   1e-04
Kwal_56.24526                                                          46   1e-04
KLLA0F04884g complement(478044..481682) similar to sp|P53622 Sac...    46   2e-04
CAGL0I03718g complement(317565..321170) highly similar to sp|P53...    46   2e-04
Sklu_2442.2 YNL006W, Contig c2442 3831-4742                            45   2e-04
CAGL0E02805g complement(265137..267659) similar to sp|P32479 Sac...    45   2e-04
KLLA0E12287g join(1086778..1087329,1087730..1088158) similar to ...    44   3e-04
CAGL0K12188g 1191188..1192795 similar to sp|P38262 Saccharomyces...    44   4e-04
Scas_571.4                                                             44   4e-04
CAGL0D02090g join(214357..214893,215564..215860) highly similar ...    44   5e-04
AFR199C [3391] [Homologous to ScYMR116C (ASC1) - SH] (799876..80...    44   5e-04
Scas_719.52                                                            44   5e-04
KLLA0A04928g 439349..441934 similar to sp|P32479 Saccharomyces c...    44   5e-04
YLR429W (CRN1) [3804] chr12 (990773..992728) Coronin, actin-bind...    44   5e-04
KLLA0D07546g complement(647984..649927) some similarities with s...    44   6e-04
CAGL0M04279g 469040..471862 highly similar to sp|Q12220 Saccharo...    44   6e-04
Kwal_0.212                                                             43   6e-04
YLR129W (DIP2) [3539] chr12 (399658..402489) Component of U3 sno...    44   9e-04
ADR090W [1831] [Homologous to ScYDL195W (SEC31) - SH] complement...    44   0.001
KLLA0F05159g 506007..509702 similar to sp|P38968 Saccharomyces c...    43   0.001
CAGL0H03729g 342948..343859 highly similar to sp|P41318 Saccharo...    42   0.002
AAL009C [178] [Homologous to ScYNL006W (LST8) - SH] (325785..326...    42   0.002
CAGL0A02772g complement(289274..290599) similar to sp|P40968 Sac...    42   0.002
KLLA0D16390g 1378884..1381694 similar to sp|Q12220 Saccharomyces...    42   0.002
YBL008W (HIR1) [186] chr2 (209618..212140) Histone transcription...    42   0.002
CAGL0K00957g 94828..97209 similar to sp|P42935 Saccharomyces cer...    42   0.003
Scas_720.95                                                            41   0.003
YCR072C (YCR072C) [597] chr3 complement(240800..242347) Protein ...    41   0.003
Kwal_56.24478                                                          42   0.004
Scas_658.1                                                             41   0.005
Scas_660.8                                                             41   0.005
Scas_713.50                                                            41   0.005
KLLA0E11297g complement(994770..996308) similar to sp|P38262 Sac...    41   0.005
Kwal_26.7570                                                           39   0.007
CAGL0B01529g 137174..138283 highly similar to sp|P39108 Saccharo...    40   0.007
Scas_711.11                                                            40   0.007
Scas_695.15                                                            40   0.007
Scas_707.22                                                            40   0.008
AER263C [2765] [Homologous to ScYCR072C - SH] (1118228..1119769)...    40   0.008
CAGL0L02629g complement(307323..309710) similar to sp|P07834 Sac...    40   0.008
Kwal_27.12667                                                          40   0.009
AEL314W [2191] [Homologous to ScYJL112W (MDV1) - SH; ScYKR036C (...    40   0.009
AGL024W [4287] [Homologous to ScYFL009W (CDC4) - SH; ScYER066W -...    40   0.010
AGL196C [4116] [Homologous to ScYLR129W (DIP2) - SH] (328838..33...    40   0.010
Scas_702.16                                                            40   0.010
KLLA0F21406g complement(1996260..1998377) similar to sp|P47025 S...    40   0.011
CAGL0C02937g 290289..291692 similar to sp|P39946 Saccharomyces c...    40   0.011
Kwal_27.12586                                                          40   0.013
Sklu_2173.2 YCR072C, Contig c2173 2732-4279                            39   0.014
YDL195W (SEC31) [678] chr4 (107209..111030) Component (p150) of ...    40   0.015
CAGL0D04884g 475678..477369 highly similar to tr|Q06506 Saccharo...    39   0.016
KLLA0E21263g 1892524..1893813 similar to sp|P40968 Saccharomyces...    39   0.018
Sklu_2435.13 YPR137W, Contig c2435 18346-20073                         39   0.019
Scas_719.30                                                            39   0.020
CAGL0J04818g 455846..457810 highly similar to sp|Q06440 Saccharo...    39   0.021
AER114W [2619] [Homologous to ScYLR429W (CRN1) - SH] complement(...    39   0.022
YBR175W (SWD3) [360] chr2 (582365..583312) Component of SET1 and...    39   0.022
YFL009W (CDC4) [1673] chr6 (116139..118478) F-box protein and co...    39   0.022
Scas_512.3                                                             39   0.023
Scas_718.6*                                                            39   0.029
AER255C [2757] [Homologous to ScYDR364C (CDC40) - SH] (1107932.....    38   0.029
ABL044C [548] [Homologous to ScYMR093W - SH] (312378..313934) [1...    38   0.031
Scas_720.83d                                                           39   0.032
Kwal_23.5035                                                           39   0.033
KLLA0C08547g 749737..751284 highly similar to sp|P25382 Saccharo...    38   0.033
CAGL0G04345g 408842..410977 similar to sp|P47025 Saccharomyces c...    38   0.033
YPR178W (PRP4) [5592] chr16 (892326..893723) U4/U6 snRNA-associa...    38   0.035
Sklu_2291.4 YPL183C, Contig c2291 6003-8996 reverse complement         38   0.036
Kwal_23.6324                                                           38   0.036
Kwal_55.21144                                                          38   0.038
YKR036C (CAF4) [3289] chr11 complement(508344..510323) Protein t...    38   0.039
AEL269C [2236] [Homologous to ScYPR178W (PRP4) - SH] (134760..13...    38   0.044
YCR057C (PWP2) [586] chr3 complement(220452..223223) Essential p...    38   0.051
Scas_465.4                                                             38   0.055
Scas_720.45                                                            37   0.060
KLLA0B02827g 254447..257275 similar to sp|Q06078 Saccharomyces c...    37   0.062
Kwal_33.15591                                                          37   0.063
YMR093W (UTP15) [4051] chr13 (454014..455555) Protein component ...    37   0.067
CAGL0G09845g 940598..942100 similar to sp|P20053 Saccharomyces c...    37   0.068
YDR364C (CDC40) [1190] chr4 complement(1202831..1204198) Protein...    37   0.078
Kwal_55.21450                                                          37   0.078
YPR137W (RRP9) [5555] chr16 (802353..804074) Protein component o...    37   0.089
CAGL0J03476g 331933..333486 highly similar to sp|P25382 Saccharo...    37   0.10 
Kwal_26.7736                                                           37   0.10 
Kwal_56.23920                                                          37   0.11 
YBR103W (SIF2) [292] chr2 (447666..449273) Protein involved in t...    36   0.12 
KLLA0E24508g complement(2175775..2176758) similar to sp|P38123 S...    36   0.12 
Scas_581.3                                                             36   0.13 
Kwal_33.15475                                                          37   0.13 
YPL126W (NAN1) [5319] chr16 (310209..312899) Nucleolar protein a...    36   0.14 
AAR102C [288] [Homologous to ScYPR137W (RRP9) - SH] (526057..527...    36   0.15 
CAGL0J08998g 882655..886500 highly similar to sp|P38968 Saccharo...    36   0.18 
CAGL0M08646g 861488..862501 similar to tr|Q05583 Saccharomyces c...    35   0.18 
CAGL0K09284g 914937..917672 highly similar to sp|P25635 Saccharo...    36   0.19 
YNL035C (YNL035C) [4552] chr14 complement(568520..569689) Protei...    35   0.20 
YKL213C (DOA1) [3062] chr11 complement(31961..34108) Protein req...    36   0.21 
YPL151C (PRP46) [5296] chr16 complement(266179..267534) Putative...    35   0.21 
Kwal_47.17465                                                          35   0.24 
Kwal_56.23035                                                          35   0.24 
YDR142C (PEX7) [987] chr4 complement(740467..741594) Peroxisomal...    35   0.25 
Scas_631.17                                                            35   0.29 
YGL004C (RPN14) [1968] chr7 complement(490705..491958) Protein c...    35   0.32 
YOR269W (PAC1) [5055] chr15 (826382..827866) Protein required in...    35   0.35 
YER107C (GLE2) [1539] chr5 complement(373444..374541) Nuclear po...    35   0.37 
YGR200C (ELP2) [2150] chr7 complement(899907..902273) 90 kDa sub...    35   0.39 
Kwal_33.15136                                                          35   0.39 
CAGL0M02277g complement(271836..273119) highly similar to sp|Q12...    34   0.43 
Sklu_1880.3 YDR364C, Contig c1880 4293-5708                            34   0.46 
Sklu_1963.2 YBR175W, Contig c1963 4075-5019 reverse complement         34   0.52 
CAGL0M09845g 975007..977817 highly similar to sp|Q06078 Saccharo...    34   0.59 
CAGL0C01441g complement(156930..159947) similar to tr|Q08924 Sac...    34   0.61 
KLLA0F15598g 1439610..1441046 highly similar to sp|P33750 Saccha...    34   0.62 
YKL021C (MAK11) [3234] chr11 complement(396987..398393) Protein ...    34   0.65 
Scas_601.2                                                             34   0.68 
YLR409C (UTP21) [3786] chr12 complement(934411..937230) Member o...    34   0.70 
Scas_659.9                                                             34   0.71 
YJL112W (MDV1) [2803] chr10 (205222..207366) Protein involved in...    34   0.72 
Kwal_56.24163                                                          34   0.79 
YMR146C (TIF34) [4102] chr13 complement(557480..558523) Translat...    33   0.80 
YLL011W (SOF1) [3408] chr12 (127522..128991) Protein component o...    33   0.86 
ACR137W [1184] [Homologous to ScYPL151C (PRP46) - SH] complement...    33   0.87 
CAGL0M06193g 643917..644867 similar to sp|P38123 Saccharomyces c...    33   0.92 
ADL322C [1419] [Homologous to ScYBR103W (SIF2) - SH] (128830..13...    33   0.93 
Kwal_27.12239                                                          33   0.94 
Scas_442.2*                                                            33   0.95 
Scas_652.16                                                            33   1.00 
KLLA0C08976g 784536..787271 highly similar to sgd|S0000653 Sacch...    33   1.0  
KLLA0E03982g 371642..372760 similar to sp|P39108 Saccharomyces c...    33   1.1  
AAL157C [30] [Homologous to ScYLL011W (SOF1) - SH] (70077..71516...    33   1.2  
Scas_721.7                                                             33   1.2  
Sklu_1926.5 YBR103W, Contig c1926 4197-5726 reverse complement         33   1.3  
Kwal_23.6240                                                           33   1.3  
CAGL0K11836g complement(1142213..1143781) similar to tr|Q12021 S...    33   1.4  
CAGL0L10890g 1163084..1164457 highly similar to sp|Q12024 Saccha...    33   1.4  
ADR264C [2005] [Homologous to ScYMR146C (TIF34) - SH] (1158218.....    33   1.4  
Kwal_26.8975                                                           33   1.5  
Scas_705.2                                                             33   1.6  
CAGL0J01265g complement(118375..119928) highly similar to sp|Q04...    33   1.7  
Scas_558.3                                                             33   1.7  
YGL100W (SEH1) [1883] chr7 (313235..314284) Protein found in com...    32   1.7  
Scas_510.5                                                             32   1.9  
AGR168W [4479] [Homologous to ScYBL008W (HIR1) - SH] complement(...    33   1.9  
AER448W [2948] [Homologous to ScYKL213C (DOA1) - SH] complement(...    33   1.9  
Kwal_27.11550                                                          32   2.1  
Scas_692.25                                                            32   2.2  
Scas_680.11                                                            32   2.3  
KLLA0E22814g 2023109..2027200 similar to sp|P47104 Saccharomyces...    32   2.3  
Sklu_2406.11 YOR212W, Contig c2406 16632-17912 reverse complement      32   2.5  
AGR238C [4549] [Homologous to ScYIL017C (VID28) - SH] (1196780.....    32   2.6  
Scas_646.14                                                            32   2.6  
KLLA0D06787g 586289..587599 gi|4809177|gb|AAD30127.1|AF136180_1 ...    32   3.1  
AER337W [2838] [Homologous to ScYOR272W (YTM1) - SH] complement(...    32   3.3  
CAGL0C00737g complement(75028..77478) similar to tr|Q05946 Sacch...    32   3.4  
CAGL0G03399g complement(325879..326988) highly similar to sp|P40...    31   4.0  
CAGL0B00748g 65727..68165 similar to sp|P25569 Saccharomyces cer...    32   4.0  
KLLA0D17028g complement(1443150..1445255) similar to sp|P30619 S...    32   4.0  
Scas_692.29                                                            31   4.5  
ACL116W [933] [Homologous to ScYGR200C (ELP2) - SH] complement(1...    31   4.8  
AGR180W [4491] [Homologous to ScYLR222C - SH] complement(1090647...    31   4.9  
YCL039W (GID7) [504] chr3 (52645..54882) Protein of unknown func...    31   5.2  
YOR212W (STE4) [5005] chr15 (742910..744181) Beta subunit of the...    31   5.4  
KLLA0F07205g 686532..688172 some similarities with sgd|S0002247 ...    31   5.6  
Scas_685.11                                                            31   5.6  
CAGL0J10340g complement(1008637..1009653) highly similar to sp|P...    31   5.8  
Kwal_26.8628                                                           31   6.0  
ADL184W [1557] [Homologous to ScYNL317W (PFS2) - SH] complement(...    31   6.3  
Kwal_47.17572                                                          31   6.5  
Sklu_2420.2 YPL151C, Contig c2420 3924-5249                            30   6.8  
KLLA0F06754g complement(650475..651509) similar to sp|P53011 Sac...    30   7.3  
KLLA0C07425g complement(647673..649007) highly similar to sp|Q12...    30   7.5  
KLLA0A08866g 776960..778231 weakly similar to sp|P53196 Saccharo...    30   7.6  
AGL301C [4011] [Homologous to ScYER107C (GLE2) - SH] (137221..13...    30   8.1  
YDR030C (RAD28) [881] chr4 complement(501749..503269) Protein in...    30   8.2  
ACR097W [1144] [Homologous to ScYOR212W (STE4) - SH] complement(...    30   8.5  
CAGL0M04081g complement(450572..451939) highly similar to sp|P42...    30   8.9  
Sklu_1701.1 YOR229W, Contig c1701 334-1536 reverse complement          30   9.6  

>Sklu_2430.9 YMR102C, Contig c2430 15497-18397
          Length = 966

 Score = 1730 bits (4480), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 850/966 (87%), Positives = 850/966 (87%)

Query: 1   MSEKSKHKKGSFVKRIFTSGNTSSSEPSTLTEAIEDPIDSRNSSDIALMRXXXXXXXXEN 60
           MSEKSKHKKGSFVKRIFTSGNTSSSEPSTLTEAIEDPIDSRNSSDIALMR        EN
Sbjct: 1   MSEKSKHKKGSFVKRIFTSGNTSSSEPSTLTEAIEDPIDSRNSSDIALMRSSSTDSSSEN 60

Query: 61  EKHSTEHIENTEKDNNETDHESFDGTKPFXXXXXXXXXXXXXXXXXXXXXXNHYSADIAP 120
           EKHSTEHIENTEKDNNETDHESFDGTKPF                      NHYSADIAP
Sbjct: 61  EKHSTEHIENTEKDNNETDHESFDGTKPFSSPKKLLSKKLSKSSSLHQSLSNHYSADIAP 120

Query: 121 LRFKMSMTRLDNAAAVKPVGQRPIAKPIVLDSLAAGRRLDSTDRNNIAVKPDKISRVTKN 180
           LRFKMSMTRLDNAAAVKPVGQRPIAKPIVLDSLAAGRRLDSTDRNNIAVKPDKISRVTKN
Sbjct: 121 LRFKMSMTRLDNAAAVKPVGQRPIAKPIVLDSLAAGRRLDSTDRNNIAVKPDKISRVTKN 180

Query: 181 PTKFVLDKDLYRFHHGSTLGSINRKQFEQYLKEPEYIKVFKKRKGLKQFRRFFLAQELKI 240
           PTKFVLDKDLYRFHHGSTLGSINRKQFEQYLKEPEYIKVFKKRKGLKQFRRFFLAQELKI
Sbjct: 181 PTKFVLDKDLYRFHHGSTLGSINRKQFEQYLKEPEYIKVFKKRKGLKQFRRFFLAQELKI 240

Query: 241 GTSPVNSNVGTNNVDGIPHVXXXXXXXXXXXXXXXXXXXXXXXXXXXXMKFSKDGRFLAT 300
           GTSPVNSNVGTNNVDGIPHV                            MKFSKDGRFLAT
Sbjct: 241 GTSPVNSNVGTNNVDGIPHVASSASIATLSSSSPTGSSSSSAGKSVWSMKFSKDGRFLAT 300

Query: 301 GGKDRILRIWKVIASPTERLELDSSTMKPSKTVCMLNGKLISYSRDVPQSGFARTENGDN 360
           GGKDRILRIWKVIASPTERLELDSSTMKPSKTVCMLNGKLISYSRDVPQSGFARTENGDN
Sbjct: 301 GGKDRILRIWKVIASPTERLELDSSTMKPSKTVCMLNGKLISYSRDVPQSGFARTENGDN 360

Query: 361 PEDDSLDTNGMFPDESLNLYAPVFHPLPYRSFLGHNQDILDIDWSKNNFVLTGSMDKTVK 420
           PEDDSLDTNGMFPDESLNLYAPVFHPLPYRSFLGHNQDILDIDWSKNNFVLTGSMDKTVK
Sbjct: 361 PEDDSLDTNGMFPDESLNLYAPVFHPLPYRSFLGHNQDILDIDWSKNNFVLTGSMDKTVK 420

Query: 421 LWHCDRKQLLKNFPHPDFVTCVKFHPNDDRFFISGCLDHKARLWSILDDEVSFEFDCGDL 480
           LWHCDRKQLLKNFPHPDFVTCVKFHPNDDRFFISGCLDHKARLWSILDDEVSFEFDCGDL
Sbjct: 421 LWHCDRKQLLKNFPHPDFVTCVKFHPNDDRFFISGCLDHKARLWSILDDEVSFEFDCGDL 480

Query: 481 ITSLEVSPGDSKYTILGTFNGYVIVLLTRGLEHVYSFHLSDKQDKKGKDVTTRDLPTSRT 540
           ITSLEVSPGDSKYTILGTFNGYVIVLLTRGLEHVYSFHLSDKQDKKGKDVTTRDLPTSRT
Sbjct: 481 ITSLEVSPGDSKYTILGTFNGYVIVLLTRGLEHVYSFHLSDKQDKKGKDVTTRDLPTSRT 540

Query: 541 NTHHGPKVTGIECFRAVNDMTLKLLVTSNDSKIRVFNLKDNILQEVLKGFENESSQISAH 600
           NTHHGPKVTGIECFRAVNDMTLKLLVTSNDSKIRVFNLKDNILQEVLKGFENESSQISAH
Sbjct: 541 NTHHGPKVTGIECFRAVNDMTLKLLVTSNDSKIRVFNLKDNILQEVLKGFENESSQISAH 600

Query: 601 LITGSKNKQQFVIAPSEDHWIYCWKLQSSLMTKDKDKEHAAGKNXXXXXXXXXXXXXXXX 660
           LITGSKNKQQFVIAPSEDHWIYCWKLQSSLMTKDKDKEHAAGKN                
Sbjct: 601 LITGSKNKQQFVIAPSEDHWIYCWKLQSSLMTKDKDKEHAAGKNSLPRSGSLRGLLHRKL 660

Query: 661 XIGSNHSDSNRSFSKSQKSXXXXXXXXXXXXSRENQHLKNNEYIAFHAHHHPLTTAIAAP 720
            IGSNHSDSNRSFSKSQKS            SRENQHLKNNEYIAFHAHHHPLTTAIAAP
Sbjct: 661 SIGSNHSDSNRSFSKSQKSHYHHLHLPHPHHSRENQHLKNNEYIAFHAHHHPLTTAIAAP 720

Query: 721 PETARTLSLSNDFICELTMEFCEDYDDVRIVNTYNXXXXXXXXXDADIAQEDDACDNDGD 780
           PETARTLSLSNDFICELTMEFCEDYDDVRIVNTYN         DADIAQEDDACDNDGD
Sbjct: 721 PETARTLSLSNDFICELTMEFCEDYDDVRIVNTYNKKQKQKKKKDADIAQEDDACDNDGD 780

Query: 781 VGTNPRRIPTVDEFIGAILVTSDDNGVIRVFRSDISTNIRKRVLAKLQEEDVKDATDKKN 840
           VGTNPRRIPTVDEFIGAILVTSDDNGVIRVFRSDISTNIRKRVLAKLQEEDVKDATDKKN
Sbjct: 781 VGTNPRRIPTVDEFIGAILVTSDDNGVIRVFRSDISTNIRKRVLAKLQEEDVKDATDKKN 840

Query: 841 RNSVSISEVNDEIASAVHALGNLTTNTVKAATAGFNKSCPMGNYSHXXXXXXXXXXXXXX 900
           RNSVSISEVNDEIASAVHALGNLTTNTVKAATAGFNKSCPMGNYSH              
Sbjct: 841 RNSVSISEVNDEIASAVHALGNLTTNTVKAATAGFNKSCPMGNYSHSNSVLSLSTMRSSK 900

Query: 901 XXXXXXIPSSQETTTEHVLPAASDSQMRCDVCGGVNFNVMKPMRSTDLRTVGFFCTDCGN 960
                 IPSSQETTTEHVLPAASDSQMRCDVCGGVNFNVMKPMRSTDLRTVGFFCTDCGN
Sbjct: 901 SSTAQSIPSSQETTTEHVLPAASDSQMRCDVCGGVNFNVMKPMRSTDLRTVGFFCTDCGN 960

Query: 961 QVSNFR 966
           QVSNFR
Sbjct: 961 QVSNFR 966

>Kwal_26.7655
          Length = 743

 Score =  530 bits (1364), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 301/685 (43%), Positives = 397/685 (57%), Gaps = 77/685 (11%)

Query: 199 LGSINRKQFEQYLKEPEYIKVFKKRKGLKQFRRFFLAQELKIGTSPVNSNVGTNNVDGIP 258
            G INR+QF QYLKEP+Y+KVF ++  +KQFRR FLAQEL++  S + S+  T       
Sbjct: 113 FGRINREQFHQYLKEPKYLKVFNRQPRVKQFRRLFLAQELRLHASDLTSSSSTTLS---- 168

Query: 259 HVXXXXXXXXXXXXXXXXXXXXXXXXXXXXMKFSKDGRFLATGGKDRILRIWKVIASPTE 318
                                          KFS+DG+++ATGGKD  LR+WKVIASP E
Sbjct: 169 ------------------TLSENSDRAVWATKFSRDGKYMATGGKDCTLRVWKVIASPLE 210

Query: 319 RLELDSSTMKPSKTVCMLNGKLISYSRDVPQSGFARTENGDNPEDDSLDTNGMFPDESLN 378
           R +L S+T KP         K IS    VP S        + PE             S++
Sbjct: 211 RNDLSSATAKP-------QAKRISMR--VPPSPTVGRSVKEEPEQP-------IGPASMD 254

Query: 379 LYAPVFHPLPYRSFLGHNQDILDIDWSKNNFVLTGSMDKTVKLWHCDRKQLLKNFPHPDF 438
           LYAPVFHPLP+R +  H QDILD+DWSKN F+LT SMDKT +LWHCDR + LK F HPDF
Sbjct: 255 LYAPVFHPLPFRIYQEHTQDILDLDWSKNGFILTTSMDKTARLWHCDRPKALKVFTHPDF 314

Query: 439 VTCVKFHPNDDRFFISGCLDHKARLWSILDDEVSFEFDCGDLITSLEVSPGDSKYTILGT 498
           VTC KFHPNDDRFFISGCLDH  RLWSILD+ VSF++ CGD+IT+++ SP D KYT  GT
Sbjct: 315 VTCAKFHPNDDRFFISGCLDHTLRLWSILDNSVSFDYYCGDIITAIDTSPRDGKYTAAGT 374

Query: 499 FNGYVIVLLTRGLEHVYSFHLSDKQDKKGKDVTTRDLPTSRTNTHHGPKVTGIECFRAVN 558
           FNG++I+L TRGLE V +FH+ +K +      TT+ +P S      GPK+TGIE F++  
Sbjct: 375 FNGHIIILYTRGLEMVSTFHVLEKPNG-----TTKKVPES------GPKITGIEFFKSAP 423

Query: 559 DMTLKLLVTSNDSKIRVFNLKDNILQEVLKGFENESSQISAHLITGSKNKQQFVIAPSED 618
           D  L+++VTSNDS+IR+F +K   L EVLKGFEN  SQISAHLI    +K+ FV+APSE+
Sbjct: 424 DNDLRIMVTSNDSRIRIFRIKGQSLLEVLKGFENTHSQISAHLIL-PPSKKIFVLAPSEN 482

Query: 619 HWIYCWKLQSSLMTKDKDKEHAAGKNXXXXXXXXXXXXXXXXXIGSNHSDSNRSFSKSQK 678
            W+YCW+++SS    + D     G +                 IGS+ S   + + K+  
Sbjct: 483 QWVYCWRVESSAGVSNSDDSQNNGTH---RRGSIRGLLQRSLSIGSSQSPERQEY-KNGS 538

Query: 679 SXXXXXXXXXXXXSRENQHLKNNEYIAFHAHHHPLTTAIAAPPETARTLSLSNDFICELT 738
                        S+ +Q++KN  YIAFHAH   +TT   AP  T +TL+LS+DFICELT
Sbjct: 539 HSHSLHLPSPTAKSKGDQYIKNQHYIAFHAHRCTVTTTAVAPVNTNKTLALSDDFICELT 598

Query: 739 MEFCEDYDDVRIVNTYNXXXXXXXXXDADIAQEDDACDNDGDVGTNPRRIPTVDEFIGAI 798
           M   E  +DV  +                +         D D+    RR P++ + IG I
Sbjct: 599 MALSETDEDVAFLKQQRRK---------SLIHSKKGSQKDRDLME--RRFPSMIDAIGTI 647

Query: 799 LVTSDDNGVIRVFRSDISTNIRKRVLAKLQEEDVKDATDKKNRNSVSISEVNDEIASAVH 858
           +V++D++G+IRVFRSDISTN+RK+VL  L+E      +             +D     VH
Sbjct: 648 VVSTDNSGIIRVFRSDISTNVRKKVLKCLKESSTPPMSGSS----------SDSNGPNVH 697

Query: 859 ALGNLTTNTVKAATAGFNKSCPMGN 883
           A  +L  +TVKAAT+ F KS  +G+
Sbjct: 698 A--SLLGSTVKAATSTFVKSRNLGS 720

>YMR102C (YMR102C) [4060] chr13 complement(469847..472351) Protein
           containing six WD domains (WD-40 repeat), which may
           mediate protein-protein interactions, has moderate
           similarity to S. cerevisiae Ykl121p, which binds
           phosphatidylinositol [2505 bp, 834 aa]
          Length = 834

 Score =  507 bits (1306), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 329/873 (37%), Positives = 455/873 (52%), Gaps = 115/873 (13%)

Query: 114 YSADIAPLRFKMSMTRLDN-AAAVKPVGQRPIAKPIVLDSLAAGRRLDSTDRNNIAVKPD 172
           YSADI PL+F+M+ T   N        G    +   + + L  G  L+S  R N      
Sbjct: 57  YSADIEPLKFRMTKTNNTNDKLKYSNNGNATDSFMRLKEHLQRGNTLNSNLRVN------ 110

Query: 173 KISRVTKNPTKFVLDKDLYRFHHGSTLGSINRKQFEQYLKEPEYIKVFKKRKGLKQFRRF 232
                           + Y F+      SI+ +QFE YL+EP+YIK+ K+RK LKQFRR 
Sbjct: 111 ----------------EFYPFN------SIDTEQFENYLREPKYIKMLKRRKNLKQFRRL 148

Query: 233 FLAQELKIGTSPVNSNVGTNNVDGIPHVXXXXXXXXXXXXXXXXXXXXXXXXXXXXMKFS 292
           FLAQEL    +     V + +    P                               KFS
Sbjct: 149 FLAQEL---MAYEGETVTSTSKSSEP-----------------------TSKAIWSTKFS 182

Query: 293 KDGRFLATGGKDRILRIWKVIASPTERLELDSS--TMKPSKTVCMLNGKLISYSRDVPQS 350
           +DG+F+ATG KD  +RIWKVI SP ER ELDSS  + K ++   M   + +S   +  + 
Sbjct: 183 RDGKFMATGSKDGKIRIWKVIGSPVERAELDSSAESNKEARAKSMRIKQQVSSLNNPKEK 242

Query: 351 GFARTENGDNPEDDSLDTNGMFPDESLNLYAPVFHPLPYRSFLGHNQDILDIDWSKNNFV 410
            F  +      E + L          LNLYAPVFHP P R +  H QD+LDI+WSKNNF+
Sbjct: 243 QFLDSATEKYEEKEKL----------LNLYAPVFHPTPLRLYKEHVQDVLDINWSKNNFI 292

Query: 411 LTGSMDKTVKLWHCDRKQLLKNFPHPDFVTCVKFHPNDDRFFISGCLDHKARLWSILDDE 470
           L+ SMDKTVKLWH DRK  LK F HPDFVTCV+FHP DDRFFISGCLDHK RLWSILDDE
Sbjct: 293 LSASMDKTVKLWHPDRKNSLKTFIHPDFVTCVEFHPTDDRFFISGCLDHKCRLWSILDDE 352

Query: 471 VSFEFDCGDLITSLEVSPGDSKYTILGTFNGYVIVLLTRGLEHVYSFHLSDKQDKKGKD- 529
           VSFE+DC DLITS+ +SP + KYTI+GTFNGYV +L+TRGL  V SFH++D+Q ++    
Sbjct: 353 VSFEYDCQDLITSVTLSPEEGKYTIIGTFNGYVHILMTRGLTPVSSFHVADRQTQEQNAH 412

Query: 530 --VTTRDLPTSRTNTHHGPKVTGIECFRAVNDMTLKLLVTSNDSKIRVFNLKDNILQEVL 587
             VT  D     +   HGP+VTG++ FR+  D + +L+VTSNDS+IR+F+L+   L EVL
Sbjct: 413 VMVTETD-----SKIRHGPRVTGLQAFRSQLDNSFRLVVTSNDSRIRIFDLEQRKLLEVL 467

Query: 588 KGFENESSQISAHLITGSKNKQQFVIAPSEDHWIYCWKLQSSLMTKDKDKEHAAGKNXXX 647
           KGF + SSQ  A L     + Q  V+  S+DHW+Y W+L+SS    D+D+     K    
Sbjct: 468 KGFHSGSSQHKAQLSIW--HGQPIVVNSSDDHWVYGWRLKSSDRENDQDEPKRKPKGLAR 525

Query: 648 XXXXXXXXXXXXXXIGSNHSDSNRSFSKSQKSXXXXXXXXXXXXSRENQHLKNNEYIAFH 707
                           S +++      +                   + ++KN +YI+FH
Sbjct: 526 SGSLRSIFSKSMSRSSSQNNE------EKPHHHLKLTNLLPLPHHSNDHYIKNTDYISFH 579

Query: 708 AHHHPLTTAIAAPPETARTLSLSNDFICELTMEFCEDYDDVRIVNTYNXXXXXXXXXDAD 767
           AH+ P+T    APPET++TLSLSND ICEL++EF +  D   +++  N          +D
Sbjct: 580 AHNAPVTCVSIAPPETSKTLSLSNDVICELSLEFFQTSDSFDVLSRSNDDGIM-----SD 634

Query: 768 IAQEDDACDNDGDV--GTNPRRIPTVDEFIGAILVTSDDNGVIRVFRSDISTNIRKRVLA 825
           +          G +   +    IP V + IG IL+++D+ G IRVFR+D+ + IRKRVL 
Sbjct: 635 VESSLGYNSKPGSISNASATSAIPDVVDAIGTILISTDNVGTIRVFRADMPSVIRKRVLL 694

Query: 826 KLQEEDVK-----DATD-----KKNRNSVSISEVNDEIASAVHALGNLTTNTVK--AATA 873
           KL+E + +     +++D      ++ NS + S +  + A+A        TNT K  A   
Sbjct: 695 KLEEYNREVRRRFNSSDSLHSLSRSFNSRAKSNLAGQPAAAY-------TNTGKGYATGR 747

Query: 874 GFNKSCPMGNYSHXXXXXXXXXXXXXXXXXXXXIPSSQETTTEHVLPAASDSQMRCDVCG 933
           G++  CP  + S                       +   TT      +A +  +RC+VC 
Sbjct: 748 GYSNICPKSSTSLKTLGSNAQPRTPRESMSSIFSNAHGPTTPT----SAMNLPIRCNVCN 803

Query: 934 GVNFNVMKPMRSTDLRTVGFFCTDCGNQVSNFR 966
           G  F       + D +   ++C DCG  V+NFR
Sbjct: 804 GSRFEAFSG--ANDQQDRNYYCVDCGTVVNNFR 834

>Scas_721.128
          Length = 851

 Score =  487 bits (1254), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 314/880 (35%), Positives = 448/880 (50%), Gaps = 112/880 (12%)

Query: 114 YSADIAPLRFKMSMTRLDNAAAVKPVGQRPIAKPIVLDSLAAGRRLDSTDRNNIAVKPDK 173
           YSAD+ PL+FKM+ T                     L+ + +  +  S D ++     ++
Sbjct: 57  YSADLQPLKFKMTRTP-------------------DLEEVPSHVKTASADVDSFYKVRNR 97

Query: 174 ISRVTKNPTKFVLDKDLYRFHHGSTLGSINRKQFEQYLKEPEYIKVFKKRKGLKQFRRFF 233
           + ++      F                SI+++QFE YLKEPEYIKVFKK + L++F+R F
Sbjct: 98  LQKIADPSWNF---------------SSIDQEQFEIYLKEPEYIKVFKKHEDLEEFKRLF 142

Query: 234 LAQELKIGTSPVNSNVGTNNVDGIPHVXXXXXXXXXXXXXXXXXXXXXXXXXXXXMKFSK 293
           LAQEL + T+  N     N                                    +KFS 
Sbjct: 143 LAQELNVTTTKENDPTAQN--------------------------TDASNKAIWTLKFSH 176

Query: 294 DGRFLATGGKDRILRIWKVIASPTERLELDSSTMKPSKTVCMLNGKLISYSRDVPQSGFA 353
           DG+++ATG KD  + +WKVI+SP ER ELD +  + S  V M     I  + +  ++   
Sbjct: 177 DGKYMATGSKDGCVMLWKVISSPVERWELDRA--EESNLVAMAKSIRIKQNLETNEAHL- 233

Query: 354 RTENGDNPEDDSLDTNGMFPDESLNLYAPVFHPLPYRSFLGHNQDILDIDWSKNNFVLTG 413
                + P     DTN     ESLNLYAP+FHP P R +  H+ DILD+DWSKNNF+LT 
Sbjct: 234 -----NAPSRPPTDTNL----ESLNLYAPIFHPNPVRIYKEHSHDILDLDWSKNNFLLTA 284

Query: 414 SMDKTVKLWHCDRKQLLKNFPHPDFVTCVKFHPNDDRFFISGCLDHKARLWSILDDEVSF 473
           SMDK V LWH DR+  LK+FPHPDFVT V+FHP DDRFF+SGCLDHK R+WSIL+++V +
Sbjct: 285 SMDKLVSLWHPDRETSLKSFPHPDFVTSVRFHPKDDRFFVSGCLDHKCRMWSILENKVVY 344

Query: 474 EFDCGDLITSLEVSPGDSKYTILGTFNGYVIVLLTRGLEHVYSFHLSDK--QDKKGKDVT 531
           EFDC DLIT++ +SPG  ++TI+GTFNGY+ +L T  L+ +Y+FH+ DK  Q   G D +
Sbjct: 345 EFDCQDLITAISISPGVGEFTIIGTFNGYITILSTFELKPLYTFHVLDKHMQGNSGNDSS 404

Query: 532 TRDLPTSRTNTHHGPKVTGIECFRAVNDMTLKLLVTSNDSKIRVFNLKDNILQEVLKGFE 591
            ++L       HHGP+VTG++ F       LKLLV+S DS+IR+F+L+ N L EV KGF 
Sbjct: 405 FKNLLGQNLKNHHGPRVTGLQLFLEKETDDLKLLVSSTDSRIRIFDLEKNKLIEVFKGFR 464

Query: 592 NESSQISAHLITGSKNKQQFVIAPSEDHWIYCWKLQSSLMTKDKDKEHAAGKNXXXXXXX 651
           +  SQ +A L   +   Q  VI  S+DHW Y WK+ +S     ++      +        
Sbjct: 465 SGLSQHNAQL--SNWGDQPIVINSSKDHWFYAWKINTSNPKTTQNFSSIRQERLSTGGGL 522

Query: 652 XXXXXXXXXXIGSNHSDSNRSFSKSQKSXXXXXXXXXXXXSRENQHLKNNEYIAFHAHHH 711
                       + H  S  S +    +               +  +KN+ Y+AFHAHH 
Sbjct: 523 NDLLNKSSEKKETTHELSRTSTAGDSSTRHHFLPSLSRLLPHSSHVVKNSHYVAFHAHHA 582

Query: 712 PLTTAIAAPPETARTLSLSNDFICELTMEFCEDYDDVRIVNTYNXXXXXXXXXDADIAQE 771
           P++TA  AP ETA+TLSLSNDFICELT++  E   D+R   T            + + ++
Sbjct: 583 PVSTATIAPQETAKTLSLSNDFICELTLQVME---DIRKTTT---GSSDSSNGRSSVDKK 636

Query: 772 DDACDNDGDVGTNPRRIPTVDEFIGAILVTSDDNGVIRVFRSDISTNIRKRVLAKLQE-- 829
            +A +    + T    IP     IG ILVT+D  G IRVFR D+S   R RVL KLQ+  
Sbjct: 637 KNASEK--SLPTVTSGIPDAVNAIGPILVTTDTRGTIRVFRVDMSNATRSRVLKKLQDYK 694

Query: 830 ---EDVKDATDKKNRNSVSISE--VNDEIASAVHAL---------GNLTTNTVKAATAGF 875
              +D+ D+    N  + S SE  +N      V+++         G+ T  +V+   +  
Sbjct: 695 QNSQDIIDSATTLNPLNASDSEGAINTTPLIQVNSIPQRSRTNQNGSQTNGSVQRNGSIS 754

Query: 876 NKSCPMGNYSHXXXXXXXXXXXXXXXXXXXXIPSSQETTTEHVLPAASD-------SQMR 928
           N     G  S                        S++ + + V+  A +       S+++
Sbjct: 755 NNGTGTGPKSPRPSTSFTNAIFNRSNSSFSSSNRSRKPSIQSVMSDAEELHHGSRPSRLK 814

Query: 929 CDVCGGVNFNVMKPMRSTDL--RTVGFFCTDCGNQVSNFR 966
           CDVC G+NF   +P+    L  R  G++C DCG  ++NFR
Sbjct: 815 CDVCDGINF---EPLSKNLLGQRENGYYCVDCGTILNNFR 851

>CAGL0K03377g complement(306529..309465) similar to sp|Q03177
           Saccharomyces cerevisiae YMR102c, hypothetical start
          Length = 978

 Score =  486 bits (1250), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 329/926 (35%), Positives = 475/926 (51%), Gaps = 111/926 (11%)

Query: 114 YSADIAPLRFKMS---MTRLDNAAAVKPV--------GQRPIAKPIVLD--SLAAGRRLD 160
           YSADI PL+FKMS    T+ D   + K          G  PI K +  D  SL++     
Sbjct: 91  YSADIQPLQFKMSRRRTTQFDGTESSKASRKANASGNGSDPI-KTLRFDEGSLSSSPTAI 149

Query: 161 STDRNNIAVKPDKISRVTKNPTKFVLDKDLYRFHHGSTLGSINRKQFEQYLKEPEYIKVF 220
           ++D    +++ D  ++V ++  +  +          +    I+R+QFE YLKEP YI++F
Sbjct: 150 ASDATRASLQRDTFAKVREHIQRGSVGNSGLTRSDFNPFAFIDREQFETYLKEPRYIRIF 209

Query: 221 KKR-KGLKQFRRFFLAQE-----------------------LKIGTSPVNSNVGTNNV-D 255
           KKR +  KQFRR FLAQE                       LK  TS  N+ +  NN  D
Sbjct: 210 KKRSRSSKQFRRLFLAQELKTTDEFDDIEAMSASLLSQPDGLKPNTSITNATLNGNNFHD 269

Query: 256 GI--PHVXXXXXXXXXXXX-----XXXXXXXXXXXXXXXXMKFSKDGRFLATGGKDRILR 308
            I  P+                                   KFS DG+++ATG +D +LR
Sbjct: 270 NINDPNHDMHSDKTFSGTACPVLPTSGHLEPAKNTKAIWSTKFSIDGKYMATGSRDGVLR 329

Query: 309 IWKVIASPTERLELDSSTMKPSKTVCMLNGKLISYSRDVPQSGFARTENGDNPEDDSLDT 368
           +WKV+++P ER  LDSS      +  + + K +   ++   S             D+ D 
Sbjct: 330 LWKVLSTPVERWGLDSSI----DSAHLTSAKSLRLQQNQHGSSHGGPLGSPAMRRDTFD- 384

Query: 369 NGMFPDESLNLYAPVFHPLPYRSFLGHNQDILDIDWSKNNFVLTGSMDKTVKLWHCDRKQ 428
           N    + S NLYAPVF P P R++  H  D+LD+DWSKNNF+++ SMDKT KLWH  + +
Sbjct: 385 NIDAKENSSNLYAPVFQPTPVRTYKEHLHDVLDMDWSKNNFLISASMDKTAKLWHPSKMR 444

Query: 429 LLKNFPHPDFVTCVKFHPNDDRFFISGCLDHKARLWSILDDEVSFEFDCGDLITSLEVSP 488
            LK+F HPDFVTCVKFHP DDRFFISGCLD K RLWSILDDEVSFEF+C DL+TSL ++P
Sbjct: 445 SLKSFQHPDFVTCVKFHPTDDRFFISGCLDQKCRLWSILDDEVSFEFNCRDLVTSLTLTP 504

Query: 489 GDSKYTILGTFNGYVIVLLTRGLEHVYSFHLSDKQDKKGKDVTTRDLPTSRTNTHHGPKV 548
           GD  YTI+GTFNGY+ VL T+GLEH+ SFH++ K  K  ++      P++ +   HGP+V
Sbjct: 505 GDGTYTIVGTFNGYIHVLQTKGLEHITSFHVTAK--KTHENTHEVLCPSNDSKVRHGPRV 562

Query: 549 TGIECFRAVNDMTLKLLVTSNDSKIRVFNLKDNILQEVLKGFENESSQISAHLITGSKNK 608
           TG++CF ++ D +L+L+VTS+DS+IRVF+L    L E+L+GF+  SSQ  A  I+  +N 
Sbjct: 563 TGLQCFNSLIDNSLRLVVTSSDSRIRVFDLTRRKLIEILRGFQCGSSQHKAQ-ISVYRN- 620

Query: 609 QQFVIAPSEDHWIYCWKLQSS--LMTKDKDKEHAAGKNXXXXXXXXXXXXXXXXXIGSNH 666
           Q  VI  S+DHW+Y W+L+SS  +    K K+H   ++                    + 
Sbjct: 621 QPIVINSSDDHWVYGWRLKSSDPVEINKKAKKHGMSRSGSIRGLFSKSISRSSSQGSEDR 680

Query: 667 SDSNRSFSKSQKSXXXXXXXXXXXXSRENQHLKNNEYIAFHAHHHPLTTAIAAPPETART 726
                +   S               S  +  +KN++Y +FHAH+ P+TT   AP ET++T
Sbjct: 681 QSLRNTLKLSS-------LLPIPHSSHSDGVMKNSDYFSFHAHNAPVTTVTMAPEETSKT 733

Query: 727 LSLSNDFICELTMEFCEDYDDVRIVNTYNXXXXXXXXXDADIAQEDDACDNDGDVGTNPR 786
           LSLSND ICEL++EF E  D+V I+             D      D+       V T+  
Sbjct: 734 LSLSNDPICELSLEFFEPSDEVDIIK----------LKDTQKGGHDNIPATKTPVTTSLA 783

Query: 787 RIPTVDEFIGAILVTSDDNGVIRVFRSDISTNIRKRVLAKLQEEDVKDATDKKNRNSVSI 846
           + PT  E IG+IL+++D NG+IRVFR+D+S +IR RVL KLQ+ + +    K+  ++ S+
Sbjct: 784 K-PTPVEVIGSILISTDSNGLIRVFRADMSKSIRARVLQKLQKYNRE--MGKQYGSTDSL 840

Query: 847 SEVNDEIASAVHALGNL-TTNTV-----------------KAATAGFNKS--------CP 880
              ND+    +  +G+  +TN+                    A+   N S         P
Sbjct: 841 VSENDKSRPNLGTVGHQPSTNSTSFLSSTGSTNTTTVGSGSKASITRNHSFRSLKAFKSP 900

Query: 881 MGNYSHXXXXXXXXXXXXXXXXXXXXIPSSQETTTEHVLPAASDSQMRCDVCGGVNFNVM 940
             N+S+                    I S +  +T + +   S   ++C VC G  F  +
Sbjct: 901 TANFSN------TALGATMNRAPRESISSVRSDSTSNTMTPMSFPGLKCHVCDGTKFEPL 954

Query: 941 KPMRSTDLRTVGFFCTDCGNQVSNFR 966
              RS+  +   +FC DC   ++NFR
Sbjct: 955 --TRSSGSQDKSYFCVDCKTLLNNFR 978

>KLLA0B12804g 1117475..1120033 weakly similar to sp|Q03177
           Saccharomyces cerevisiae YMR102c, hypothetical start
          Length = 852

 Score =  439 bits (1130), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 298/850 (35%), Positives = 415/850 (48%), Gaps = 146/850 (17%)

Query: 202 INRKQFEQYLKEPEYIKVFKKRKGLKQFRRFFLAQELKIGTSPVNSNVGTNNVDGIPHVX 261
           +  + F+++LK  E++KV++K+KG KQFRR  LAQEL+   +    +  +N         
Sbjct: 64  VGNEDFKRHLKTGEHMKVYRKKKGFKQFRRLILAQELRPFGNEFQDSSSSNE-------- 115

Query: 262 XXXXXXXXXXXXXXXXXXXXXXXXXXXMKFSKDGRFLATGGKDRILRIWKVIASPTERLE 321
                                      ++FS DG+F+AT GKD ILRIWKVI+SP ERLE
Sbjct: 116 -----------KGTATEPMKNGGAVWCIRFSHDGKFMATAGKDEILRIWKVISSPAERLE 164

Query: 322 LDSSTMK----PSKTVCMLNGKLISYSRDVPQ----SGFARTE---------NGDN---- 360
           L+  ++      +  +  LNG+L  Y  D       SG + T          N D     
Sbjct: 165 LNQHSISFLKSTANAISQLNGQLAQYGGDTDSASLNSGSSNTHVDSLGSSNANRDGFSTK 224

Query: 361 --PEDDSLDTNG-MFPDESLNLYAPVFHPLPYRSFLGHNQDILDIDWSKNNFVLTGSMDK 417
             P++    T G   P    + Y  VFHP P  +F  H  DILDIDWSKN+F+LTGSMDK
Sbjct: 225 AVPQEQQGQTQGHRHPYGLGDSYCGVFHPNPLVTFHEHTDDILDIDWSKNSFILTGSMDK 284

Query: 418 TVKLWHCDRKQLLKNFPHPDFVTCVKFHPNDDRFFISGCLDHKARLWSILDDEVSFEFDC 477
           + KLWHC R   LK F H DFVT V+FHP DDRFF+S CLD K RLWSIL+ +V FE+DC
Sbjct: 285 SCKLWHCARPTSLKTFVHSDFVTAVRFHPEDDRFFLSACLDQKCRLWSILEKQVIFEYDC 344

Query: 478 GDLITSLEVSPGDSKYTILGTFNGYVIVLLTRGLEHVYSFHLSDKQD--KKGKDVTTRDL 535
           GDLIT++++S  D  YTILGTFNGY+ VL+T+ LE ++SF++ DK    KK    + R  
Sbjct: 345 GDLITAMDISY-DGNYTILGTFNGYIHVLITKSLELLFSFNVLDKDSELKKCHRTSRRLK 403

Query: 536 PTSRTNTHHGPKVTGIECFR--------AVNDMTLKLLVTSNDSKIRVFNLKDNILQEVL 587
             S     +GPK+TG+E  +        +  D++   LV+SNDS+IR++ L    +  V+
Sbjct: 404 KQSSDKAKNGPKITGLEFIQKDARNYKISSKDVSDWFLVSSNDSRIRIYTLNQEFV-SVM 462

Query: 588 KGFENESSQISAHLITGSKNKQQFVIAPSEDHWIYCWKLQSSLM----TKDKDKEHAAGK 643
           KG  NE SQI+AH  T +++ + +V++ SEDHWIYCWKL   ++    T  KD +    +
Sbjct: 463 KGHSNEHSQITAH-STVTRSGKAYVVSGSEDHWIYCWKLSDEVVKSTETSSKDSKSTRSR 521

Query: 644 NXXXXXXXXXXXXXXXXXIGSNHSDSNRSFSKSQKSXXXXXXXXXXXXSR----ENQHLK 699
                                  S S RSF + + +            SR     +Q   
Sbjct: 522 -----------------------SGSLRSFCRRRNNDSVASETLDAVLSRGYTKNHQVSS 558

Query: 700 NNEYIAFHAHHHPLTTAIAAPPETARTLSLSNDFICELTMEFCEDYDDV----------- 748
           N+ YI FHAHHHP+T A A P +  + LSLSND ICELTM+F E  DD            
Sbjct: 559 NSNYIGFHAHHHPITCATAVPMQVTKVLSLSNDLICELTMQFWETTDDFTMESASKNARA 618

Query: 749 ------------------RIVNTYNXXXXXXXXXDADIAQEDDACD---NDGD------- 780
                             R ++                AQ ++  +   +DGD       
Sbjct: 619 KKNGNAISSNDGQKTDCRRKISIDKTIPNVKGKSGVSGAQSNNVPNIQISDGDNRTTNAV 678

Query: 781 VGTNPRRIPTVDEFIGAILVTSDDNGVIRVFRSDISTNIRKRVLAKLQEEDVKDATDK-- 838
            GT     P++ EFIG I+V++D  GVIRVFRSDIS+N+RK+VL +L      +A +K  
Sbjct: 679 NGTTAANPPSLIEFIGGIVVSADTTGVIRVFRSDISSNVRKKVLNRL------NAIEKQL 732

Query: 839 KNRNSVSISEVNDEIASAVHAL-GNLTTNTVKAATAGFNKSCPMGNYSHXXXXXXXXXXX 897
           K     S+      ++S   A  G+L+T T              G+  H           
Sbjct: 733 KENGEGSVKPRTSGVSSVAAATNGSLSTATTFVGN---------GSNGHNVHSIERPTPF 783

Query: 898 XXXXXXXXXIPSSQETTTEHVLPAASDSQMRCDVCGGVNFNVMKPMRSTDL-RTVGFFCT 956
                      SS   TT       S S++ C+VCGG  F   + +      + V ++C 
Sbjct: 784 PMQDSLPLVDESSSSLTTLQQQQPHSQSRV-CNVCGGTRFATDQTLSFNQAPQNVKYYCL 842

Query: 957 DCGNQVSNFR 966
           DCG   ++ R
Sbjct: 843 DCGALYTSLR 852

>ABL024W [568] [Homologous to ScYMR102C - SH; ScYKL121W - SH]
           complement(353684..355888) [2205 bp, 734 aa]
          Length = 734

 Score =  414 bits (1064), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 271/775 (34%), Positives = 390/775 (50%), Gaps = 106/775 (13%)

Query: 207 FEQYLKEPEYIKVFKKRKGLKQFRRFFLAQELKIGTSPVNSNVGTNNVDGIPHVXXXXXX 266
             ++  EPEYIKV  ++KG + FRR F+AQEL+    PV+S +  N+             
Sbjct: 51  LRRFAAEPEYIKVLARKKGARCFRRLFVAQELQ---PPVDSPLHANH------------- 94

Query: 267 XXXXXXXXXXXXXXXXXXXXXXMKFSKDGRFLATGGKDRILRIWKVIASPTER---LELD 323
                                 ++FSKDG++LA+GGK R L +WKVIASP ER   L + 
Sbjct: 95  --SSQSLGQAAPAGDKARSVWLLRFSKDGKYLASGGKGRQLCVWKVIASPMERWNLLPVY 152

Query: 324 SSTMKPSKTVCMLNGKLISYS----RDVPQSGFARTENGDNPEDDSLDTNGMFPDESLNL 379
                 S T+ +LN +L+ YS      VP  G  R E                P +    
Sbjct: 153 GGDKHHSNTLSLLNQQLLKYSGKRTEAVPAPGPERKE---------------IPFDLEQQ 197

Query: 380 YAPVFHPLPYRSFLGHNQDILDIDWSKNNFVLTGSMDKTVKLWHCDRKQLLKNFPHPDFV 439
           YAPVFHP P+R F  H QDILD DWSKN+F+LT SMDKTVKLWH +R   LK F HPDFV
Sbjct: 198 YAPVFHPDPHRVFGEHLQDILDCDWSKNSFLLTASMDKTVKLWHINRTTSLKTFVHPDFV 257

Query: 440 TCVKFHPNDDRFFISGCLDHKARLWSILDDEVSFEFDCGDLITSLEVSPGDSKYTILGTF 499
           TCV+FHP+DDRFF SGCLDH  R WSIL+ EV+  F+CGDLI +L+VSP D  + ++GTF
Sbjct: 258 TCVRFHPHDDRFFFSGCLDHTVRTWSILEGEVAEAFNCGDLIMALDVSP-DGNWLLIGTF 316

Query: 500 NGYVIVLLTRGLEHVYSFHLSDKQDKKGKDVTTRDLPTSRTNTHHGPKVTGIECFRAVND 559
           NGYV VL T GL+ ++SFHL  K ++      T + P       HGPK+TG+E  R    
Sbjct: 317 NGYVHVLHTNGLKLLHSFHLLQKPNE------TENRP------RHGPKITGVEFIRHKAY 364

Query: 560 MTLKLLVTSNDSKIRVFNLKDNILQEVLKGFENESSQISAHLITGSKNKQQFVIAPSEDH 619
             L LL+TSNDS++R+F++    L E+ +GF NESS+ISAH +   ++ +  V++ SE+H
Sbjct: 365 PWLGLLITSNDSRVRLFDMSTTRLLEIFRGFSNESSRISAHHLE-MEDGESVVLSASENH 423

Query: 620 WIYCWKL-QSSLMTKDKDKEHAA-------GKNXXXXXXXXXXXXXXXXXIGSNHSDSNR 671
           W+Y W L     M    D ++A        GK+                   S +SD   
Sbjct: 424 WLYTWMLHHEEYMYSHSDLDNARTVPSPIDGKDPKKHSIRNIFRRSI-----SFNSD--- 475

Query: 672 SFSKSQKSXXXXXXXXXXXXSRENQHLKNNEYIAFHAHHHPLTTAIAAPPETARTLSLSN 731
             S+S                 +   +KN+EYI FHAHH+P+T A  AP ET   LSLS+
Sbjct: 476 ILSESNPVARHHFPLFHHKAQHKGGCVKNSEYITFHAHHNPVTAATIAPKETTHVLSLSD 535

Query: 732 DFICELTMEFCEDYDDVRIVNTYNXXXXXXXXXDADIAQEDDACDNDGDVGTNPRRIPTV 791
           D ICEL M+F    + +  + T +          +D  +   A  N            T 
Sbjct: 536 DIICELNMKF--GGEALEHLRTKSIREPGSPAGRSDHKRNHSAEKNYSQS--------TA 585

Query: 792 DEFIGAILVTSDDNGVIRVFRSDISTNIRKRVLAKLQEEDVKDATDKKNRNSVSISEVND 851
            + +G I+V++   G IRVFR+D+S+++R + L  ++       + ++    V +S +  
Sbjct: 586 KQNVGTIIVSAAATGQIRVFRTDVSSSVRAKALEAIRAAHGLPGSPERPLKPV-LSALAH 644

Query: 852 EIASAVHALGNLTTNTVKAATAGFNKSCPMGNYSHXXXXXXXXXXXXXXXXXXXXIPSSQ 911
            +++ V A G       ++A +    +CP    S                     +   Q
Sbjct: 645 PLSAGV-AKGKHICGDNRSAPS---TTCPRCAPS--------------------AVNGQQ 680

Query: 912 ETTTEHVLPAASDSQMRCDVCGGVNFNVMKPMRSTDLRTVGFFCTDCGNQVSNFR 966
           + +      + S  +  CDVCGG   +V+   ++   +T   +C +CGN ++ F+
Sbjct: 681 DESASTAEQSTSSPKPTCDVCGGQKLSVVG-KKTALQKTKSLYCLECGNHINRFK 734

>Scas_717.68
          Length = 908

 Score =  419 bits (1076), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 247/616 (40%), Positives = 344/616 (55%), Gaps = 42/616 (6%)

Query: 377 LNLYAPVFHPLPYRSFLGHNQDILDIDWSKNNFVLTGSMDKTVKLWHCDRKQLLKNFPHP 436
           LNLYAPVF+P  ++ F  H  D+LD+DWSKNNF++T SMD+TVKLWH +R+  LK F H 
Sbjct: 309 LNLYAPVFNPSCFKIFKEHTADVLDLDWSKNNFLITSSMDRTVKLWHLERQTSLKTFQHQ 368

Query: 437 DFVTCVKFHPNDDRFFISGCLDHKARLWSILDDEVSFEFDCGDLITSLEVSPGDSKYTIL 496
           DFVTCV+FHP DDRFFISGCLDHK RLWSIL++E++FEFDC DLITSL +SPGD KYTI+
Sbjct: 369 DFVTCVRFHPTDDRFFISGCLDHKVRLWSILENEITFEFDCQDLITSLTLSPGDGKYTIV 428

Query: 497 GTFNGYVIVLLTRGLEHVYSFHLSDKQDKKGKDVTTRDLPTSRTNTHHGPKVTGIECFRA 556
           GTFNGYV VLLT+GLE V SFH+ DK         T++  T+ T  HHGP+VTG+ECF+ 
Sbjct: 429 GTFNGYVHVLLTKGLEQVSSFHVVDKN--------TQERNTASTKIHHGPRVTGLECFKY 480

Query: 557 VNDMTLKLLVTSNDSKIRVFNLKDNILQEVLKGFENESSQISAHLITGSKNKQQFVIAPS 616
             D +L+++VTS+DS+IR+F+L+   L E LKGF++ +SQ  A L T     QQ V++ S
Sbjct: 481 EPDNSLRIVVTSSDSRIRIFDLEKKKLLEYLKGFQSGASQHKACLAT--VKGQQVVLSSS 538

Query: 617 EDHWIYCWKLQSSLMTKDKDKEHAAGKNXXXXXXXXXXXXXXXXXIGSNHSDSNRSFSKS 676
           +DHW++ WKL+SS    + +K +   +                   GS  S  ++S  K 
Sbjct: 539 DDHWVHGWKLKSSTSLTESEKNNNIDQTAATTTTTKKSNSHSISRSGSFRSLFSKSSKKD 598

Query: 677 QKSXXXXXXXXXXXXSRENQH-----LKNNEYIAFHAHHHPLTTAIAAPPETARTLSLSN 731
                             + H     +KN++ I+FHAHH P+TTAI AP  TA+TLSLSN
Sbjct: 599 NIDENGKHSHLKLTSLIPHCHNGSTVIKNSDGISFHAHHAPVTTAIVAPSGTAKTLSLSN 658

Query: 732 DFICELTMEFCEDYDDVRIVNTYNXXXXXXXXXDADIAQEDDACDNDGDVGTNPRRIPTV 791
           DFI EL+ EF  +  D  + NT +          +D ++      +   V   P  I  V
Sbjct: 659 DFIYELSSEFAMESRDFEM-NTNSDTHSVTTSGSSDKSKIRSHSSSATLV---PPSISAV 714

Query: 792 DEFIGAILVTSDDNGVIRVFRSDISTNIRKRVLAKLQE---EDVKDATDKKNRNSVSISE 848
           D  IG+I+VT+D+ G+IRVFR+DIS+ IRK+VL  LQ+   E ++      +  +++ + 
Sbjct: 715 D-LIGSIIVTTDNTGIIRVFRADISSTIRKKVLCTLQQCKKESIRSNKSGDSLKTLASAP 773

Query: 849 VNDEIASAVHALGNLTTNTVKAATA----------GFNKSCPMGNYSHXXXXXXXXXXXX 898
                    HA  +      +A ++          G  ++  +   +             
Sbjct: 774 TTVTTGPTGHAKSSFHCPISRAKSSAAVNALALNQGMARAGSISRKTKSSLPFKRASSCT 833

Query: 899 XXXXXXXXIPSS--QETTT------EHVLPAASDSQMRCDVCGGVNFNVMKPMRSTDLRT 950
                   I S   +E+ T      EHV        +RCDVC G+ F  +    S     
Sbjct: 834 NFNNLNFTIGSGSPRESVTSFDIDGEHVTNNPIKMGVRCDVCHGMRFEAITKNVS-GRPD 892

Query: 951 VGFFCTDCGNQVSNFR 966
            G++C DCG  ++NFR
Sbjct: 893 KGYYCMDCGTVLNNFR 908

 Score = 99.8 bits (247), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 72/212 (33%), Positives = 93/212 (43%), Gaps = 43/212 (20%)

Query: 114 YSADIAPLRFKMSMTRLDNAAAVKPVGQRPIAKPIVLDSLAAGRRLDSTDRNNIAVKPDK 173
           YSADI PL+FKM+                             G R    DR +I+     
Sbjct: 49  YSADIKPLQFKMNH--------------------------VPGTR----DRKHISYAAAA 78

Query: 174 ISRVTKNPTKFVLDKDLYRFHHGSTLGSINRKQFEQYLKEPEYIKVFKKRKGLKQFRRFF 233
            S   ++       K  Y F+      SI++ QFE+YL EP YIK+ K+RK LK FRR F
Sbjct: 79  PSSSLRSNGSMKGQKYSYLFN------SIDQDQFEKYLMEPTYIKILKRRKNLKMFRRLF 132

Query: 234 LAQELKIGTSPVNSNVGTNNVDGIPHVXXXXXXXXXXXXXXXXXXXXXXXXXXXXMKFSK 293
           LAQELK        N  TN ++G+                                KFS 
Sbjct: 133 LAQELKAFDDENKINAFTNQINGL-------QSPPLTPTSSSSNLNALADRAIWITKFSL 185

Query: 294 DGRFLATGGKDRILRIWKVIASPTERLELDSS 325
           DG+F+A+ GK  I+R+WKV+ SP ER EL SS
Sbjct: 186 DGKFMASAGKSGIIRVWKVLNSPIERWELGSS 217

>YKL121W (YKL121W) [3144] chr11 (213788..216346) Protein containing
           three WD domains (WD-40 repeat), which may mediate
           protein-protein interactions, has moderate similarity to
           uncharacterized S. cerevisiae Ymr102p [2559 bp, 852 aa]
          Length = 852

 Score =  416 bits (1070), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 282/801 (35%), Positives = 400/801 (49%), Gaps = 97/801 (12%)

Query: 202 INRKQFEQYLKEPEYIKVFKKRKGLKQFRRFFLAQELKIGTSPVNSNVGTNNVDGIPHVX 261
            +RK FE YL+EP YIK+FKK++GL+QF R FLAQELKI          +    G P V 
Sbjct: 113 FDRKYFENYLEEPTYIKIFKKKEGLEQFDRMFLAQELKIPDV-----YKSTTYQGEPAVA 167

Query: 262 XXXXXXXXXXXXXXXXXXXXXXXXXXXMKFSKDGRFLATGGKDRILRIWKVIASPTERLE 321
                                        FS DG+++  G KD  L +WKVI SP +R E
Sbjct: 168 NSELFKNSICC----------------CTFSHDGKYMVIGCKDGSLHLWKVINSPVKRSE 211

Query: 322 LDSSTMKPSKTVCMLNGKLISYSRDVPQSGFARTENGDNPEDDSLDTNGMF--PDESLNL 379
           +  S     K+V       +   R +       + NG    +D L  +  F  P + L+L
Sbjct: 212 MGRS----EKSVSASRANSLKIQRHLAS---ISSHNGSISSND-LKPSDQFEGPSKQLHL 263

Query: 380 YAPVFHPLPYRSFLGHNQDILDIDWSKNNFVLTGSMDKTVKLWHCDRKQLLKNFPHPDFV 439
           YAPVF+   +R F+ H  DILD +WSKN F++T SMDKT KLWH +RK  LK F HPDFV
Sbjct: 264 YAPVFYSDVFRVFMEHALDILDANWSKNGFLITASMDKTAKLWHPERKYSLKTFVHPDFV 323

Query: 440 TCVKFHPNDDRFFISGCLDHKARLWSILDDEVSFEFDCGDLITSLEVSPGDSKYTILGTF 499
           T   F PNDDRF I+GCLDH+ RLWSILD+EVS+ FDC DLITSL +SP   +YTI+GTF
Sbjct: 324 TSAIFFPNDDRFIITGCLDHRCRLWSILDNEVSYAFDCKDLITSLTLSPPGGEYTIIGTF 383

Query: 500 NGYVIVLLTRGLEHVYSFHLSDKQDKKGKDVTTRDLPTSRTNTHHGPKVTGIECFRAVND 559
           NGY+ VLLT GL+ V SFH+SDK   +G    +    +      HGP++TG++CF +  D
Sbjct: 384 NGYIYVLLTHGLKFVSSFHVSDKS-TQGTTKNSFHPSSEYGKVQHGPRITGLQCFFSKVD 442

Query: 560 MTLKLLVTSNDSKIRVFNLKDNILQEVLKGFENESSQISAHLITGSKNKQQFVIAPSEDH 619
             L+L+VT+NDSKI++F+L +    E+ KGF++ SS+     +      +  V   S+DH
Sbjct: 443 KNLRLIVTTNDSKIQIFDLNEKKPLELFKGFQSGSSRHRGQFLM--MKNEPVVFTGSDDH 500

Query: 620 WIYCWKLQSSLMTKDKD------KEHAAGKNXXXXXXXXXXXXXXXXXIGSNHSD--SNR 671
           W Y WK+QS  ++ + +      K+  +G                     +  S+  S+ 
Sbjct: 501 WFYTWKMQSFNLSAEMNCTAPHRKKRLSGSMSLKGLLRIVSNKSTNDECLTETSNQSSSH 560

Query: 672 SFSKSQKSXXXXXXXXXXXXSRENQHLKNNEYIAFHAHHHPLTTAIAAPPETARTLSLSN 731
           +F+ S K+               +Q +KNN YI+FHAH+ P+T A  AP    + LSLSN
Sbjct: 561 TFTNSSKNVLQTQTVG-------SQAIKNNHYISFHAHNSPVTCASIAPDVAIKNLSLSN 613

Query: 732 DFICELTMEFCEDYDDVRIVNTYNXXXXXXXXXDADIAQEDDACDND-----GDVGTNPR 786
           D I ELT ++ ++                      + ++  + CDN       + G    
Sbjct: 614 DLIFELTSQYFKEMGQ-------------------NYSESKETCDNKPNHPVTETGGFSS 654

Query: 787 RIPTVDEFIGAILVTSDDNGVIRVFRSDISTNIRKRVLAKLQEED---VKDATDKKNRNS 843
            +  V   +G IL+T+D  G+IRVFR+DI   IRK+++ K  E +   ++ A    N N+
Sbjct: 655 NLSNVVNNVGTILITTDSQGLIRVFRTDILPEIRKKIIEKFHEYNLFHLEAAGKINNHNN 714

Query: 844 VSISEVN-DEIASAVHALGNLT--TNTVKA-ATAGF-----NKSCPMGNYSHXXXXXXXX 894
            SI E   DE +S      + T  +NT  +  +  F     N S  +             
Sbjct: 715 DSILENRMDERSSTEDNEFSTTPPSNTHNSRPSHDFCELHPNNSPVISGMPSRASAIFKN 774

Query: 895 XXXXXXXXXXXXIPSSQETTTE-----HVLPAASDS--QMRCDVCGGVNFNVMK--PMRS 945
                       + S  E+T+      H +P  S +  +++CDVC G NF      P+  
Sbjct: 775 SIFNKSNGSFISLKSRSESTSSTVFGPHDIPRVSTTYPKLKCDVCNGSNFECASKNPIAG 834

Query: 946 TDLRTVGFFCTDCGNQVSNFR 966
            D    GF C DCG  ++NFR
Sbjct: 835 GD---SGFTCADCGTILNNFR 852

>CAGL0K11638g complement(1123343..1125121) weakly similar to
           sp|Q03177 Saccharomyces cerevisiae YMR102c, hypothetical
           start
          Length = 592

 Score =  220 bits (561), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 187/674 (27%), Positives = 274/674 (40%), Gaps = 183/674 (27%)

Query: 206 QFEQYLKEPEYIKVFKKRKG--LKQFRRFFLAQELKIGTSPVNSNVGTNNVDGIPHVXXX 263
           QFE+YL  P+Y+K+ KK+    +  F+R FLAQEL++G S V  +               
Sbjct: 41  QFEKYLVRPDYVKLLKKQADCDILPFKRLFLAQELQLGGSSVTVS--------------- 85

Query: 264 XXXXXXXXXXXXXXXXXXXXXXXXXMKFSKDGRFLATGGKDRILRIWKVIASPTERLELD 323
                                     +FSKDG     G KD  L + KV+ + +E+L + 
Sbjct: 86  --------------------------RFSKDGTLFCVGCKDGSLMVLKVLQTKSEKLGI- 118

Query: 324 SSTMKPSKTVCMLNGKLISYSRDVPQSGFARTENGDNPEDDSLDTNGMFPDESLNLYAPV 383
                 S   C   GK     R +                                YAP+
Sbjct: 119 ------SDAECEETGK-----RKIQ-------------------------------YAPI 136

Query: 384 FHPLPYRSFLGH---NQDILDIDWSKNNFVLTGSMDKTVKLWH-CDRKQLLKNFPHPDFV 439
           F+ L   S       ++++LD+ WS N+F+L  S+D  V LW   D  + +  F HPD V
Sbjct: 137 FNELDIVSLNSDEKVHREVLDLSWSVNHFLLVSSVDSYVTLWTPFDGNRPIMRFDHPDLV 196

Query: 440 TCVKFHPNDDRFFISGCLDHKARLWSILDDEVSFEFDCGDLITSLEVSPGDSKYTILGTF 499
           T  KF   DDRFFISGCLDH  R WS+ D+ V + F+C + I  + VSPG S +T++GTF
Sbjct: 197 TSAKFIEADDRFFISGCLDHCVRFWSVTDNRVEYSFNCEEPINVVTVSPGMSHFTVVGTF 256

Query: 500 NGYVIVLLTRGLEHVYSFHLSDKQDKKGKDVTTRDLPTSRTNTHHGPKVTGIECFRAVND 559
            GY+ V  T GL+ +  FH+          +  R +  +  N     K+TGIE     N 
Sbjct: 257 GGYIYVFSTMGLKLIDKFHI----------INGRSIDGNLRNGADKIKITGIEWIVTDNR 306

Query: 560 M----------TLKLLVTSNDSKIRVFNLKDNILQEV-LKGFENESSQISAHLITGSKNK 608
           +          T +++VTS D +IRVF L +     + LKGF  E  +  A L     + 
Sbjct: 307 LDEIQEDNEYSTARIVVTSGDERIRVFKLTEGGYHNLELKGFHCEQFRHRAQLCIW--DD 364

Query: 609 QQFVIAPSEDHWIYCWKL--QSSLMTKDKDK-----------------EHAAGKNXXXXX 649
           + F+   SED W Y W+L  Q  ++T+  ++                  H          
Sbjct: 365 KPFIYCSSEDQWFYVWRLNYQDLMLTRATNEILYASTTHRRRRTERILGHTKEVTSSVLD 424

Query: 650 XXXXXXXXXXXXIGSN----HSDSNRSFSKSQKSXXXXXX-----------XXXXXXSRE 694
                       +GSN         +S + S +S                         E
Sbjct: 425 MFFSTYAAADVEMGSNDKGMRHGQQQSMTFSHESTVTQTMPIGQPTGSTTKSTIEEQREE 484

Query: 695 NQHLKNNEYIAFHAHHHPLTTAIAAPPETARTLSLSNDFICELTMEFCEDYDDVRIVNTY 754
           N  L+++   +FHAH HP+TT   AP  T   ++ SNDFI E T     +  ++R V   
Sbjct: 485 NYILRHSHTFSFHAHDHPITTVNIAPIGTIAAVTQSNDFIYEFTCRCYSNNVELRDV--- 541

Query: 755 NXXXXXXXXXDADIAQEDDACDNDGDVGTNPRRIPTVDEFIGAILVTSDDNGVIRVFRSD 814
                           E D+CD                  IG I+VT+D  G +RVFR+D
Sbjct: 542 ----------------EMDSCD-----------------IIGPIVVTTDSVGKLRVFRTD 568

Query: 815 ISTNIRKRVLAKLQ 828
           +S   R+ ++  L 
Sbjct: 569 LSDIARETLINVLH 582

>AEL246C [2260] [Homologous to ScYBR198C (TAF90) - SH]
           (172849..175296) [2448 bp, 815 aa]
          Length = 815

 Score = 83.6 bits (205), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 67/220 (30%), Positives = 103/220 (46%), Gaps = 21/220 (9%)

Query: 289 MKFSKDGRFLATGGKDRILRIWKVIASPTERLELDSSTMKPSKTVCMLNGKLISYSRDVP 348
           ++FS D R +A G +D  +++W +  +P E  +L S     S TV      LI +S  V 
Sbjct: 493 LRFSDDSRLVAAGFQDSYIKLWSLDGTPLES-QLPSKAKDASNTVT-----LIGHSGPVY 546

Query: 349 QSGFARTENGDNPEDDSLDTNGMFPDESLNLYAPVFHPLPYRSFLGHNQDILDIDWSK-N 407
              F+     DN    S   +      SL+ Y  +       S+ GHN  + D+ +S   
Sbjct: 547 SVSFSP----DNRYLVSASEDKTVRLWSLDTYTCLV------SYKGHNHPVWDVKFSPLG 596

Query: 408 NFVLTGSMDKTVKLWHCDRKQLLKNFP-HPDFVTCVKFHPNDDRFFISGCLDHKARLWSI 466
           ++  TGS D+T +LW CD    L+ F  H + V CV FHPN   + ++G  D   R+W I
Sbjct: 597 HYFATGSHDQTARLWSCDHIYPLRIFAGHLNDVDCVTFHPNGT-YVLTGSSDKTCRMWDI 655

Query: 467 -LDDEVSFEFDCGDLITSLEVSPGDSKYTILGTFNGYVIV 505
              D V         + S+ VSP D ++   G+ +G +IV
Sbjct: 656 QTGDSVRLFLGHTASVVSVAVSP-DGRWLTTGSEDGVIIV 694

>KLLA0E23529g 2088516..2090996 similar to sp|P38129 Saccharomyces
           cerevisiae YBR198c TAF90 TFIID and SAGA subunit, start
           by similarity
          Length = 826

 Score = 73.2 bits (178), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 64/222 (28%), Positives = 105/222 (47%), Gaps = 25/222 (11%)

Query: 289 MKFSKDGRFLATGGKDRILRIWKVIASPTERLELDSSTMKPSKTVCMLN-GKLISYSRDV 347
           ++FS D R  A G +D  +++W +  SP +       ++ PSK     N   L+ +S  V
Sbjct: 504 VEFSDDARLTAAGFQDSTIKVWYLDGSPLQ-------SILPSKAKDQSNSATLVGHSGPV 556

Query: 348 PQSGFARTENGDNPEDDSLDTNGMFPDESLNLYA-PVFHPLPYRSFLGHNQDILDIDWSK 406
               F+       P++  L +     D+++ L++   F  L    + GHN  +  + +S 
Sbjct: 557 YSVAFS-------PDNRYLLSAS--EDKTVRLWSLDTFTCL--VCYKGHNHPVWYVKFSP 605

Query: 407 -NNFVLTGSMDKTVKLWHCDRKQLLKNFP-HPDFVTCVKFHPNDDRFFISGCLDHKARLW 464
             ++ +T S D+T +LW CD    L+ F  H + V C  FHPN    F +G  D   R+W
Sbjct: 606 LGHYFITASHDQTARLWSCDHIYPLRIFSGHLNDVDCSTFHPNGCYVF-TGSSDKTCRMW 664

Query: 465 SI-LDDEVSFEFDCGDLITSLEVSPGDSKYTILGTFNGYVIV 505
            I   D V         +T+LEVSP D ++   G+ +G +IV
Sbjct: 665 DIQTGDSVRLFLGHTSPVTALEVSP-DGRWLTTGSEDGTIIV 705

>Sklu_2431.12 YBR198C, Contig c2431 17817-20066 reverse complement
          Length = 749

 Score = 72.0 bits (175), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 65/221 (29%), Positives = 100/221 (45%), Gaps = 23/221 (10%)

Query: 289 MKFSKDGRFLATGGKDRILRIWKVIASPTERLELDSSTMKPSKTVCMLNGK-LISYSRDV 347
           ++FS D    A G +D  +++W +  +P     LDS    PSK    +N   LI +S  V
Sbjct: 427 LEFSDDATLAAAGFQDSYIKLWSLDGTP-----LDSKL--PSKQREKINNTTLIGHSGTV 479

Query: 348 PQSGFARTENGDNPEDDSLDTNGMFPDESLNLYAPVFHPLPYRSFLGHNQDILDIDWSK- 406
             + F+     DN    S   +      S++ Y+ +       S+ GHN  + D+ +S  
Sbjct: 480 YSTSFS----PDNKYLLSASEDKTVRLWSMDTYSSLV------SYKGHNHPVWDVSFSPL 529

Query: 407 NNFVLTGSMDKTVKLWHCDRKQLLKNFP-HPDFVTCVKFHPNDDRFFISGCLDHKARLWS 465
            ++  T S D+T +LW CD    L+ F  H + V CV FHPN    F +G  D   R+W 
Sbjct: 530 GHYFATASHDQTARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGTYVF-TGSTDKTCRMWD 588

Query: 466 I-LDDEVSFEFDCGDLITSLEVSPGDSKYTILGTFNGYVIV 505
           I   D V         + S  VSP D ++   G+ +G + V
Sbjct: 589 IGTGDSVRLFLGHTAPVISTAVSP-DGRWLSTGSEDGIINV 628

 Score = 33.5 bits (75), Expect = 0.97,   Method: Compositional matrix adjust.
 Identities = 26/105 (24%), Positives = 41/105 (39%), Gaps = 10/105 (9%)

Query: 390 RSFLGHNQDILDIDWSKNN-FVLTGSMDKTVKLWHCDRKQLLKNF-PHPDFVTCVKFHPN 447
           R FLGH   ++    S +  ++ TGS D  + +W     + LK    H         +  
Sbjct: 596 RLFLGHTAPVISTAVSPDGRWLSTGSEDGIINVWDIGTGKRLKQMRGHGKNAVYSLSYSK 655

Query: 448 DDRFFISGCLDHKARLWSI--------LDDEVSFEFDCGDLITSL 484
           +    +SG  DH  R+W +         + E  F    GD  TS+
Sbjct: 656 EGTVLVSGGADHSVRVWDLKRSTAEPNTEPEQPFTSYFGDATTSV 700

>Kwal_27.12053
          Length = 755

 Score = 67.4 bits (163), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 63/221 (28%), Positives = 102/221 (46%), Gaps = 23/221 (10%)

Query: 289 MKFSKDGRFLATGGKDRILRIWKVIASPTERLELDSSTMKPSKTVCMLNGK-LISYSRDV 347
           ++FS D R  A G +D I++IW +   P +          PSK     N + L+ +S  V
Sbjct: 433 LEFSDDVRLAAAGFQDSIIKIWSLDGEPLK-------NKLPSKQGERTNNETLVGHSGTV 485

Query: 348 PQSGFARTENGDNPEDDSLDTNGMFPDESLNLYAPVFHPLPYRSFLGHNQDILDIDWSK- 406
             + F+       P++  L +     D+++ L++   +     ++ GHN  I D+ +S  
Sbjct: 486 YSTSFS-------PDNRYLLSAS--EDKTVRLWSTDTY-TSLVNYKGHNHPIWDVAFSPL 535

Query: 407 NNFVLTGSMDKTVKLWHCDRKQLLKNFP-HPDFVTCVKFHPNDDRFFISGCLDHKARLWS 465
            ++  T S D+T +LW CD    L+ F  H + V  V FHPN    F +G  D   R+W 
Sbjct: 536 GHYFATASHDQTARLWSCDHIYPLRIFAGHLNDVDTVSFHPNGTYVF-TGSSDKTCRMWD 594

Query: 466 ILD-DEVSFEFDCGDLITSLEVSPGDSKYTILGTFNGYVIV 505
           I   D V         +TS  VSP D ++   G+ +G + V
Sbjct: 595 ITSGDSVRLFLGHTAPVTSTAVSP-DGRWLSTGSEDGVINV 634

 Score = 30.8 bits (68), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 12/30 (40%), Positives = 18/30 (60%)

Query: 289 MKFSKDGRFLATGGKDRILRIWKVIASPTE 318
           + +SK+G  L +GG D  +R+W V  S  E
Sbjct: 657 LSYSKEGHVLISGGADHSVRVWDVKKSTAE 686

>Scas_721.32
          Length = 822

 Score = 67.0 bits (162), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 57/219 (26%), Positives = 103/219 (47%), Gaps = 16/219 (7%)

Query: 289 MKFSKDGRFLATGGKDRILRIWKVIASPTERLELDSS-TMKPSKTVCMLNGKLISYSRDV 347
           ++FS+D R +A G +D  +++W +  S  ++++  S+ ++         +  LI +S  V
Sbjct: 493 LQFSEDSRLVAAGFQDSYIKLWSLDGSSLKQIQEKSADSINTGDMNDNTSTTLIGHSGAV 552

Query: 348 PQSGFARTENGDNPEDDSLDTNGMFPDESLNLYAPVFHPLPYRSFLGHNQDILDIDWSK- 406
             + F+       P++  L +     D+++ L++   +     S+ GHN  + D+ +S  
Sbjct: 553 YSTSFS-------PDNRYLLSGS--EDKTVRLWSTDTY-TSLVSYKGHNHPVWDVQFSPL 602

Query: 407 NNFVLTGSMDKTVKLWHCDRKQLLKNFP-HPDFVTCVKFHPNDDRFFISGCLDHKARLWS 465
            ++  T S D+T +LW CD    L+ F  H   V CV FHPN    F +G  D   R+W 
Sbjct: 603 GHYFATASHDQTARLWSCDHIYPLRIFAGHLSDVDCVSFHPNGCYVF-TGSSDKTCRMWD 661

Query: 466 I-LDDEVSFEFDCGDLITSLEVSPGDSKYTILGTFNGYV 503
           I   D V         +    VSP D ++   G+ +G +
Sbjct: 662 ISTGDSVRLFLGHTAPVLCTAVSP-DGRWLATGSEDGII 699

 Score = 33.1 bits (74), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 47/223 (21%), Positives = 74/223 (33%), Gaps = 79/223 (35%)

Query: 291 FSKDGRFLATGGKDRILRIWKVIASPTERLELDSSTMKPSKTVCMLNGKLISY---SRDV 347
           FS D R+L +G +D+ +R+W            D+ T             L+SY   +  V
Sbjct: 557 FSPDNRYLLSGSEDKTVRLWST----------DTYT------------SLVSYKGHNHPV 594

Query: 348 PQSGFARTENGDNPEDDSLDTNGMFPDESLNLYAPVFHPLPYRSFLGHNQDILDIDWSKN 407
               F+       P      T     D++  L++   H  P R F GH  D+  + +  N
Sbjct: 595 WDVQFS-------PLGHYFATASH--DQTARLWS-CDHIYPLRIFAGHLSDVDCVSFHPN 644

Query: 408 N-FVLTGSMDKTVKLWHCDRKQLLKNF-PHPDFVTCVKFHPN------------------ 447
             +V TGS DKT ++W       ++ F  H   V C    P+                  
Sbjct: 645 GCYVFTGSSDKTCRMWDISTGDSVRLFLGHTAPVLCTAVSPDGRWLATGSEDGIINLWDI 704

Query: 448 ------------------------DDRFFISGCLDHKARLWSI 466
                                   +    +SG  DH  R+W +
Sbjct: 705 GTAKRLKVMRGHGKNAIHSLSYCKEGNVLVSGGADHSVRVWDL 747

>CAGL0H08932g join(871668..871685,872089..874779) highly similar to
           sp|P41811 Saccharomyces cerevisiae YGL137w SEC27
          Length = 902

 Score = 63.9 bits (154), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 41/72 (56%), Gaps = 2/72 (2%)

Query: 409 FVLTGSMDKTVKLWHCDRKQLLKNF--PHPDFVTCVKFHPNDDRFFISGCLDHKARLWSI 466
           ++LTGS D TVKLW+ +    L+     H  FV CV F+P D   F SGCLDHK ++WS+
Sbjct: 111 YILTGSDDLTVKLWNWENDWSLEQTFKGHEHFVMCVAFNPKDPNVFASGCLDHKVKVWSL 170

Query: 467 LDDEVSFEFDCG 478
                +F    G
Sbjct: 171 GQSTPNFTLHTG 182

>YBR198C (TAF5) [381] chr2 complement(616084..618480) Component of
           the TAF(II) complex (TBP-associated protein complex) and
           SAGA complex (Spt-Ada-Gcn5-acetyltransferase), required
           for activated transcription by RNA polymerase II, member
           of WD (WD-40) repeat family [2397 bp, 798 aa]
          Length = 798

 Score = 63.5 bits (153), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 59/221 (26%), Positives = 98/221 (44%), Gaps = 19/221 (8%)

Query: 289 MKFSKDGRFLATGGKDRILRIWKVIASPTERLELDSSTM-KPSKTVCMLNGKLISYSRDV 347
           + FS D R  A G +D  ++IW +  S      +  +   K     C     L+ +S  V
Sbjct: 472 LDFSDDCRIAAAGFQDSYIKIWSLDGSSLNNPNIALNNNDKDEDPTCK---TLVGHSGTV 528

Query: 348 PQSGFARTENGDNPEDDSLDTNGMFPDESLNLYAPVFHPLPYRSFLGHNQDILDIDWSK- 406
             + F+       P++  L +     D+++ L++   H     S+ GHN  + D+ +S  
Sbjct: 529 YSTSFS-------PDNKYLLSGS--EDKTVRLWSMDTH-TALVSYKGHNHPVWDVSFSPL 578

Query: 407 NNFVLTGSMDKTVKLWHCDRKQLLKNFP-HPDFVTCVKFHPNDDRFFISGCLDHKARLWS 465
            ++  T S D+T +LW CD    L+ F  H + V CV FHPN    F +G  D   R+W 
Sbjct: 579 GHYFATASHDQTARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGCYVF-TGSSDKTCRMWD 637

Query: 466 I-LDDEVSFEFDCGDLITSLEVSPGDSKYTILGTFNGYVIV 505
           +   D V         + S+ V P D ++   G+ +G + V
Sbjct: 638 VSTGDSVRLFLGHTAPVISIAVCP-DGRWLSTGSEDGIINV 677

 Score = 33.5 bits (75), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 21/79 (26%), Positives = 33/79 (41%), Gaps = 2/79 (2%)

Query: 390 RSFLGHNQDILDIDWSKNN-FVLTGSMDKTVKLWHCDRKQLLKNF-PHPDFVTCVKFHPN 447
           R FLGH   ++ I    +  ++ TGS D  + +W     + LK    H         +  
Sbjct: 645 RLFLGHTAPVISIAVCPDGRWLSTGSEDGIINVWDIGTGKRLKQMRGHGKNAIYSLSYSK 704

Query: 448 DDRFFISGCLDHKARLWSI 466
           +    ISG  DH  R+W +
Sbjct: 705 EGNVLISGGADHTVRVWDL 723

 Score = 31.2 bits (69), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 11/30 (36%), Positives = 19/30 (63%)

Query: 289 MKFSKDGRFLATGGKDRILRIWKVIASPTE 318
           + +SK+G  L +GG D  +R+W +  + TE
Sbjct: 700 LSYSKEGNVLISGGADHTVRVWDLKKATTE 729

>CAGL0M05335g complement(569132..571552) similar to sp|P38129
           Saccharomyces cerevisiae YBR198c Transcription
           initiation factor TFIID 90, hypothetical start
          Length = 806

 Score = 61.2 bits (147), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 61/227 (26%), Positives = 101/227 (44%), Gaps = 21/227 (9%)

Query: 289 MKFSKDGRFLATGGKDRILRIWKVIASPTERLELDSSTMK--PSKTVCMLNGKLISYSRD 346
           ++FS D R  A G +D  ++IW +  S     +  SS          C     L+ +S  
Sbjct: 479 LEFSDDCRLAAAGFQDSYIKIWSLDGSSLINPKYSSSQFDRFSQDNTC---STLVGHSGT 535

Query: 347 VPQSGFARTENGDNPEDDSLDTNGMFPDESLNLYAPVFHPLPYRSFLGHNQDILDIDWSK 406
           V  + F+       P++  L +     D+++ L++   H     ++ GHN  + D+ +S 
Sbjct: 536 VYSTSFS-------PDNMYLVSGS--EDKTVKLWSMDTH-TALVNYKGHNHPVWDVKFSP 585

Query: 407 -NNFVLTGSMDKTVKLWHCDRKQLLKNFP-HPDFVTCVKFHPNDDRFFISGCLDHKARLW 464
             ++  + S D+T +LW CD    L+ F  H + V  V FHPN    F +G  D   R+W
Sbjct: 586 LGHYFASASHDQTARLWACDHIYPLRIFAGHTNDVDTVSFHPNGCYVF-TGSSDKTCRMW 644

Query: 465 SI-LDDEVSFEFDCGDLITSLEVSPGDSKYTILGTFNGYVIVLLTRG 510
            +   D V         + S +VSP D ++   G+ +G VI L   G
Sbjct: 645 DVSTGDSVRLFLGHTAPVLSTQVSP-DGRWLATGSEDG-VICLWDIG 689

 Score = 35.8 bits (81), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 28/106 (26%), Positives = 44/106 (41%), Gaps = 12/106 (11%)

Query: 390 RSFLGHNQDILDIDWSKNN-FVLTGSMDKTVKLWHCDRKQLLKNFPH--PDFVTCVKFHP 446
           R FLGH   +L    S +  ++ TGS D  + LW     + +K       + V  + F+ 
Sbjct: 653 RLFLGHTAPVLSTQVSPDGRWLATGSEDGVICLWDIGTGKRIKQMRGHGKNAVHSLSFN- 711

Query: 447 NDDRFFISGCLDHKARLWSIL--------DDEVSFEFDCGDLITSL 484
            +    ISG  DH  R+W +         + E  F    GD+  S+
Sbjct: 712 KEGNVLISGGADHSVRVWDVKHGTTEQGPEPEQPFNAHVGDITASI 757

 Score = 30.8 bits (68), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 12/31 (38%), Positives = 19/31 (61%)

Query: 289 MKFSKDGRFLATGGKDRILRIWKVIASPTER 319
           + F+K+G  L +GG D  +R+W V    TE+
Sbjct: 708 LSFNKEGNVLISGGADHSVRVWDVKHGTTEQ 738

>Kwal_23.6429
          Length = 750

 Score = 60.5 bits (145), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 35/116 (30%), Positives = 55/116 (47%), Gaps = 4/116 (3%)

Query: 391 SFLGHNQDILDIDW-SKNNFVLTGSMDKTVKLWHCDRKQLLKNFPHPDFVTCVKFHPNDD 449
           +  GH QDI  +D+    + +++GS D+TV++W     Q        D VT V   P D 
Sbjct: 507 TLQGHEQDIYSLDYFPSGDKLVSGSGDRTVRIWDLRTGQCSLTLSIEDGVTTVAVSPGDG 566

Query: 450 RFFISGCLDHKARLWSILDDEVSFEFDCGDLITSLEVSPGDSKYTILGTFNGYVIV 505
           +   +G LD   R+W   D E  F  +  D    L     DS Y+++ T +G+ +V
Sbjct: 567 KLIAAGSLDRTVRIW---DSETGFLVERLDSENELGTGHKDSVYSVVFTRDGHGVV 619

 Score = 53.5 bits (127), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 24/93 (25%), Positives = 47/93 (50%), Gaps = 2/93 (2%)

Query: 409 FVLTGSMDKTVKLWHCDRKQLLKNFP-HPDFVTCVKFHPNDDRFFISGCLDHKARLWSIL 467
           F+ TG+ DK +++W    ++++     H   +  + + P+ D+  +SG  D   R+W + 
Sbjct: 484 FLATGAEDKLIRIWDLATRRIVMTLQGHEQDIYSLDYFPSGDK-LVSGSGDRTVRIWDLR 542

Query: 468 DDEVSFEFDCGDLITSLEVSPGDSKYTILGTFN 500
             + S      D +T++ VSPGD K    G+ +
Sbjct: 543 TGQCSLTLSIEDGVTTVAVSPGDGKLIAAGSLD 575

 Score = 44.7 bits (104), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 45/185 (24%), Positives = 74/185 (40%), Gaps = 39/185 (21%)

Query: 291 FSKDGRFLATGGKDRILRIWKVIASPTERLELDSSTMKPSKTVCMLNG-KLISYSRDVPQ 349
           FS DG+FLATG +D+++RIW +    T R+            V  L G +   YS D   
Sbjct: 478 FSPDGKFLATGAEDKLIRIWDLA---TRRI------------VMTLQGHEQDIYSLDYFP 522

Query: 350 SGFARTENGDNPEDDSLDTNGMFPDESLNLYAPVFHPLPYRSFLGHNQDILDIDWSKNNF 409
           SG           D  +  +G   D ++ ++            +      + +       
Sbjct: 523 SG-----------DKLVSGSG---DRTVRIWDLRTGQCSLTLSIEDGVTTVAVSPGDGKL 568

Query: 410 VLTGSMDKTVKLWHCDRKQLLKNF--------PHPDFVTCVKFHPNDDRFFISGCLDHKA 461
           +  GS+D+TV++W  +   L++           H D V  V F   D    +SG LD   
Sbjct: 569 IAAGSLDRTVRIWDSETGFLVERLDSENELGTGHKDSVYSVVFT-RDGHGVVSGSLDRSV 627

Query: 462 RLWSI 466
           +LW++
Sbjct: 628 KLWNL 632

 Score = 34.3 bits (77), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 22/85 (25%), Positives = 37/85 (43%), Gaps = 15/85 (17%)

Query: 394 GHNQDILDIDWSKNNF-VLTGSMDKTVKLWHC-------------DRKQLLKNFPHPDFV 439
           GH   +  + ++++   V++GS+D++VKLW+                   +    H DFV
Sbjct: 601 GHKDSVYSVVFTRDGHGVVSGSLDRSVKLWNLRSANGGTAEGKANTAASEVTYTGHKDFV 660

Query: 440 TCVKFHPNDDRFFISGCLDHKARLW 464
             V    ND+ F +SG  D     W
Sbjct: 661 LSVATTQNDE-FILSGSKDRGVLFW 684

>CAGL0E00561g 49750..52260 some similarities with sp|P16649
           Saccharomyces cerevisiae YCR084c TUP1, hypothetical
           start
          Length = 836

 Score = 60.5 bits (145), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 35/113 (30%), Positives = 54/113 (47%), Gaps = 4/113 (3%)

Query: 394 GHNQDILDIDW-SKNNFVLTGSMDKTVKLWHCDRKQLLKNFPHPDFVTCVKFHPNDDRFF 452
           GH QDI  +D+    + +++GS D+TV++W     Q        D VT V   P D +F 
Sbjct: 595 GHEQDIYSLDYFPSGDKLVSGSGDRTVRIWDLKTGQCTLTLSIEDGVTTVAVSPGDGKFI 654

Query: 453 ISGCLDHKARLWSILDDEVSFEFDCGDLITSLEVSPGDSKYTILGTFNGYVIV 505
            +G LD   R+W   D +  F  +  D    L     DS Y+++ T +G  +V
Sbjct: 655 AAGSLDRAVRVW---DSDTGFLVERLDSENELGTGHKDSVYSVVFTRDGNGVV 704

 Score = 57.0 bits (136), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 26/98 (26%), Positives = 52/98 (53%), Gaps = 2/98 (2%)

Query: 409 FVLTGSMDKTVKLWHCDRKQLLKNFP-HPDFVTCVKFHPNDDRFFISGCLDHKARLWSIL 467
           F+ TG+ DK +++W  ++K+++     H   +  + + P+ D+  +SG  D   R+W + 
Sbjct: 569 FLATGAEDKLIRIWDIEQKKIVMVLKGHEQDIYSLDYFPSGDK-LVSGSGDRTVRIWDLK 627

Query: 468 DDEVSFEFDCGDLITSLEVSPGDSKYTILGTFNGYVIV 505
             + +      D +T++ VSPGD K+   G+ +  V V
Sbjct: 628 TGQCTLTLSIEDGVTTVAVSPGDGKFIAAGSLDRAVRV 665

 Score = 48.5 bits (114), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 45/185 (24%), Positives = 74/185 (40%), Gaps = 39/185 (21%)

Query: 291 FSKDGRFLATGGKDRILRIWKVIASPTERLELDSSTMKPSKTVCMLNG-KLISYSRDVPQ 349
           FS DG+FLATG +D+++RIW +               +  K V +L G +   YS D   
Sbjct: 563 FSPDGKFLATGAEDKLIRIWDI---------------EQKKIVMVLKGHEQDIYSLDYFP 607

Query: 350 SGFARTENGDNPEDDSLDTNGMFPDESLNLYAPVFHPLPYRSFLGHNQDILDIDWSKNNF 409
           SG           D  +  +G   D ++ ++            +      + +      F
Sbjct: 608 SG-----------DKLVSGSG---DRTVRIWDLKTGQCTLTLSIEDGVTTVAVSPGDGKF 653

Query: 410 VLTGSMDKTVKLWHCDRKQLLKNF--------PHPDFVTCVKFHPNDDRFFISGCLDHKA 461
           +  GS+D+ V++W  D   L++           H D V  V F   D    +SG LD   
Sbjct: 654 IAAGSLDRAVRVWDSDTGFLVERLDSENELGTGHKDSVYSVVFT-RDGNGVVSGSLDRSV 712

Query: 462 RLWSI 466
           +LW++
Sbjct: 713 KLWNL 717

 Score = 35.8 bits (81), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 24/85 (28%), Positives = 39/85 (45%), Gaps = 15/85 (17%)

Query: 394 GHNQDILDIDWSKN-NFVLTGSMDKTVKLW--------HCDRKQL-----LKNFPHPDFV 439
           GH   +  + ++++ N V++GS+D++VKLW        + D K       +    H DFV
Sbjct: 686 GHKDSVYSVVFTRDGNGVVSGSLDRSVKLWNLRNVNHNNADGKPTSGTCEVTYTGHKDFV 745

Query: 440 TCVKFHPNDDRFFISGCLDHKARLW 464
             V     DD + +SG  D     W
Sbjct: 746 LSVATT-EDDEYILSGSKDRGVLFW 769

>AGL234W [4078] [Homologous to ScYCR084C (TUP1) - SH]
           complement(257969..259858) [1890 bp, 629 aa]
          Length = 629

 Score = 59.3 bits (142), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 34/116 (29%), Positives = 55/116 (47%), Gaps = 4/116 (3%)

Query: 391 SFLGHNQDILDIDW-SKNNFVLTGSMDKTVKLWHCDRKQLLKNFPHPDFVTCVKFHPNDD 449
           +  GH QDI  +D+    + +++GS D+TV++W     Q        D VT V   P D 
Sbjct: 389 TLQGHEQDIYSLDYFPAGDKLVSGSGDRTVRIWDLRTGQCSLTLSIEDGVTTVAVSPGDG 448

Query: 450 RFFISGCLDHKARLWSILDDEVSFEFDCGDLITSLEVSPGDSKYTILGTFNGYVIV 505
           ++  +G LD   R+W   D E  F  +  D    L     DS Y+++ T +G  ++
Sbjct: 449 KYIAAGSLDRTVRVW---DSETGFLVERLDSENELSTGHKDSVYSVVFTRDGQGVI 501

 Score = 57.8 bits (138), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 55/221 (24%), Positives = 91/221 (41%), Gaps = 44/221 (19%)

Query: 289 MKFSKDGRFLATGGKDRILRIWKV-IASPTERLELDSSTMKPSKTVCMLNGKLISYSRDV 347
           ++FS DG +LATG  ++  +++KV       RL  DS        V  +N +        
Sbjct: 282 VRFSNDGEYLATG-CNKTTQVYKVSTGELLARLSDDS--------VAGVNNEA------- 325

Query: 348 PQSGFARTENGDNPEDDSLDTNGMFPDESLNLY--APVFHPLPYRSFLGHNQDILDIDWS 405
             +G A     DN  ++S       P  S +LY  +  F P                   
Sbjct: 326 -STGPANNGTADNGGENSATIQ---PASSSDLYIRSVCFSP------------------- 362

Query: 406 KNNFVLTGSMDKTVKLWHCDRKQLLKNFP-HPDFVTCVKFHPNDDRFFISGCLDHKARLW 464
              ++ TG+ DK +++W    K++L     H   +  + + P  D+  +SG  D   R+W
Sbjct: 363 DGKYLATGAEDKLIRIWDLTTKKILMTLQGHEQDIYSLDYFPAGDK-LVSGSGDRTVRIW 421

Query: 465 SILDDEVSFEFDCGDLITSLEVSPGDSKYTILGTFNGYVIV 505
            +   + S      D +T++ VSPGD KY   G+ +  V V
Sbjct: 422 DLRTGQCSLTLSIEDGVTTVAVSPGDGKYIAAGSLDRTVRV 462

 Score = 37.4 bits (85), Expect = 0.066,   Method: Compositional matrix adjust.
 Identities = 20/68 (29%), Positives = 32/68 (47%), Gaps = 9/68 (13%)

Query: 407 NNFVLTGSMDKTVKLWHCDRKQLLKNF--------PHPDFVTCVKFHPNDDRFFISGCLD 458
             ++  GS+D+TV++W  +   L++           H D V  V F   D +  ISG LD
Sbjct: 448 GKYIAAGSLDRTVRVWDSETGFLVERLDSENELSTGHKDSVYSVVFT-RDGQGVISGSLD 506

Query: 459 HKARLWSI 466
              +LW +
Sbjct: 507 RSVKLWDL 514

 Score = 35.0 bits (79), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 22/80 (27%), Positives = 36/80 (45%), Gaps = 10/80 (12%)

Query: 394 GHNQDILDIDWSKNN-FVLTGSMDKTVKLWHCDRKQLLKNFP--------HPDFVTCVKF 444
           GH   +  + ++++   V++GS+D++VKLW        K+          H DFV  V  
Sbjct: 483 GHKDSVYSVVFTRDGQGVISGSLDRSVKLWDLRGLNGQKSHATCEVTYTGHKDFVLSVAT 542

Query: 445 HPNDDRFFISGCLDHKARLW 464
              DD + +SG  D     W
Sbjct: 543 T-QDDEYILSGSKDRGVLFW 561

>YGL137W (SEC27) [1850] chr7 (249872..249889,250090..252741)
           Coatomer (COPI) complex beta' chain (beta'-COP) of
           secretory pathway vesicles, required for retrograde
           transport from Golgi to endoplasmic reticulum, member of
           the WD (WD-40) repeat family [2670 bp, 889 aa]
          Length = 889

 Score = 58.2 bits (139), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 39/72 (54%), Gaps = 2/72 (2%)

Query: 409 FVLTGSMDKTVKLWHCDRKQLLKNF--PHPDFVTCVKFHPNDDRFFISGCLDHKARLWSI 466
           +VL+GS D TVKLW+ +    L+     H  FV CV F+P D   F SGCLD   ++WS+
Sbjct: 111 YVLSGSDDLTVKLWNWENNWALEQTFEGHEHFVMCVAFNPKDPSTFASGCLDRTVKVWSL 170

Query: 467 LDDEVSFEFDCG 478
                +F    G
Sbjct: 171 GQSTPNFTLTTG 182

 Score = 34.7 bits (78), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 15/61 (24%), Positives = 35/61 (57%), Gaps = 2/61 (3%)

Query: 405 SKNNFVLTGSMDKTVKLWHCDRKQLLKNF-PHPDFVTCVKFHPNDDRFFISGCLDHKARL 463
           ++ N+++ GS D  +++++ +  + + +F  HPD++  +  HP    + +SG  D   +L
Sbjct: 65  ARKNWIIVGSDDFRIRVFNYNTGEKVVDFEAHPDYIRSIAVHPTKP-YVLSGSDDLTVKL 123

Query: 464 W 464
           W
Sbjct: 124 W 124

>KLLA0B01958g join(170646..170663,170896..173550) similar to
           sp|P41811 Saccharomyces cerevisiae YGL137w SEC27
           coatomer complex beta chain (beta -cop) of secretory
           pathway vesicles, hypothetical start
          Length = 890

 Score = 58.2 bits (139), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 30/67 (44%), Positives = 39/67 (58%), Gaps = 2/67 (2%)

Query: 409 FVLTGSMDKTVKLWHCDRKQLLKNF--PHPDFVTCVKFHPNDDRFFISGCLDHKARLWSI 466
           FVLTGS D T+KLW+ ++    +     H  FV  V F+P D   F SGCLDH  ++WSI
Sbjct: 111 FVLTGSDDLTIKLWNWEKNWGCQQTFTGHEHFVMSVAFNPKDPNQFASGCLDHTIKVWSI 170

Query: 467 LDDEVSF 473
             D  +F
Sbjct: 171 GQDVPNF 177

 Score = 34.7 bits (78), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 16/61 (26%), Positives = 34/61 (55%), Gaps = 2/61 (3%)

Query: 405 SKNNFVLTGSMDKTVKLWHCDRKQLLKNF-PHPDFVTCVKFHPNDDRFFISGCLDHKARL 463
           ++ N+V+ GS D  +++++ +  + +  F  HPD++  +  HP    F ++G  D   +L
Sbjct: 65  ARKNWVVVGSDDFKLRVYNYNTGEKVTEFEAHPDYIRSIAVHPT-KPFVLTGSDDLTIKL 123

Query: 464 W 464
           W
Sbjct: 124 W 124

 Score = 33.9 bits (76), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 20/74 (27%), Positives = 38/74 (51%), Gaps = 2/74 (2%)

Query: 410 VLTGSMDKTVKLWHCDRKQLLKNF-PHPDFVTCVKFHPNDDRFFISGCLDHKARLWSILD 468
           +++GS D T+K+W+ +  +L K      +   C+  HP+  R +I+   D+   + S+ D
Sbjct: 243 IISGSEDGTLKIWNANTYKLEKTLNIGLERSWCIATHPSGKRNYIASGFDNGFTVLSLGD 302

Query: 469 DEVSFEFD-CGDLI 481
           D+     D  G L+
Sbjct: 303 DQPKLSLDPVGKLV 316

>Scas_629.12
          Length = 671

 Score = 57.0 bits (136), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 60/240 (25%), Positives = 94/240 (39%), Gaps = 60/240 (25%)

Query: 289 MKFSKDGRFLATGGKDRILRIWKVIASPTERLELDSSTMKPSKTVCMLNGKLISYSRDVP 348
           +KFS DG+FLATG  ++  +I++V                        +G+LI+   D  
Sbjct: 334 VKFSNDGQFLATGC-NKTTQIYRVS-----------------------DGELIAKLSD-- 367

Query: 349 QSGFARTENGDNPEDDSLDTNGMFPDESLNLYAPVFHP------------------LPYR 390
                   +     D S  T+G  P   L + +  F P                  +  R
Sbjct: 368 --------DSVTSPDTSSATSGSTPSTDLYIRSVCFSPDGEFLATGAEDKLIRIWDIQER 419

Query: 391 SFL----GHNQDILDIDWSKNNF-VLTGSMDKTVKLWHCDRKQLLKNFPHPDFVTCVKFH 445
             +    GH QD+  +D+  N   +++GS D+TV++W     Q          VT V   
Sbjct: 420 KIVMVLKGHEQDVYSLDYFPNGEKLVSGSGDRTVRIWDLRTGQCSLTLSIEYGVTTVAVS 479

Query: 446 PNDDRFFISGCLDHKARLWSILDDEVSFEFDCGDLITSLEVSPGDSKYTILGTFNGYVIV 505
           PND +F  +G LD   R+W   D    F  +  D    L     DS Y+++ T +G  +V
Sbjct: 480 PNDGKFIAAGSLDRAVRVW---DSTTGFLVERLDSENELGTGHRDSVYSVVFTRDGNEVV 536

 Score = 37.0 bits (84), Expect = 0.086,   Method: Compositional matrix adjust.
 Identities = 25/88 (28%), Positives = 38/88 (43%), Gaps = 18/88 (20%)

Query: 394 GHNQDILDIDWSKN-NFVLTGSMDKTVKLWHCDRKQLLKN----------------FPHP 436
           GH   +  + ++++ N V++GS+DKTVKLW+        N                  H 
Sbjct: 518 GHRDSVYSVVFTRDGNEVVSGSLDKTVKLWNMRHSGNSNNESNDKGSASATCEVTYVGHK 577

Query: 437 DFVTCVKFHPNDDRFFISGCLDHKARLW 464
           DFV  V     DD++ +SG  D     W
Sbjct: 578 DFVLSVTTS-QDDKYILSGSKDRGILFW 604

>YCR084C (TUP1) [608] chr3 complement(260307..262448) General
           repressor of RNA polymerase II transcription that is
           brought to target promoters by regulated,
           sequence-specific DNA-binding proteins, exists in a
           complex with Ssn6p that is converted to a
           transcriptional activator in a Hog1p-dependent manner
           [2142 bp, 713 aa]
          Length = 713

 Score = 56.6 bits (135), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 34/113 (30%), Positives = 53/113 (46%), Gaps = 4/113 (3%)

Query: 394 GHNQDILDIDW-SKNNFVLTGSMDKTVKLWHCDRKQLLKNFPHPDFVTCVKFHPNDDRFF 452
           GH QDI  +D+    + +++GS D+TV++W     Q        D VT V   P D ++ 
Sbjct: 483 GHEQDIYSLDYFPSGDKLVSGSGDRTVRIWDLRTGQCSLTLSIEDGVTTVAVSPGDGKYI 542

Query: 453 ISGCLDHKARLWSILDDEVSFEFDCGDLITSLEVSPGDSKYTILGTFNGYVIV 505
            +G LD   R+W   D E  F  +  D          DS Y+++ T +G  +V
Sbjct: 543 AAGSLDRAVRVW---DSETGFLVERLDSENESGTGHKDSVYSVVFTRDGQSVV 592

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 44/185 (23%), Positives = 75/185 (40%), Gaps = 39/185 (21%)

Query: 291 FSKDGRFLATGGKDRILRIWKVIASPTERLELDSSTMKPSKTVCMLNG-KLISYSRDVPQ 349
           FS DG+FLATG +DR++RIW +               +  K V +L G +   YS D   
Sbjct: 451 FSPDGKFLATGAEDRLIRIWDI---------------ENRKIVMILQGHEQDIYSLDYFP 495

Query: 350 SGFARTENGDNPEDDSLDTNGMFPDESLNLYAPVFHPLPYRSFLGHNQDILDIDWSKNNF 409
           SG           D  +  +G   D ++ ++            +      + +      +
Sbjct: 496 SG-----------DKLVSGSG---DRTVRIWDLRTGQCSLTLSIEDGVTTVAVSPGDGKY 541

Query: 410 VLTGSMDKTVKLWHCDRKQLLKNF--------PHPDFVTCVKFHPNDDRFFISGCLDHKA 461
           +  GS+D+ V++W  +   L++           H D V  V F   D +  +SG LD   
Sbjct: 542 IAAGSLDRAVRVWDSETGFLVERLDSENESGTGHKDSVYSVVF-TRDGQSVVSGSLDRSV 600

Query: 462 RLWSI 466
           +LW++
Sbjct: 601 KLWNL 605

>ADL082C [1659] [Homologous to ScYIL046W (MET30) - SH]
           (538948..540657) [1710 bp, 569 aa]
          Length = 569

 Score = 54.3 bits (129), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 28/76 (36%), Positives = 40/76 (52%), Gaps = 2/76 (2%)

Query: 391 SFLGHNQDILDIDWSKNNFVLTGSMDKTVKLWHCDRKQLLKNFPHPDFVTCVKFHPNDDR 450
           ++ GH   +L +D S    +++GS DKTVK+WH + +       H  +V CVK HP    
Sbjct: 334 TYRGHQDSVLSVD-SFRKLIVSGSADKTVKVWHVESRTCYTLRGHTGWVNCVKLHPKSFT 392

Query: 451 FFISGCLDHKARLWSI 466
            F SG  D   R+W I
Sbjct: 393 CF-SGSDDMTIRMWDI 407

 Score = 46.6 bits (109), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 52/205 (25%), Positives = 88/205 (42%), Gaps = 37/205 (18%)

Query: 390 RSFLGHNQDILDIDWSKNNFVLTGSMDKTVKLWHCDRKQLLKNFP-HPDFVTCVKFHPND 448
           + F GH   +L +  + N  +LTGS D TV +W     +L++    H D V  ++F   D
Sbjct: 253 QEFKGHMDGVLSLQLT-NKLLLTGSYDSTVAIWDLATGKLIRRLSGHTDGVKALRF---D 308

Query: 449 DRFFISGCLDHKARLWSILDDEVSFEFDCGDLITSLEVSPGDSKYTILGTFNGYVIVLLT 508
           D+  I+G LD   R+W              + +T   VS          T+ G+   +L+
Sbjct: 309 DQKLITGSLDKTIRVW--------------NYVTGACVS----------TYRGHQDSVLS 344

Query: 509 RGLEHVYSFHLSDKQDKKGK--DVTTRDLPTSRTNTHHGPKV----TGIECFRAVNDMTL 562
             ++      +S   DK  K   V +R   T R +T     V        CF   +DMT+
Sbjct: 345 --VDSFRKLIVSGSADKTVKVWHVESRTCYTLRGHTGWVNCVKLHPKSFTCFSGSDDMTI 402

Query: 563 KLLVTSNDSKIRVFNLKDNILQEVL 587
           ++     ++ +RVF+     +Q+V+
Sbjct: 403 RMWDIRTNTCVRVFHGHVGQVQKVI 427

>Scas_630.6
          Length = 621

 Score = 53.5 bits (127), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 59/217 (27%), Positives = 87/217 (40%), Gaps = 60/217 (27%)

Query: 291 FSKDGRFLATGGKDRILRIWKVIASPTERLELDSSTMKPSKTVCMLNG------------ 338
           FS DG FLATG +D+++RIW +               K  K V +L G            
Sbjct: 349 FSPDGEFLATGAEDKLIRIWNI---------------KERKIVMVLKGHEQDIYSLDYFP 393

Query: 339 ---KLISYSRD---------VPQSGFART-ENGD-----NPEDDSLDTNGMFPDESLNLY 380
              KL+S S D           Q     + E+G      +P +  L   G   D S+ ++
Sbjct: 394 DGQKLVSGSGDRSIRIWDLKTGQCSLTLSIEDGVTTVAVSPNEGKLIAAGSL-DRSVRIW 452

Query: 381 APVFHPLPYR------SFLGHNQDILDIDWSKN-NFVLTGSMDKTVKLWHCDRKQL---- 429
                 L  R      S  GH   +  + ++K+   V++GS+D+TVKLW+    Q     
Sbjct: 453 DSSTGFLVERLDSDNESGNGHQDSVYSVAFTKDGQHVVSGSLDRTVKLWNLGDTQSGTGK 512

Query: 430 --LKNFPHPDFVTCVKFHPNDDRFFISGCLDHKARLW 464
             +    H DFV  V    NDD++  SG  D    +W
Sbjct: 513 CEVTYIGHKDFVLSVATS-NDDKYIFSGSKDRGVIIW 548

 Score = 49.7 bits (117), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 38/137 (27%), Positives = 61/137 (44%), Gaps = 7/137 (5%)

Query: 394 GHNQDILDIDW-SKNNFVLTGSMDKTVKLWHCDRKQLLKNFPHPDFVTCVKFHPNDDRFF 452
           GH QDI  +D+      +++GS D+++++W     Q        D VT V   PN+ +  
Sbjct: 381 GHEQDIYSLDYFPDGQKLVSGSGDRSIRIWDLKTGQCSLTLSIEDGVTTVAVSPNEGKLI 440

Query: 453 ISGCLDHKARLWSILDDEVSFEFDCGDLITSLEVSPGDSKYTILGTFNGYVIVLLTRGLE 512
            +G LD   R+W   D    F  +  D          DS Y++  T +G  +V  +  L+
Sbjct: 441 AAGSLDRSVRIW---DSSTGFLVERLDSDNESGNGHQDSVYSVAFTKDGQHVV--SGSLD 495

Query: 513 H-VYSFHLSDKQDKKGK 528
             V  ++L D Q   GK
Sbjct: 496 RTVKLWNLGDTQSGTGK 512

 Score = 47.0 bits (110), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 24/93 (25%), Positives = 47/93 (50%), Gaps = 2/93 (2%)

Query: 409 FVLTGSMDKTVKLWHC-DRKQLLKNFPHPDFVTCVKFHPNDDRFFISGCLDHKARLWSIL 467
           F+ TG+ DK +++W+  +RK ++    H   +  + + P D +  +SG  D   R+W + 
Sbjct: 355 FLATGAEDKLIRIWNIKERKIVMVLKGHEQDIYSLDYFP-DGQKLVSGSGDRSIRIWDLK 413

Query: 468 DDEVSFEFDCGDLITSLEVSPGDSKYTILGTFN 500
             + S      D +T++ VSP + K    G+ +
Sbjct: 414 TGQCSLTLSIEDGVTTVAVSPNEGKLIAAGSLD 446

>KLLA0F10263g 949926..951974 gi|2494900|sp|P56094|TUP1_KLULA
           Kluyveromyces lactis Transcriptional repressor TUP1,
           start by similarity
          Length = 682

 Score = 53.5 bits (127), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 51/221 (23%), Positives = 93/221 (42%), Gaps = 35/221 (15%)

Query: 289 MKFSKDGRFLATGGKDRILRIWKV-IASPTERLELDSSTMKPSKTVCMLNGKLISYSRDV 347
           ++FS DG FLATG  ++  +++KV       RL  DS++    +            ++ V
Sbjct: 327 VRFSSDGEFLATGC-NKTTQVYKVSTGELVARLSDDSASQPQPQPQ----------NQTV 375

Query: 348 PQSGFARTENGDNPEDDSLDTNGMFPDESLNLY--APVFHPLPYRSFLGHNQDILDIDWS 405
                    NG + ED + + N      S +LY  +  F P                   
Sbjct: 376 TAETSTSNSNGSSAEDGTGNQNSAASTASSDLYIRSVCFSP------------------- 416

Query: 406 KNNFVLTGSMDKTVKLWHCDRKQLLKNFP-HPDFVTCVKFHPNDDRFFISGCLDHKARLW 464
              F+ TG+ DK +++W  + K+++     H   +  + + P+ ++  +SG  D   R+W
Sbjct: 417 DGKFLATGAEDKLIRIWDLETKKIVMTLKGHEQDIYSLDYFPSGNKL-VSGSGDRTVRIW 475

Query: 465 SILDDEVSFEFDCGDLITSLEVSPGDSKYTILGTFNGYVIV 505
            +     S      D +T++ VSPG+ K+   G+ +  V V
Sbjct: 476 DLTTGTCSLTLSIEDGVTTVAVSPGEGKFIAAGSLDRTVRV 516

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 45/185 (24%), Positives = 76/185 (41%), Gaps = 39/185 (21%)

Query: 291 FSKDGRFLATGGKDRILRIWKVIASPTERLELDSSTMKPSKTVCMLNG-KLISYSRDVPQ 349
           FS DG+FLATG +D+++RIW                ++  K V  L G +   YS D   
Sbjct: 414 FSPDGKFLATGAEDKLIRIWD---------------LETKKIVMTLKGHEQDIYSLDYFP 458

Query: 350 SGFARTENGDNPEDDSLDTNGMFPDESLNLYAPVFHPLPYRSFLGHNQDILDIDWSKNNF 409
           SG           +  +  +G   D ++ ++            +      + +   +  F
Sbjct: 459 SG-----------NKLVSGSG---DRTVRIWDLTTGTCSLTLSIEDGVTTVAVSPGEGKF 504

Query: 410 VLTGSMDKTVKLWHCDRKQLLKNF--------PHPDFVTCVKFHPNDDRFFISGCLDHKA 461
           +  GS+D+TV++W  D   L++           H D V  V F   D +  +SG LD   
Sbjct: 505 IAAGSLDRTVRVWDSDTGFLVERLDSENELGTGHRDSVYSVVF-TRDGKGVVSGSLDRSV 563

Query: 462 RLWSI 466
           +LW++
Sbjct: 564 KLWNL 568

>CAGL0C03608g 360681..362612 similar to sp|P16649 Saccharomyces
           cerevisiae YCR084c TUP1 general transcription repressor,
           hypothetical start
          Length = 643

 Score = 53.1 bits (126), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 34/113 (30%), Positives = 52/113 (46%), Gaps = 4/113 (3%)

Query: 394 GHNQDILDIDW-SKNNFVLTGSMDKTVKLWHCDRKQLLKNFPHPDFVTCVKFHPNDDRFF 452
           GH QDI  +D+    N +++GS D+T+++W     Q        D VT V   P +  + 
Sbjct: 413 GHEQDIYSLDYFQSGNKLVSGSGDRTIRIWDLHTGQCSLTLSIEDGVTTVAVSPGNGNYV 472

Query: 453 ISGCLDHKARLWSILDDEVSFEFDCGDLITSLEVSPGDSKYTILGTFNGYVIV 505
            +G LD   R+W   D    F  +  D      V   DS Y+++ T +G  IV
Sbjct: 473 AAGSLDRTVRVW---DSNSGFLVERLDSEGETGVGHKDSVYSVVFTRDGKNIV 522

 Score = 51.6 bits (122), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 46/185 (24%), Positives = 77/185 (41%), Gaps = 39/185 (21%)

Query: 291 FSKDGRFLATGGKDRILRIWKVIASPTERLELDSSTMKPSKTVCMLNG-KLISYSRDVPQ 349
           FS DG+FLATG +D+++RIW +                  K V +L G +   YS D  Q
Sbjct: 381 FSPDGKFLATGAEDKLIRIWDI---------------AQRKIVMVLRGHEQDIYSLDYFQ 425

Query: 350 SGFARTENGDNPEDDSLDTNGMFPDESLNLYAPVFHPLPYRSFLGHNQDILDIDWSKNNF 409
           SG           +  +  +G   D ++ ++            +      + +     N+
Sbjct: 426 SG-----------NKLVSGSG---DRTIRIWDLHTGQCSLTLSIEDGVTTVAVSPGNGNY 471

Query: 410 VLTGSMDKTVKLWHCDRKQLLKNF--------PHPDFVTCVKFHPNDDRFFISGCLDHKA 461
           V  GS+D+TV++W  +   L++           H D V  V F   D +  +SG LD   
Sbjct: 472 VAAGSLDRTVRVWDSNSGFLVERLDSEGETGVGHKDSVYSVVF-TRDGKNIVSGSLDRSV 530

Query: 462 RLWSI 466
           +LW++
Sbjct: 531 KLWNL 535

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 25/98 (25%), Positives = 48/98 (48%), Gaps = 2/98 (2%)

Query: 409 FVLTGSMDKTVKLWH-CDRKQLLKNFPHPDFVTCVKFHPNDDRFFISGCLDHKARLWSIL 467
           F+ TG+ DK +++W    RK ++    H   +  + +  + ++  +SG  D   R+W + 
Sbjct: 387 FLATGAEDKLIRIWDIAQRKIVMVLRGHEQDIYSLDYFQSGNK-LVSGSGDRTIRIWDLH 445

Query: 468 DDEVSFEFDCGDLITSLEVSPGDSKYTILGTFNGYVIV 505
             + S      D +T++ VSPG+  Y   G+ +  V V
Sbjct: 446 TGQCSLTLSIEDGVTTVAVSPGNGNYVAAGSLDRTVRV 483

>Scas_704.40
          Length = 608

 Score = 52.8 bits (125), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 27/76 (35%), Positives = 41/76 (53%), Gaps = 2/76 (2%)

Query: 391 SFLGHNQDILDIDWSKNNFVLTGSMDKTVKLWHCDRKQLLKNFPHPDFVTCVKFHPNDDR 450
           ++ GH   ++ +D  K   +++GS DKTVK+WH + +       H ++V CVK HP    
Sbjct: 328 TYRGHTDSVMSVDAFKK-IIVSGSADKTVKIWHVESRTCYTLRGHTEWVNCVKLHPKSFT 386

Query: 451 FFISGCLDHKARLWSI 466
            F SG  D   R+W I
Sbjct: 387 CF-SGSDDTTIRMWDI 401

 Score = 35.0 bits (79), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 23/76 (30%), Positives = 37/76 (48%), Gaps = 5/76 (6%)

Query: 390 RSFLGHNQDILDIDWSKNNFVLTGSMDKTVKLWH-CDRKQLLKNFPHPDFVTCVKFHPND 448
           + F GH   +L + ++    + TGS D TV +W  C  K + +   H D V  + F   D
Sbjct: 247 QEFKGHMDGVLTLQFNYR-LLFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTLYF---D 302

Query: 449 DRFFISGCLDHKARLW 464
           +   ++G LD   R+W
Sbjct: 303 EAKLVTGSLDKTIRVW 318

>AFL118W [3077] [Homologous to ScYGL137W (SEC27) - SH]
           complement(216252..216269,216423..218903) [2499 bp, 832
           aa]
          Length = 832

 Score = 52.4 bits (124), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 25/68 (36%), Positives = 39/68 (57%), Gaps = 2/68 (2%)

Query: 408 NFVLTGSMDKTVKLWHCDRKQLLKNF--PHPDFVTCVKFHPNDDRFFISGCLDHKARLWS 465
           ++VL+ S D TVKLW+ ++   L+     H  FV  V F+P D   F + CLDH  ++WS
Sbjct: 110 SYVLSASDDLTVKLWNWEKNWALEQTFEGHEHFVMSVTFNPKDPNTFATACLDHTVKIWS 169

Query: 466 ILDDEVSF 473
           +  +  +F
Sbjct: 170 LGQETSNF 177

 Score = 35.0 bits (79), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 22/74 (29%), Positives = 37/74 (50%), Gaps = 2/74 (2%)

Query: 410 VLTGSMDKTVKLWHCDRKQLLKNF-PHPDFVTCVKFHPNDDRFFISGCLDHKARLWSILD 468
           +++GS D TVK+W+ +  +L +      +   CV  HP   R FI+   D+   + +I +
Sbjct: 243 IISGSEDGTVKIWNSNTYKLERTLNLGLERSWCVAAHPTGKRNFIAAGFDNGFTVLAIGN 302

Query: 469 DEVSFEFD-CGDLI 481
           DE     D  G L+
Sbjct: 303 DEPRLSLDPVGKLV 316

>YIL046W (MET30) [2621] chr9 (268650..270572) F-box protein that
           targets proteins for ubiquitination by interacting with
           the SCF complex (Skp1p-Cdc53p-Cdc34p), regulates sulfur
           assimilation genes in response to S-adenosylmethionine
           levels, contains five WD (WD-40) repeats [1923 bp, 640
           aa]
          Length = 640

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 27/76 (35%), Positives = 41/76 (53%), Gaps = 2/76 (2%)

Query: 391 SFLGHNQDILDIDWSKNNFVLTGSMDKTVKLWHCDRKQLLKNFPHPDFVTCVKFHPNDDR 450
           ++ GH+  +L +D S    +++GS DKTVK+WH + +       H ++V CVK HP    
Sbjct: 377 TYRGHSDSVLSVD-SYQKVIVSGSADKTVKVWHVESRTCYTLRGHTEWVNCVKLHPKSFS 435

Query: 451 FFISGCLDHKARLWSI 466
            F S   D   R+W I
Sbjct: 436 CF-SCSDDTTIRMWDI 450

 Score = 40.4 bits (93), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 46/211 (21%), Positives = 88/211 (41%), Gaps = 40/211 (18%)

Query: 390 RSFLGHNQDILDIDWSKNNFVLTGSMDKTVKLWHCDRKQLLKNFP-HPDFVTCVKFHPND 448
           + F GH   +L + ++    + TGS D T+ +W     +L++    H D V  + F   D
Sbjct: 296 QEFKGHMDGVLTLQFNYR-LLFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLYF---D 351

Query: 449 DRFFISGCLDHKARLWSILDDEVSFEFDCGDLITSLEVSPGDSKYTILGTFNGYVIVLLT 508
           DR  I+G LD   R+W+ +  E                         + T+ G+   +L+
Sbjct: 352 DRKLITGSLDKTIRVWNYITGEC------------------------ISTYRGHSDSVLS 387

Query: 509 RGLEHVYSFHLSDKQDKKGK--DVTTRDLPTSRTNTHHGPKVTGIECFRAVNDMTLKLLV 566
             ++      +S   DK  K   V +R   T R +T        + C + ++  +     
Sbjct: 388 --VDSYQKVIVSGSADKTVKVWHVESRTCYTLRGHTE------WVNCVK-LHPKSFSCFS 438

Query: 567 TSNDSKIRVFNLKDNILQEVLKGFENESSQI 597
            S+D+ IR+++++ N   +V +G   +  +I
Sbjct: 439 CSDDTTIRMWDIRTNSCLKVFRGHVGQVQKI 469

>CAGL0L00781g 95506..97527 similar to sp|P39014 Saccharomyces
           cerevisiae YIL046w MET30, hypothetical start
          Length = 673

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 26/77 (33%), Positives = 40/77 (51%), Gaps = 4/77 (5%)

Query: 391 SFLGHNQDILDIDWSKNNFVLTGSMDKTVKLWHCDRKQLLKNFPHPDFVTCVKFHPNDDR 450
           ++ GH   ++ +D S    +++GS DKTVK+WH + +       H ++V CVK HP    
Sbjct: 409 TYRGHTDSVMSVD-SHKKIIVSGSADKTVKVWHVESRTCYTLKGHTEWVNCVKLHPKS-- 465

Query: 451 FFISGCLDHKA-RLWSI 466
           F    C D    R+W I
Sbjct: 466 FSCYSCSDDTTIRMWDI 482

 Score = 39.3 bits (90), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 25/83 (30%), Positives = 41/83 (49%), Gaps = 5/83 (6%)

Query: 390 RSFLGHNQDILDIDWSKNNFVLTGSMDKTVKLWHCDRKQLLKNFP-HPDFVTCVKFHPND 448
           + F GH   +L + ++    + TGS D TV +W     +L++    H D V  + F   D
Sbjct: 328 QEFKGHMDGVLTLQFNYR-LLFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYF---D 383

Query: 449 DRFFISGCLDHKARLWSILDDEV 471
           D+  I+G LD   R+W+ +  E 
Sbjct: 384 DQKLITGSLDKTIRVWNYITGEC 406

 Score = 33.1 bits (74), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 19/78 (24%), Positives = 39/78 (50%), Gaps = 5/78 (6%)

Query: 390 RSFLGHNQDILDIDWSKNNFVLTGSMDKTVKLWHCDRKQLLKNF-PHPDFVTCVKFHPND 448
           R   GH+  +  + +  +  ++TGS+DKT+++W+    + +  +  H D V  V  H   
Sbjct: 368 RRLTGHSDGVKTL-YFDDQKLITGSLDKTIRVWNYITGECISTYRGHTDSVMSVDSHK-- 424

Query: 449 DRFFISGCLDHKARLWSI 466
            +  +SG  D   ++W +
Sbjct: 425 -KIIVSGSADKTVKVWHV 441

>YMR116C (ASC1) [4073] chr13
           complement(499455..499877,500151..500687) Ribosomal
           protein of the 40S ribosomal subunit that influences
           translational efficiency and cell size, contains two WD
           (WD-40) repeats [960 bp, 319 aa]
          Length = 319

 Score = 50.4 bits (119), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 36/126 (28%), Positives = 63/126 (50%), Gaps = 14/126 (11%)

Query: 362 EDDSLDTNGMFP-----DESLNLYAPVFHPLPYRSFLGHNQDIL--DIDWSKNNFVLTGS 414
           +D +L  +G +      D++L L+  V     Y+ F+GH  D++  DID  K + +++GS
Sbjct: 69  QDCTLTADGAYALSASWDKTLRLW-DVATGETYQRFVGHKSDVMSVDID-KKASMIISGS 126

Query: 415 MDKTVKLWHCDRKQLLKNFPHPDFVTCVKFHPN-----DDRFFISGCLDHKARLWSILDD 469
            DKT+K+W    + L     H D+V+ V+  PN     D    IS   D   + W++   
Sbjct: 127 RDKTIKVWTIKGQCLATLLGHNDWVSQVRVVPNEKADDDSVTIISAGNDKMVKAWNLNQF 186

Query: 470 EVSFEF 475
           ++  +F
Sbjct: 187 QIEADF 192

 Score = 38.1 bits (87), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 27/104 (25%), Positives = 46/104 (44%), Gaps = 3/104 (2%)

Query: 387 LPYRSFLGHNQDILDIDWSKNN-FVLTGSMDKTVKLWHCDRKQLLKNF-PHPDFVTCVKF 444
           +P RSF GH+  + D   + +  + L+ S DKT++LW     +  + F  H   V  V  
Sbjct: 56  VPVRSFKGHSHIVQDCTLTADGAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVDI 115

Query: 445 HPNDDRFFISGCLDHKARLWSILDDEVSFEFDCGDLITSLEVSP 488
                   ISG  D   ++W+I    ++      D ++ + V P
Sbjct: 116 DKK-ASMIISGSRDKTIKVWTIKGQCLATLLGHNDWVSQVRVVP 158

>Kwal_23.5769
          Length = 627

 Score = 51.2 bits (121), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 27/76 (35%), Positives = 41/76 (53%), Gaps = 2/76 (2%)

Query: 391 SFLGHNQDILDIDWSKNNFVLTGSMDKTVKLWHCDRKQLLKNFPHPDFVTCVKFHPNDDR 450
           ++ GH+  +L +D S    +++GS DKTVK+WH + +       H ++V  VK HP    
Sbjct: 392 AYPGHSDSVLSVD-SYKKIIVSGSADKTVKVWHVESRTCYTLRGHTEWVGTVKLHPKSFT 450

Query: 451 FFISGCLDHKARLWSI 466
            F SG  D   R+W I
Sbjct: 451 CF-SGSDDTTIRMWDI 465

 Score = 38.1 bits (87), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 45/203 (22%), Positives = 82/203 (40%), Gaps = 33/203 (16%)

Query: 390 RSFLGHNQDILDIDWSKNNFVLTGSMDKTVKLWHCDRKQLLKNFP-HPDFVTCVKFHPND 448
           + F GH   +L + ++    + TGS D TV +W     +L++    H D V  + F   D
Sbjct: 311 QEFKGHMDGVLSLQFN-YRLLFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAIYF---D 366

Query: 449 DRFFISGCLDHKARLWSILDDEVSFEFDCGDLITSLEVSPGDSKYTILGTFNGYVIVLLT 508
            +  I+G LD   R+W+ +       +            PG S  ++L   +   I++  
Sbjct: 367 GQKLITGSLDRMIRVWNYVTGACVAAY------------PGHSD-SVLSVDSYKKIIVSG 413

Query: 509 RGLEHVYSFHLSDKQDKKGKDVTTRDLPTSRTNTHHGPKV----TGIECFRAVNDMTLKL 564
              + V  +H           V +R   T R +T     V        CF   +D T+++
Sbjct: 414 SADKTVKVWH-----------VESRTCYTLRGHTEWVGTVKLHPKSFTCFSGSDDTTIRM 462

Query: 565 LVTSNDSKIRVFNLKDNILQEVL 587
               +++ ++VF      +Q+VL
Sbjct: 463 WDIRSNTCVKVFRGHVGQVQKVL 485

 Score = 37.4 bits (85), Expect = 0.071,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 37/68 (54%), Gaps = 7/68 (10%)

Query: 390 RSFLGHNQDILDIDWSKNNF-VLTGSMDKTVKLWHCDRKQLLKNF-PHPDFVTCVKFHPN 447
           R+  GH + I DI  + +NF +++G+ DKTVK+W     + +  F  H   +TCV     
Sbjct: 553 RTHFGHVEGIWDI--AADNFRIVSGAHDKTVKVWDLQSGKCIHTFDSHQAPITCVGI--- 607

Query: 448 DDRFFISG 455
            D  F+SG
Sbjct: 608 GDSEFVSG 615

>Sklu_2160.3 YGL137W, Contig c2160 2536-4818 reverse complement
          Length = 760

 Score = 50.8 bits (120), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 30/51 (58%), Gaps = 2/51 (3%)

Query: 418 TVKLWHCDRKQLLKNF--PHPDFVTCVKFHPNDDRFFISGCLDHKARLWSI 466
           T+KLW+ ++   L+     H  FV CV F+P D   F S CLDH  ++WS+
Sbjct: 2   TIKLWNWEKNWALEQTFEGHEHFVMCVAFNPKDPNTFASACLDHTVKIWSL 52

 Score = 34.3 bits (77), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 21/74 (28%), Positives = 37/74 (50%), Gaps = 2/74 (2%)

Query: 410 VLTGSMDKTVKLWHCDRKQLLKNF-PHPDFVTCVKFHPNDDRFFISGCLDHKARLWSILD 468
           +++GS D TVK+W+ +  +L K      +   CV  HP   R +++   D+   + S+ +
Sbjct: 125 IISGSEDGTVKIWNANTYKLEKTLNLGLERSWCVAAHPTGKRNYVASGFDNGFNVLSMGN 184

Query: 469 DEVSFEFD-CGDLI 481
           DE     D  G L+
Sbjct: 185 DEPRLSLDPVGKLV 198

>YNL006W (LST8) [4579] chr14 (620066..620977) Protein required for
           transport of permeases from the Golgi to the plasma
           membrane [912 bp, 303 aa]
          Length = 303

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 61/270 (22%), Positives = 112/270 (41%), Gaps = 58/270 (21%)

Query: 386 PLPYRSFLGHNQDILDIDWSKNN-FVLTGSMDKTVKLWHCDRKQLLKNFPHPDFVTCVKF 444
           P P  SF GH  ++  + + ++N +++T S D T+K+W      + +N+ H   V  V  
Sbjct: 65  PNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNYKHNAPVNEVVI 124

Query: 445 HPNDDRFFISGCLDHKARLWSILDDEVSFEFDCGDLITSLEVSPGDSKYTILGTFNGYVI 504
           HPN     IS   D   R+W + +++ + +    D  TSL+     S  ++L   N    
Sbjct: 125 HPNQGE-LISCDRDGNIRIWDLGENQCTHQLTPED-DTSLQSLSMASDGSMLAAAN---- 178

Query: 505 VLLTRGLEHVYSFHLSDKQDKKGKDVTTRDLPTSRTNTHHGPKVTGIECFRAVNDMTLKL 564
              T+G  +V+                  ++P     +H  P    +  FRA +    ++
Sbjct: 179 ---TKGNCYVW------------------EMPNHTDASHLKP----VTKFRAHSTYITRI 213

Query: 565 LVTSN---------DSKIRVFNLKDNI-LQEVLKG-----FENESSQISAHLITGSKNKQ 609
           L++S+         D   RV+++ D+  L+  L G     ++   S  SA+L+T S    
Sbjct: 214 LLSSDVKHLATCSADHTARVWSIDDDFKLETTLDGHQRWVWDCAFSADSAYLVTASS--- 270

Query: 610 QFVIAPSEDHWIYCWKLQSSLMTKDKDKEH 639
                   DH++  W L +  + +     H
Sbjct: 271 --------DHYVRLWDLSTREIVRQYGGHH 292

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 51/215 (23%), Positives = 85/215 (39%), Gaps = 35/215 (16%)

Query: 289 MKFSKDGRFLATGGKDRILRIWKVIASPTER-----LELDSSTMKPSKTVCMLNGKLISY 343
           + F +D R++ T  +D  +++W V +    R       ++   + P++      G+LIS 
Sbjct: 81  VSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNYKHNAPVNEVVIHPNQ------GELISC 134

Query: 344 SRD----VPQSGFARTENGDNPEDD-SLDTNGMFPDESL--------NLYAPVF------ 384
            RD    +   G  +  +   PEDD SL +  M  D S+        N Y          
Sbjct: 135 DRDGNIRIWDLGENQCTHQLTPEDDTSLQSLSMASDGSMLAAANTKGNCYVWEMPNHTDA 194

Query: 385 -HPLPYRSFLGHNQDILDIDWSKN-NFVLTGSMDKTVKLWHCDRKQLLKNF--PHPDFVT 440
            H  P   F  H+  I  I  S +   + T S D T ++W  D    L+     H  +V 
Sbjct: 195 SHLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSIDDDFKLETTLDGHQRWVW 254

Query: 441 CVKFHPNDDRFFISGCLDHKARLWSILDDEVSFEF 475
              F   D  + ++   DH  RLW +   E+  ++
Sbjct: 255 DCAFSA-DSAYLVTASSDHYVRLWDLSTREIVRQY 288

>Sklu_2318.1 YKL213C, Contig c2318 605-2740 reverse complement
          Length = 711

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 62/235 (26%), Positives = 97/235 (41%), Gaps = 44/235 (18%)

Query: 388 PYRSFLGHNQDILDIDWSKNNFVLTGSMDKTVKLWHCDRKQLLKNFPHPDFVTCVKFHPN 447
           P    +GH  ++  +  SKNNFV++ S DKT K+WH +   +     H   V   KF P 
Sbjct: 91  PVYMLIGHKGNVCSLS-SKNNFVISSSWDKTAKVWH-NGSAIYDLVGHSASVWDAKFLPE 148

Query: 448 DDRFFISGCLDHKARLWSILDDEVSFEFDCGDLITSLEVSPGDSKYT------------- 494
            D FF++   D   +LW       +F     D+I  L++SP    +              
Sbjct: 149 KD-FFLTASADCTIKLWHGNKLIKTFSGIHKDVIRHLDISPDGETFASCSNDGTVKINDM 207

Query: 495 ---ILGTFNGYVIVLLTRGLEHVYSFHLSDKQDKKGKDVTTRDLPTSRTNTHHGPKVTGI 551
              IL TF G+             SF  S K    G  V+  +  + R  +  G  V  +
Sbjct: 208 DGNILKTFTGH------------ESFVYSVKFLPNGDLVSCGEDRSVRVWSKTG-AVKQV 254

Query: 552 ECFRAVNDMTL------KLLVTSNDSKIRVFNLKD------NILQEVLKGFENES 594
               AV+   L       +LV S+D+ +R+F +++      + L+E+ K  EN S
Sbjct: 255 LRLPAVSIWDLDILPNGDILVGSSDNMVRIFTVEESRIASNSKLEELQKQVENSS 309

>Sklu_2382.2 YDL195W, Contig c2382 2146-5931 reverse complement
          Length = 1261

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 29/100 (29%), Positives = 49/100 (49%), Gaps = 5/100 (5%)

Query: 394 GHNQDILDIDWSKN--NFVLTGSMDKTVKLWHCDRKQLLKNFP-HPDFVTCVKFHPNDDR 450
           GH++ IL +DW K   N +L+   D T  LW+    Q L  FP   ++    KF P    
Sbjct: 249 GHSKGILSLDWCKQDENLLLSSGRDNTCALWNPQTAQKLSQFPTRGNWCFKTKFAPEAPD 308

Query: 451 FFISGCLDHKARLWSILDDEVSFEFDCGDLITSLEVSPGD 490
            F S  LD+K ++ ++    ++ + D  D+++  + S  D
Sbjct: 309 LFASASLDNKIQVQTL--QNLTNKLDLEDIVSKQQESEAD 346

 Score = 32.7 bits (73), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 19/68 (27%), Positives = 32/68 (47%), Gaps = 2/68 (2%)

Query: 401 DIDWSKNNFVLTGSMDKTVKLWHCDR--KQLLKNFPHPDFVTCVKFHPNDDRFFISGCLD 458
           D+DWS +N +L G++D  +  +   +  K + K   H   V  +KF+   D    SG   
Sbjct: 67  DLDWSPDNSILAGALDNGIVEFFSPKELKSVAKISKHTTPVNTLKFNAKQDNVLCSGDSR 126

Query: 459 HKARLWSI 466
            +  +W I
Sbjct: 127 GEIFIWDI 134

>Scas_721.115*
          Length = 318

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 36/125 (28%), Positives = 63/125 (50%), Gaps = 13/125 (10%)

Query: 362 EDDSLDTNGMFP-----DESLNLYAPVFHPLPYRSFLGHNQDILD--IDWSKNNFVLTGS 414
           +D +L  +G +      D++L L+  V     Y+ F+GH  D++   ID  K + +++GS
Sbjct: 69  QDCTLTQDGAYALSASWDKTLRLW-DVATGETYQRFVGHKSDVMSVAID-RKASMIISGS 126

Query: 415 MDKTVKLWHCDRKQLLKNFPHPDFVTCVKFHP---NDDRF-FISGCLDHKARLWSILDDE 470
            DKT+K+W    + L     H D+V+ V+  P   NDD    IS   D   + W++   +
Sbjct: 127 RDKTIKVWTIKGQCLATLLGHNDWVSQVRIAPTDQNDDSVTVISAGNDKMVKAWNLNQFQ 186

Query: 471 VSFEF 475
           +  +F
Sbjct: 187 IEADF 191

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 29/109 (26%), Positives = 51/109 (46%), Gaps = 9/109 (8%)

Query: 387 LPYRSFLGHNQDILDIDWSKNN-FVLTGSMDKTVKLWHCDRKQLLKNF-PHPDFVTCVKF 444
           +P RSF GH+  + D   +++  + L+ S DKT++LW     +  + F  H   V  V  
Sbjct: 56  VPVRSFKGHSHIVQDCTLTQDGAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVAI 115

Query: 445 HPNDDR---FFISGCLDHKARLWSILDDEVSFEFDCGDLITSLEVSPGD 490
               DR     ISG  D   ++W+I    ++      D ++ + ++P D
Sbjct: 116 ----DRKASMIISGSRDKTIKVWTIKGQCLATLLGHNDWVSQVRIAPTD 160

>YDL145C (COP1) [723] chr4 complement(194572..198177) Coatomer
           (COPI) complex alpha chain (alpha-COP) of secretory
           pathway vesicles required for retrograde Golgi to
           endoplasmic reticulum transport, member of WD (WD-40)
           repeat family [3606 bp, 1201 aa]
          Length = 1201

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 36/59 (61%), Gaps = 2/59 (3%)

Query: 409 FVLTGSMDKTVKLWHC-DRKQLLKNFPHPDFVTCVKFHPNDDRFFISGCLDHKARLWSI 466
           ++++ S D+T+++W+  +RK++     H  FV C +FHP DD   +S  LD   R+W I
Sbjct: 109 WIISASDDQTIRIWNWQNRKEIACLTGHNHFVMCAQFHPTDD-LIVSASLDETIRIWDI 166

>Scas_592.4*
          Length = 318

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 36/125 (28%), Positives = 63/125 (50%), Gaps = 13/125 (10%)

Query: 362 EDDSLDTNGMFP-----DESLNLYAPVFHPLPYRSFLGHNQDILD--IDWSKNNFVLTGS 414
           +D +L  +G +      D++L L+  V     Y+ F+GH  D++   ID  K + +++GS
Sbjct: 69  QDCTLTQDGAYALSASWDKTLRLW-DVATGETYQRFVGHKSDVMSVAID-RKASMIISGS 126

Query: 415 MDKTVKLWHCDRKQLLKNFPHPDFVTCVKFHP---NDDRF-FISGCLDHKARLWSILDDE 470
            DKT+K+W    + L     H D+V+ V+  P   NDD    IS   D   + W++   +
Sbjct: 127 RDKTIKVWTIKGQCLATLLGHNDWVSQVRIAPTDQNDDAVTVISAGNDKMVKAWNLNQFQ 186

Query: 471 VSFEF 475
           +  +F
Sbjct: 187 IEADF 191

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 29/109 (26%), Positives = 51/109 (46%), Gaps = 9/109 (8%)

Query: 387 LPYRSFLGHNQDILDIDWSKNN-FVLTGSMDKTVKLWHCDRKQLLKNF-PHPDFVTCVKF 444
           +P RSF GH+  + D   +++  + L+ S DKT++LW     +  + F  H   V  V  
Sbjct: 56  VPVRSFKGHSHIVQDCTLTQDGAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVAI 115

Query: 445 HPNDDR---FFISGCLDHKARLWSILDDEVSFEFDCGDLITSLEVSPGD 490
               DR     ISG  D   ++W+I    ++      D ++ + ++P D
Sbjct: 116 ----DRKASMIISGSRDKTIKVWTIKGQCLATLLGHNDWVSQVRIAPTD 160

>KLLA0F27511g 2546533..2548404 similar to sp|P39014 Saccharomyces
           cerevisiae YIL046w MET30 involved in regulation of
           sulfur assimilation genes and cell cycle progression,
           start by similarity
          Length = 623

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 25/76 (32%), Positives = 39/76 (51%), Gaps = 2/76 (2%)

Query: 391 SFLGHNQDILDIDWSKNNFVLTGSMDKTVKLWHCDRKQLLKNFPHPDFVTCVKFHPNDDR 450
           ++ GH   +L +D S    +++ S DKTVK+WH + +       H ++V CVK HP    
Sbjct: 387 TYRGHQDSVLSVD-SYKKIIVSASADKTVKVWHVESRTCYTLRGHTEWVNCVKLHPKSFT 445

Query: 451 FFISGCLDHKARLWSI 466
            + S   D   R+W I
Sbjct: 446 CY-SSSDDKTLRMWDI 460

 Score = 35.4 bits (80), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 23/77 (29%), Positives = 38/77 (49%), Gaps = 5/77 (6%)

Query: 392 FLGHNQDILDIDWSKNNFVLTGSMDKTVKLWHCDRKQLLKNFP-HPDFVTCVKFHPNDDR 450
           F GH   +L + ++ +  + TGS D TV +W      L++    H D V  + F   DD+
Sbjct: 308 FKGHMDGVLSLKFN-HRLLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIYF---DDQ 363

Query: 451 FFISGCLDHKARLWSIL 467
             I+  LD   R+W+ +
Sbjct: 364 KMITASLDKTIRVWNYI 380

 Score = 33.9 bits (76), Expect = 0.82,   Method: Compositional matrix adjust.
 Identities = 22/77 (28%), Positives = 41/77 (53%), Gaps = 7/77 (9%)

Query: 390 RSFLGHNQDILDIDWSKNNF-VLTGSMDKTVKLWHCDRKQLLKNFP-HPDFVTCVKFHPN 447
           R+  GH + + DI  + +NF +++GS DK++K+W     + ++ F  H   + CV     
Sbjct: 547 RTQFGHVEGVWDI--AADNFRIVSGSHDKSIKVWDLQNGKCIQTFTGHKAPIVCVGI--- 601

Query: 448 DDRFFISGCLDHKARLW 464
            D  F+SG    + ++W
Sbjct: 602 GDSSFVSGDELGEVKMW 618

>KLLA0D04840g 413362..414273 highly similar to sp|P41318
           Saccharomyces cerevisiae YNL006w LST8 required for
           transport of permeases from the golgi to the plasma
           membrane, start by similarity
          Length = 303

 Score = 47.4 bits (111), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 62/264 (23%), Positives = 108/264 (40%), Gaps = 46/264 (17%)

Query: 386 PLPYRSFLGHNQDILDIDWSKNN-FVLTGSMDKTVKLWHCDRKQLLKNFPHPDFVTCVKF 444
           P P  SF GH  ++  I + + N ++++ S D T+K+W      + +N+ H   V  V  
Sbjct: 65  PNPVSSFEGHKGNVTSIAFQQENRWMVSSSEDGTIKVWDVRSPSVQRNYKHNAPVNEVAI 124

Query: 445 HPNDDRFFISGCLDHKARLWSILDDEVSFEFDCGD--LITSLEVSPGDSKYTILGTFNGY 502
           HPN     IS   D   R+W + +++ + +    D   + SL V+  D    + G   G 
Sbjct: 125 HPNQGE-LISCDQDGNIRIWDLGENQCTNQLTPEDNTPLQSLSVA-SDGSMLVAGNNKG- 181

Query: 503 VIVLLTRGLEHVYSFHLSDKQDKKGKDVTTRDLPTSRTNTHHGPKVTGIECFRAVNDMTL 562
                     + Y + +    D    +      P ++  + H   +T     R +    +
Sbjct: 182 ----------NCYVWKMPHHTDASTLE------PVTKFKS-HTKYIT-----RVLLSADV 219

Query: 563 KLLVT-SNDSKIRVFNLKDNI-LQEVLKG-----FENESSQISAHLITGSKNKQQFVIAP 615
           K L T S D   RV+N++DN  L+  L G     ++   S  SA+L+T            
Sbjct: 220 KHLATCSADHTARVWNIEDNFELETTLDGHQRWVWDCAFSADSAYLVTACS--------- 270

Query: 616 SEDHWIYCWKLQSSLMTKDKDKEH 639
             DH++  W L +S + +     H
Sbjct: 271 --DHYVRLWDLSTSEIVRQYGGHH 292

 Score = 37.0 bits (84), Expect = 0.062,   Method: Compositional matrix adjust.
 Identities = 45/217 (20%), Positives = 89/217 (41%), Gaps = 39/217 (17%)

Query: 289 MKFSKDGRFLATGGKDRILRIWKVIASPTER-----LELDSSTMKPSKTVCMLNGKLISY 343
           + F ++ R++ +  +D  +++W V +   +R       ++   + P++      G+LIS 
Sbjct: 81  IAFQQENRWMVSSSEDGTIKVWDVRSPSVQRNYKHNAPVNEVAIHPNQ------GELISC 134

Query: 344 SRD----VPQSGFARTENGDNPEDDS-LDTNGMFPDESL--------NLY---------A 381
            +D    +   G  +  N   PED++ L +  +  D S+        N Y         A
Sbjct: 135 DQDGNIRIWDLGENQCTNQLTPEDNTPLQSLSVASDGSMLVAGNNKGNCYVWKMPHHTDA 194

Query: 382 PVFHPLPYRSFLGHNQDILDIDWSKN-NFVLTGSMDKTVKLWHCDRKQLLKNF--PHPDF 438
               P+    F  H + I  +  S +   + T S D T ++W+ +    L+     H  +
Sbjct: 195 STLEPVT--KFKSHTKYITRVLLSADVKHLATCSADHTARVWNIEDNFELETTLDGHQRW 252

Query: 439 VTCVKFHPNDDRFFISGCLDHKARLWSILDDEVSFEF 475
           V    F   D  + ++ C DH  RLW +   E+  ++
Sbjct: 253 VWDCAFSA-DSAYLVTACSDHYVRLWDLSTSEIVRQY 288

>Scas_624.11
          Length = 1205

 Score = 48.5 bits (114), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 36/59 (61%), Gaps = 2/59 (3%)

Query: 409 FVLTGSMDKTVKLWHC-DRKQLLKNFPHPDFVTCVKFHPNDDRFFISGCLDHKARLWSI 466
           ++++ S D+T+++W+  +RK++     H  FV C +FHP DD   +S  LD   R+W I
Sbjct: 109 WIISASDDQTIRIWNWQNRKEIACLTGHNHFVMCAQFHPTDD-LVVSASLDETIRVWDI 166

 Score = 33.5 bits (75), Expect = 0.98,   Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 31/61 (50%), Gaps = 4/61 (6%)

Query: 409 FVLTGSMDKTVKLWHCDRKQLLKN---FPHPDFVTCVKFHPNDDRFFISGCLDHKARLWS 465
            +++GS D+ VKLW  +  +  +      H + V CV FHP   +F +S   D   R+W 
Sbjct: 223 MIVSGSDDRQVKLWKYNSTKAWEVDTCRGHTNNVDCVIFHPT-QKFILSVGEDKTLRIWD 281

Query: 466 I 466
           +
Sbjct: 282 L 282

>KLLA0D02530g complement(212703..214826) gi|5679595|emb|CAB51777.1
           Kluyveromyces lactis CRN1 homologue, start by similarity
          Length = 707

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 31/115 (26%), Positives = 46/115 (40%), Gaps = 19/115 (16%)

Query: 392 FLGHNQDILDIDWSKNN--FVLTGSMDKTVKLWHCDRKQLLKNF---------------- 433
           F GH   +LD D+S  N   V +GS D  + +W       L  +                
Sbjct: 89  FRGHTAQVLDTDFSPFNDHIVASGSDDGKIGIWEIPEDYGLHEYVDEEGNPKDLKPVRML 148

Query: 434 -PHPDFVTCVKFHPNDDRFFISGCLDHKARLWSILDDEVSFEFDCGDLITSLEVS 487
             H   V  + FHP  +    S  LD+  ++W I  +EV F     D++TS+  S
Sbjct: 149 SGHSRKVGHLLFHPLAENILASSSLDYTVKIWDISQEEVKFTLKHPDMVTSMSFS 203

>Kwal_23.5351
          Length = 474

 Score = 47.4 bits (111), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 45/142 (31%), Positives = 64/142 (45%), Gaps = 26/142 (18%)

Query: 336 LNGKLISYSRDVPQSGFARTENGDNPEDDSLDTNGMFPDESLNLYAPVFHPLPY---RSF 392
           L+G  + +SR  P S  AR+     P+  SL         S N    + HP      RS 
Sbjct: 174 LHGSQVVFSR--PVSQVARS-----PDGASLAAG------SWNGDVKILHPQSLEVVRSL 220

Query: 393 LG-HNQDILDIDWSKNNFVL-TGSMDKTVKLW------HCDRKQLLKNFPHPDFVTCVKF 444
            G H+  I  + WS ++ +L TG  D  VK+W      H +  +++    H   V+ VKF
Sbjct: 221 DGAHDDKIGGVAWSSDSQLLATGGADNLVKIWNPQAQSHSEASRVVLR-GHEARVSKVKF 279

Query: 445 HPNDDRFFISGCLDHKARLWSI 466
           HP+D RF  S   D   RLW +
Sbjct: 280 HPSD-RFVASASFDMTWRLWDV 300

 Score = 47.0 bits (110), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 47/189 (24%), Positives = 77/189 (40%), Gaps = 19/189 (10%)

Query: 289 MKFSKDGRFLATGGKDRILRIWKVIA---SPTERLELDSSTMKPSKTVCMLNGKLISYSR 345
           + +S D + LATGG D +++IW   A   S   R+ L     + SK     + + ++ + 
Sbjct: 231 VAWSSDSQLLATGGADNLVKIWNPQAQSHSEASRVVLRGHEARVSKVKFHPSDRFVASAS 290

Query: 346 --------DVPQSGFARTENGDNPEDDSLD---TNGMFPDESLNLYAPVFHPLPYRSFL- 393
                   DV +    + + G   E   LD      +     L+    V+     RS + 
Sbjct: 291 FDMTWRLWDVERETELQLQEGHAKEVYCLDFQCDGSLLCSAGLDSVGHVWDMRTGRSLMV 350

Query: 394 --GHNQDILDIDWSKN-NFVLTGSMDKTVKLWHCDRKQLLKN-FPHPDFVTCVKFHPNDD 449
             GH + I  + WS N + V TGS D TV++W   +     +   H   V+ V F   + 
Sbjct: 351 LEGHAKPIYGVSWSPNGHHVATGSGDGTVQVWDIRKANKPSSILAHNSIVSEVNFEKENG 410

Query: 450 RFFISGCLD 458
            F +S   D
Sbjct: 411 NFLVSSSYD 419

 Score = 30.4 bits (67), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 34/136 (25%), Positives = 57/136 (41%), Gaps = 31/136 (22%)

Query: 289 MKFSKDGRFLATGGKDRILRIWKVIASPTERLELDSSTMKPSKTVCMLNGKLISYSRDVP 348
           + +S +G  +ATG  D  +++W +               KPS         +++++  V 
Sbjct: 361 VSWSPNGHHVATGSGDGTVQVWDI-----------RKANKPS--------SILAHNSIVS 401

Query: 349 QSGFARTENGDNPEDDSLD-TNGMFPDESLNLYAPVFHPLPYRSFLGHNQDILDIDWSKN 407
           +  F + ENG+     S D T G+F   S          +   S  GH   IL +D S+ 
Sbjct: 402 EVNFEK-ENGNFLVSSSYDRTIGVFATGSW---------IKLASLQGHTDKILSVDISRG 451

Query: 408 NFVLTGS-MDKTVKLW 422
              L  S  D++VK+W
Sbjct: 452 GANLWSSGWDRSVKIW 467

>KLLA0E04741g 428278..429657 similar to sp|P20053 Saccharomyces
           cerevisiae YPR178w PRP4 U4/U6 snRNP 52 KD protein, start
           by similarity
          Length = 459

 Score = 46.6 bits (109), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 41/75 (54%), Gaps = 2/75 (2%)

Query: 391 SFLGHNQDILDIDWSKNNFVL-TGSMDKTVKLWHCDRKQLLKN-FPHPDFVTCVKFHPND 448
           S  GH++ I  +DWS+N + L +GS D T+K+W   +K  ++    H   V+ VKF+  +
Sbjct: 342 SLQGHSKPIYSVDWSQNGYQLASGSGDGTIKVWDIRKKGNVETILAHNSIVSQVKFNKQN 401

Query: 449 DRFFISGCLDHKARL 463
             + +S   D K  +
Sbjct: 402 GGYLVSSGYDKKVNI 416

>ADR077C [1818] [Homologous to ScYDL145C (COP1) - SH]
           (843171..846785) [3615 bp, 1204 aa]
          Length = 1204

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 36/59 (61%), Gaps = 2/59 (3%)

Query: 409 FVLTGSMDKTVKLWHC-DRKQLLKNFPHPDFVTCVKFHPNDDRFFISGCLDHKARLWSI 466
           ++++ S D+T+++W+  +R+++     H  FV C +FHP +D   +S  LD   R+W I
Sbjct: 109 WIISASDDQTIRIWNWQNRREIACLTGHNHFVMCAQFHPTED-LVVSASLDETVRIWDI 166

>Kwal_56.24526
          Length = 1210

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 35/59 (59%), Gaps = 2/59 (3%)

Query: 409 FVLTGSMDKTVKLWHC-DRKQLLKNFPHPDFVTCVKFHPNDDRFFISGCLDHKARLWSI 466
           ++++ S D+T+++W+  +RK++     H  FV C  FHP +D   +S  LD   R+W I
Sbjct: 109 WIISASDDQTIRIWNWQNRKEIACLTGHNHFVMCADFHPTED-LVVSASLDETVRVWDI 166

 Score = 32.3 bits (72), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 28/57 (49%), Gaps = 3/57 (5%)

Query: 409 FVLTGSMDKTVKLWHCDRKQLLKNF-PHPDFVTCVKFHPNDDRFFISGCLDHKARLW 464
           FV  G  D T+K+W  D K+ L     H D+V  V FH  +  + IS   D   R+W
Sbjct: 68  FVSAGD-DYTIKVWSLDTKKCLFTLNGHLDYVRTVFFH-RELPWIISASDDQTIRIW 122

 Score = 32.0 bits (71), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 15/46 (32%), Positives = 25/46 (54%), Gaps = 1/46 (2%)

Query: 407 NNFVLTGSMDKTVKLWHCDRKQLLKNFPHP-DFVTCVKFHPNDDRF 451
            N +++   DKTV++W  D++  +K F    D    V+ HPN + F
Sbjct: 265 QNLIISVGEDKTVRVWDLDKRTPVKQFKRENDRFWLVRAHPNINLF 310

>KLLA0F04884g complement(478044..481682) similar to sp|P53622
           Saccharomyces cerevisiae YDL145c RET1 coatomer complex
           alpha chain of secretory pathway vesicles, start by
           similarity
          Length = 1212

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 36/59 (61%), Gaps = 2/59 (3%)

Query: 409 FVLTGSMDKTVKLWHC-DRKQLLKNFPHPDFVTCVKFHPNDDRFFISGCLDHKARLWSI 466
           ++++ S D+T+++W+  +RK++     H  FV C +FHP +D   +S  LD   R+W I
Sbjct: 109 WIISSSDDQTIRIWNWQNRKEIACLTGHNHFVMCAQFHPVED-LVVSASLDETVRVWDI 166

 Score = 32.7 bits (73), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 15/47 (31%), Positives = 26/47 (55%), Gaps = 1/47 (2%)

Query: 406 KNNFVLTGSMDKTVKLWHCDRKQLLKNFPHP-DFVTCVKFHPNDDRF 451
           + N +++   DKTV++W  D++  +K F    D    V+ HPN + F
Sbjct: 264 QQNLIISVGEDKTVRVWDLDKRTPIKQFKRENDRFWLVRAHPNLNLF 310

>CAGL0I03718g complement(317565..321170) highly similar to sp|P53622
           Saccharomyces cerevisiae YDL145c RET1 Coatomer alpha
           subunit, start by similarity
          Length = 1201

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 35/59 (59%), Gaps = 2/59 (3%)

Query: 409 FVLTGSMDKTVKLWHC-DRKQLLKNFPHPDFVTCVKFHPNDDRFFISGCLDHKARLWSI 466
           +V++ S D+TV++W+  +RK+L     H  FV C +FH  +D   +S  LD   R+W I
Sbjct: 109 WVISASDDQTVRIWNWQNRKELACLTGHNHFVMCAQFHQTED-LVVSASLDETVRVWDI 166

 Score = 31.2 bits (69), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 14/46 (30%), Positives = 25/46 (54%), Gaps = 1/46 (2%)

Query: 407 NNFVLTGSMDKTVKLWHCDRKQLLKNFPHP-DFVTCVKFHPNDDRF 451
            N +L+ + DKT+++W  D++  +K F    D    ++ HPN   F
Sbjct: 265 QNLILSVAEDKTLRIWDLDKRTPVKQFKRENDRFWLIRSHPNMSLF 310

>Sklu_2442.2 YNL006W, Contig c2442 3831-4742
          Length = 303

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 57/263 (21%), Positives = 107/263 (40%), Gaps = 44/263 (16%)

Query: 386 PLPYRSFLGHNQDILDIDWSKNN-FVLTGSMDKTVKLWHCDRKQLLKNFPHPDFVTCVKF 444
           P P  SF GH  ++  I + ++N ++++ S D T+K+W      + +N+ H   V  V  
Sbjct: 65  PNPVTSFEGHRGNVTSISFQQDNKWMVSSSEDGTIKVWDVRAPSVQRNYKHHAPVNEVVI 124

Query: 445 HPNDDRFFISGCLDHKARLWSILDDEVSFEFDCGD--LITSLEVSPGDSKYTILGTFNGY 502
           HPN     IS   D   R+W + +++ + +    D   + SL ++  D    + G   G 
Sbjct: 125 HPNQGE-LISCDQDGNIRIWDLGENQCTHQLTPEDDTPLQSLSIA-SDGSMLVAGNNKG- 181

Query: 503 VIVLLTRGLEHVYSFHLSDKQDKKGKDVTTRDLPTSRTNTHHGPKVTGIECFRAVNDMTL 562
                     + Y + + +  D       T+     R++T +  +V        ++    
Sbjct: 182 ----------NCYVWQMPNHTDAANLKPVTK----FRSHTKYITRVL-------LSSDVK 220

Query: 563 KLLVTSNDSKIRVFNLKDNI-LQEVLKG-----FENESSQISAHLITGSKNKQQFVIAPS 616
            L   S D   RV++++DN  L+  L G     ++   S  SA+L+T             
Sbjct: 221 HLATCSADHTARVWSIEDNFKLETTLDGHQRWVWDCAFSADSAYLVTA-----------C 269

Query: 617 EDHWIYCWKLQSSLMTKDKDKEH 639
            DH++  W L +  + +     H
Sbjct: 270 SDHYVRLWDLSTREIVRQYGGHH 292

>CAGL0E02805g complement(265137..267659) similar to sp|P32479
           Saccharomyces cerevisiae YBL008w HIR1 histone
           transcription regulator, start by similarity
          Length = 840

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 49/195 (25%), Positives = 87/195 (44%), Gaps = 17/195 (8%)

Query: 292 SKDGRFLATGGKDRILRIWKV---IASPTERLELDSSTMKPSKTVCMLNGKLISYSRDVP 348
           S DG+ +ATGG D  +RIW V   +++      +D  T +P  ++    G  ++  +  P
Sbjct: 26  SPDGKRVATGGLDGKIRIWSVDALVSAAAGESGVDRDTHRPLASMSRHTGS-VTCVKFSP 84

Query: 349 QSGFARTENGDNP----EDDSLDTNGMFPDESLNLYAPVFHPLPYRSFLGHNQDILDIDW 404
              +  + + D        D  +  G F  E    +  V      +  + H+ DI DI W
Sbjct: 85  DGNYLASGSDDRILLIWAMDEENHGGSFGSEGEKEHWTV-----RKRLVAHDNDIQDICW 139

Query: 405 SKNNFVL-TGSMDKTVKLWHCDRKQLLKNF-PHPDFVTCVKFHPNDDRFFISGCLDHKAR 462
           + ++ +L T  +D++V +W+    + LK F  H   V  V F P  +++F +   D   R
Sbjct: 140 APDSSILVTVGLDRSVIVWNGLNFERLKRFDVHQSLVKGVIFDPA-NKYFATASDDRTMR 198

Query: 463 LWSI-LDDEVSFEFD 476
           ++      EVSF  +
Sbjct: 199 VFRYHKTGEVSFTIE 213

 Score = 35.0 bits (79), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 14/24 (58%), Positives = 18/24 (75%)

Query: 289 MKFSKDGRFLATGGKDRILRIWKV 312
           +KFS DG +LA+G  DRIL IW +
Sbjct: 80  VKFSPDGNYLASGSDDRILLIWAM 103

>KLLA0E12287g join(1086778..1087329,1087730..1088158) similar to
           sp|P38011 Saccharomyces cerevisiae YMR116c ASC1 40S
           small subunit ribosomal protein, start by similarity
          Length = 326

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 28/95 (29%), Positives = 46/95 (48%), Gaps = 10/95 (10%)

Query: 392 FLGHNQDILDIDWSKNNF-VLTGSMDKTVKLWHCDRKQLLKNFPHPDFVTCVKFHP---- 446
           F+GH  D+L +    N+  +++ S DKT+++W+           H D+VT V+  P    
Sbjct: 104 FVGHTGDVLSVAIDANSSKIISASRDKTIRVWNTVGDCAYVLLGHTDWVTKVRVAPKNLE 163

Query: 447 ----NDDRF-FISGCLDHKARLWSILDDEVSFEFD 476
               +D R  F+S  +D   R WS+ +D    E D
Sbjct: 164 DGEVDDGRITFVSAGMDKIVRSWSLNEDSYRIEAD 198

 Score = 42.7 bits (99), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 29/104 (27%), Positives = 48/104 (46%), Gaps = 3/104 (2%)

Query: 387 LPYRSFLGHNQDILDIDWSKN-NFVLTGSMDKTVKLWHCDRKQLLKNF-PHPDFVTCVKF 444
           +P RS+ GH+  + D+  S + N+ ++ S DKT++LW+         F  H   V  V  
Sbjct: 57  VPVRSYKGHSHIVQDVVVSADGNYAVSASWDKTLRLWNLATGNSEARFVGHTGDVLSVAI 116

Query: 445 HPNDDRFFISGCLDHKARLWSILDDEVSFEFDCGDLITSLEVSP 488
             N  +  IS   D   R+W+ + D         D +T + V+P
Sbjct: 117 DANSSK-IISASRDKTIRVWNTVGDCAYVLLGHTDWVTKVRVAP 159

 Score = 32.0 bits (71), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 46/213 (21%), Positives = 84/213 (39%), Gaps = 31/213 (14%)

Query: 292 SKDGRFLATGGKDRILRIWKVIASPTERLELDSSTMKPSKTVCMLNGKLISYSRD----- 346
           S DG +  +   D+ LR+W +    +E   +  +    S  +   + K+IS SRD     
Sbjct: 75  SADGNYAVSASWDKTLRLWNLATGNSEARFVGHTGDVLSVAIDANSSKIISASRDKTIRV 134

Query: 347 ---VPQSGFARTENGD----------NPEDDSLDTNGM-FPDESLN--LYAPVFHPLPYR 390
              V    +    + D          N ED  +D   + F    ++  + +   +   YR
Sbjct: 135 WNTVGDCAYVLLGHTDWVTKVRVAPKNLEDGEVDDGRITFVSAGMDKIVRSWSLNEDSYR 194

Query: 391 ---SFLGHNQDILDIDWSKN-NFVLTGSMDKTVKLWHCDRKQLLKNFPHPDFVTCVKFHP 446
               F+GHN  I  +  S + +   +   D  + +W+   K    NF   D V  + F P
Sbjct: 195 IEADFIGHNNYINVVQPSPDGSLAASAGKDGQIYVWNLKHKSAFMNFDAKDEVFALAFSP 254

Query: 447 NDDRFFISGCLDHKARLW----SILDDEVSFEF 475
           +  RF+++       +++     +L DE+  EF
Sbjct: 255 S--RFWLTAATASGIKIYDLENEVLIDELKPEF 285

>CAGL0K12188g 1191188..1192795 similar to sp|P38262 Saccharomyces
           cerevisiae YBR103w SIF2 SIR4P interacting protein, start
           by similarity
          Length = 535

 Score = 44.3 bits (103), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 24/36 (66%)

Query: 392 FLGHNQDILDIDWSKNNFVLTGSMDKTVKLWHCDRK 427
           F GH Q I+ + W  N+ +++ SMD +VKLW C +K
Sbjct: 397 FYGHTQTIVSLKWVNNDMLISASMDGSVKLWDCGKK 432

>Scas_571.4
          Length = 601

 Score = 44.3 bits (103), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 44/182 (24%), Positives = 75/182 (41%), Gaps = 25/182 (13%)

Query: 408 NFVLTGSMDKTVKLWHCDRKQLLKNFPHPDFVTCVKFHPNDDRFFISGCLDHKARLWSIL 467
           N + + S+D TVK+W+  + +++    H D VT + F P D  +  +   + K  +W I 
Sbjct: 162 NVLASSSLDFTVKIWNIKKGKVIGTLQHSDMVTAMAFDP-DGAYLATITRNKKLTIWDIA 220

Query: 468 DDEVSFEFDCGDLITSLEVSPGDSKYTILGTFNGYVIVLLTRGLEHVYSFHLSDKQDKKG 527
             ++  +       T     P + +   L    GY  ++ T G         S   D++ 
Sbjct: 221 SKQIVSQ-------TKSHQGPKNQRVVWL----GYSRIIATTG--------FSKSMDREI 261

Query: 528 KDVTTRDLPTSRTNTHHG-PKVTGIECFRAVNDMTLKLL--VTSNDSKIRVFNLKDNILQ 584
                 DL     N  +   + +GI       D+T ++L  V   D  IR F LKD  LQ
Sbjct: 262 GIWDALDLKEGTINKFYKIDQSSGI--LMPFYDLTNRILYVVGKGDGNIRCFELKDRKLQ 319

Query: 585 EV 586
           ++
Sbjct: 320 QL 321

 Score = 37.0 bits (84), Expect = 0.075,   Method: Compositional matrix adjust.
 Identities = 37/175 (21%), Positives = 64/175 (36%), Gaps = 43/175 (24%)

Query: 392 FLGHNQDILDIDWSK-NNF-VLTGSMDKTVKLWHCDRKQLLKNF---------------- 433
           F GH   +LD D+   N+F + + S D  + +W+      ++ +                
Sbjct: 85  FRGHKGQVLDTDFDPFNDFKIASASDDGKIGIWNIPMNYSMRTYRDSENKPMDIRPSKIL 144

Query: 434 -PHPDFVTCVKFHPNDDRFFISGCLDHKARLWSILDDEVSFEFDCGDLITSLEVSPGDSK 492
             H   V  V FHP       S  LD   ++W+I   +V       D++T++   P D  
Sbjct: 145 SGHTRKVGHVLFHPRIRNVLASSSLDFTVKIWNIKKGKVIGTLQHSDMVTAMAFDP-DGA 203

Query: 493 YTILGTFNGYVIVLLTRGLEHVYSFHLSDKQDKKGKDVTTRDLPTSRTNTHHGPK 547
           Y    T N  + +                       D+ ++ +  S+T +H GPK
Sbjct: 204 YLATITRNKKLTIW----------------------DIASKQI-VSQTKSHQGPK 235

>CAGL0D02090g join(214357..214893,215564..215860) highly similar to
           sp|P38011 Saccharomyces cerevisiae YMR116c ASC1
          Length = 277

 Score = 43.5 bits (101), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 38/139 (27%), Positives = 67/139 (48%), Gaps = 14/139 (10%)

Query: 362 EDDSLDTNGMFP-----DESLNLYAPVFHPLPYRSFLGHNQDILD--IDWSKNNFVLTGS 414
           +D +L  NG +      D++L L+  V     +++F+GH  D++   ID  K + +++GS
Sbjct: 69  QDCTLTENGAYALSGSWDKTLRLW-DVATGETFQTFVGHKGDVMSVAID-KKASMIISGS 126

Query: 415 MDKTVKLWHCDRKQLLKNFPHPDFVTCVKF---HPNDDRF-FISGCLDHKAR-LWSILDD 469
            DK++K+W      L     H D+V+ V+      +DD+   IS   D   + LW+    
Sbjct: 127 RDKSIKVWSIKGDCLATLIGHNDWVSQVRIANSSDDDDKVTVISAGNDKMVKVLWNSAAK 186

Query: 470 EVSFEFDCGDLITSLEVSP 488
              +    GD + +L  SP
Sbjct: 187 VPMYTLSAGDEVYALSFSP 205

>AFR199C [3391] [Homologous to ScYMR116C (ASC1) - SH]
           (799876..800298,800493..801074) [1005 bp, 334 aa]
          Length = 334

 Score = 43.9 bits (102), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 27/108 (25%), Positives = 52/108 (48%), Gaps = 3/108 (2%)

Query: 385 HPLPYRSFLGHNQDILDIDWSKNN-FVLTGSMDKTVKLWHCDRKQLLKNF-PHPDFVTCV 442
           + +P RSF GH+  + D   + +  + L+ S DKT++LW     + +K F  H   V  V
Sbjct: 70  YGVPVRSFKGHSHIVQDCTVTHDGKYALSASWDKTLRLWDLQSGKCIKRFVGHKSDVMSV 129

Query: 443 KFHPNDDRFFISGCLDHKARLWSILDDEVSFEFDCGDLITSLEVSPGD 490
              P   +  +S   D   ++W+ + D V       D ++++ ++P +
Sbjct: 130 SIDPRATQ-IVSASRDKTVKVWNTVGDCVVTLLGHNDWVSNVRIAPSE 176

 Score = 39.3 bits (90), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 29/122 (23%), Positives = 60/122 (49%), Gaps = 7/122 (5%)

Query: 390 RSFLGHNQDILDIDWS-KNNFVLTGSMDKTVKLWHCDRKQLLKNFPHPDFVTCVKFHP-- 446
           + F+GH  D++ +    +   +++ S DKTVK+W+     ++    H D+V+ V+  P  
Sbjct: 117 KRFVGHKSDVMSVSIDPRATQIVSASRDKTVKVWNTVGDCVVTLLGHNDWVSNVRIAPSE 176

Query: 447 --NDDRFFISGCLDHKARLWSILDDEVSFEF-DCGDLITSLEVSPGDSKYTILGTFNGYV 503
             +D    IS  +D   ++W +    +  +F    + +T++  SP  S +   G  +G +
Sbjct: 177 KSDDAVTVISAGMDKVVKVWDLQSFTIEADFIGHNNYVTTVTPSPDGSIFASAGK-DGQI 235

Query: 504 IV 505
           I+
Sbjct: 236 IL 237

 Score = 37.4 bits (85), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 30/111 (27%), Positives = 46/111 (41%), Gaps = 20/111 (18%)

Query: 391 SFLGHNQDILDIDWSKNN------------FVLTGSMDKTVKLWHCDRKQLLKNF-PHPD 437
           + LGHN      DW  N              V++  MDK VK+W      +  +F  H +
Sbjct: 159 TLLGHN------DWVSNVRIAPSEKSDDAVTVISAGMDKVVKVWDLQSFTIEADFIGHNN 212

Query: 438 FVTCVKFHPNDDRFFISGCLDHKARLWSILDDEVSFEFDCGDLITSLEVSP 488
           +VT V   P D   F S   D +  LW++ +    +  D  D + ++  SP
Sbjct: 213 YVTTVTPSP-DGSIFASAGKDGQIILWNLNEKTALYTLDAKDEVFAVAFSP 262

>Scas_719.52
          Length = 628

 Score = 44.3 bits (103), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 24/89 (26%), Positives = 44/89 (49%), Gaps = 3/89 (3%)

Query: 388 PYRSFLGHNQDILDIDWS--KNNFVLTGSMDKTVKLWHCDRKQLLKNFPHPDFVTCVKFH 445
           P +   GH++ +  + +     N + + S+D TVKLW+ +  + +    HPD VT + F 
Sbjct: 132 PVKFLSGHSRKVGHVLFHPVAENVLASSSLDYTVKLWNIETGEAVITLKHPDMVTSMSFS 191

Query: 446 PNDDRFFISGCLDHKARLWSILDDEVSFE 474
              +    + C D K R+W I + ++  E
Sbjct: 192 YGGNH-LATVCRDKKLRVWDIREGKIVSE 219

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 29/117 (24%), Positives = 45/117 (38%), Gaps = 19/117 (16%)

Query: 392 FLGHNQDILDIDWSKNN--FVLTGSMDKTVKLWHCDRKQLLKNFPHPDF----------- 438
           F GH   +LD D+   N   + + S D  + +W        +++  PD            
Sbjct: 77  FRGHTAQVLDTDFDPFNDHIIASSSDDSKIGIWKIPEDYSFQHYLDPDGEPKNIKPVKFL 136

Query: 439 ------VTCVKFHPNDDRFFISGCLDHKARLWSILDDEVSFEFDCGDLITSLEVSPG 489
                 V  V FHP  +    S  LD+  +LW+I   E        D++TS+  S G
Sbjct: 137 SGHSRKVGHVLFHPVAENVLASSSLDYTVKLWNIETGEAVITLKHPDMVTSMSFSYG 193

>KLLA0A04928g 439349..441934 similar to sp|P32479 Saccharomyces
           cerevisiae YBL008w HIR1 histone transcription regulator,
           start by similarity
          Length = 861

 Score = 44.3 bits (103), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 40/165 (24%), Positives = 63/165 (38%), Gaps = 57/165 (34%)

Query: 289 MKFSKDGRFLATGGKDRILRIWKVIASPTERLELDSSTMKPSKTVCMLNGKLISYSRDVP 348
           +KFS DG++LA+G  DRIL IW          EL+  T +P                   
Sbjct: 82  VKFSPDGKYLASGSDDRILLIW----------ELEGGTTQP------------------- 112

Query: 349 QSGFARTENGDNPEDDSLDTNGMFPDESLNLYAPVFHPLPYRSFLGHNQDILDIDWSKNN 408
                                 MF  ES ++     H    R  + H+ DI DI W+ ++
Sbjct: 113 ----------------------MFGAESTDIE----HWNVRRRLVAHDNDIQDICWAPDS 146

Query: 409 FVLTG-SMDKTVKLWHCDRKQLLKNF-PHPDFVTCVKFHPNDDRF 451
            ++    +D+ + +W+    + +K F  H   V  V F P +  F
Sbjct: 147 SIMVSVGLDRAIIIWNGSTFEKVKRFDVHQSHVKGVVFDPANKYF 191

>YLR429W (CRN1) [3804] chr12 (990773..992728) Coronin, actin-binding
           protein, inhibits ARP2/3-stimulated actin nucleation,
           contains WD (WD-40) repeats [1956 bp, 651 aa]
          Length = 651

 Score = 43.9 bits (102), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 24/89 (26%), Positives = 44/89 (49%), Gaps = 3/89 (3%)

Query: 388 PYRSFLGHNQDILDIDWS--KNNFVLTGSMDKTVKLWHCDRKQLLKNFPHPDFVTCVKFH 445
           P +   GH + +  + +     N + + S D TVKLW+ +  + +    HPD VT + F 
Sbjct: 132 PVKFLTGHARKVGHVLYHPVAENVLASSSGDYTVKLWNVETGKDMITLKHPDMVTSMSFS 191

Query: 446 PNDDRFFISGCLDHKARLWSILDDEVSFE 474
             D  +  +   D K R+W+I ++++  E
Sbjct: 192 -YDGNYLATVARDKKLRVWNIREEKIVSE 219

 Score = 33.5 bits (75), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 12/24 (50%), Positives = 17/24 (70%)

Query: 289 MKFSKDGRFLATGGKDRILRIWKV 312
           M FS DG +LAT  +D+ LR+W +
Sbjct: 188 MSFSYDGNYLATVARDKKLRVWNI 211

 Score = 32.3 bits (72), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 26/115 (22%), Positives = 44/115 (38%), Gaps = 19/115 (16%)

Query: 392 FLGHNQDILDIDWSKNN--FVLTGSMDKTVKLW----------HCDRKQLLKNFPHPDFV 439
           F GH   +LD D+   N   + +GS D  + +W          H D      +     F+
Sbjct: 77  FRGHTAQVLDTDFDPFNDHRIASGSDDSKIGIWDIPENYKFHDHVDEDGEPIDIKPVKFL 136

Query: 440 TC-------VKFHPNDDRFFISGCLDHKARLWSILDDEVSFEFDCGDLITSLEVS 487
           T        V +HP  +    S   D+  +LW++   +        D++TS+  S
Sbjct: 137 TGHARKVGHVLYHPVAENVLASSSGDYTVKLWNVETGKDMITLKHPDMVTSMSFS 191

>KLLA0D07546g complement(647984..649927) some similarities with
           sp|P07834 Saccharomyces cerevisiae YFL009w CDC4 cell
           division control protein, hypothetical start
          Length = 647

 Score = 43.9 bits (102), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 42/147 (28%), Positives = 69/147 (46%), Gaps = 16/147 (10%)

Query: 360 NPED----DSLDTNGMFPDESLNLYAPVFHPLPYRSFL-GHNQDILDIDWSKNNFVLTGS 414
           NP+D    D L+ N        N Y P + P   R+ L GH+ +++     +NN+++TG+
Sbjct: 224 NPDDRFRLDFLENNWCLQ----NWYDPNYKP--GRTCLDGHSTNVVTCLQFENNYIITGA 277

Query: 415 MDKTVKLWHCDRKQLLKNF-PHPDFVTCVKFHPNDDRFFISGCLDHKARLWSILDDEVSF 473
            DK + ++  +    L     H   V  +KF   D +  +SG  D   R+W+I   + + 
Sbjct: 278 DDKKINVYDAENDLFLLELNGHEGGVWALKF--VDGKILVSGSTDRSVRIWNIETGKCTH 335

Query: 474 EFDC-GDLITSLEVSP-GDSKYTILGT 498
            F      +  LEV   GDSKY + G+
Sbjct: 336 VFKGHTSTVRCLEVVEYGDSKYIVTGS 362

>CAGL0M04279g 469040..471862 highly similar to sp|Q12220
           Saccharomyces cerevisiae YLR129w DIP2 DOM34P-interacting
           protein, start by similarity
          Length = 940

 Score = 44.3 bits (103), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 47/182 (25%), Positives = 74/182 (40%), Gaps = 24/182 (13%)

Query: 289 MKFSKDGRFLATGGKDRILRIWKVIASPTERLELDSSTMKPSK----TVCMLNGKLISYS 344
           +  + DGR L TG  D+ +R W    S     +  + TM   +    T   L+  ++S  
Sbjct: 476 LDLTSDGRKLVTGSADKTVRFWTFEVSEVPVSDESNKTMPMLQLFHDTTLELDDDILSVV 535

Query: 345 RDVPQSGFARTENGDNPEDDSLDTNGMFPDESLNLYAPVFHPLPYRSFLGHNQDILDIDW 404
              P   F      DN       T  +F  +S+  +  ++         GH   +L +D 
Sbjct: 536 IS-PDDKFIAVSLLDN-------TVKVFFLDSMKFFLSLY---------GHKLPVLSMDI 578

Query: 405 SKNN-FVLTGSMDKTVKLWHCDRKQLLKN-FPHPDFVTCVKFHPNDDRFFISGCLDHKAR 462
           S ++  ++T S DK +K+W  D     K+ F H D +  VKF P    FF S   D   +
Sbjct: 579 SYDSKLIVTCSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESYNFF-SCSKDATVK 637

Query: 463 LW 464
            W
Sbjct: 638 YW 639

>Kwal_0.212
          Length = 303

 Score = 43.1 bits (100), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 56/259 (21%), Positives = 103/259 (39%), Gaps = 36/259 (13%)

Query: 386 PLPYRSFLGHNQDILDIDWSKNN-FVLTGSMDKTVKLWHCDRKQLLKNFPHPDFVTCVKF 444
           P P  SF GH  ++  I + + N ++++ S D T+K+W      + +N+ H   V  V  
Sbjct: 65  PNPVTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVRAPSVQRNYKHQAAVNEVVI 124

Query: 445 HPNDDRFFISGCLDHKARLWSILDDEVSFEFDCGD--LITSLEVSPGDSKYTILGTFNGY 502
           HPN     IS   D   R+W + +++   +    D   + SL V+  D    + G     
Sbjct: 125 HPNQGE-LISCDQDGNVRIWDLGENQCVHQLAPEDDTPLQSLSVA-SDGSMLVAGN---- 178

Query: 503 VIVLLTRGLEHVYSF-HLSDKQDKKGKDVTTRDLPTSRTNTHHGPKVTGIECFRAVNDMT 561
                 +G  +V+   H +D  + K         P ++  + H   +T     R +    
Sbjct: 179 -----NKGNCYVWQMPHQTDAANPK---------PVTKFRS-HAKYIT-----RVLLSSD 218

Query: 562 LKLLVT-SNDSKIRVFNLKDNILQEVLKGFENESSQISAHLITGSKNKQQFVIAPSEDHW 620
           +K L T S D   RV+++ DN   E     +N    +     +       +++    DH+
Sbjct: 219 VKHLATCSADHTARVWSIDDNFQLETT--LDNHQRWVWDCAFSADS---AYLVTACSDHY 273

Query: 621 IYCWKLQSSLMTKDKDKEH 639
           +  W L +  + +     H
Sbjct: 274 VRLWDLSTREIVRQYGGHH 292

>YLR129W (DIP2) [3539] chr12 (399658..402489) Component of U3 snoRNP
           (renamed small subunit processome - SSU processome),
           which is required for 18S rRNA biogenesis [2832 bp, 943
           aa]
          Length = 943

 Score = 43.5 bits (101), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 57/230 (24%), Positives = 89/230 (38%), Gaps = 49/230 (21%)

Query: 289 MKFSKDGRFLATGGKDRILRIW--KVIAS----------PTERLELDSSTMKPSKTVCML 336
           +  + DG+ L TG  D+ ++ W  KV  S          P  +L  D++       +C+ 
Sbjct: 479 LDLTSDGKRLVTGSADKTVKFWDFKVENSLVPGTKNKFLPVLKLHHDTTLELTDDILCV- 537

Query: 337 NGKLISYSRDVPQSGFARTENGDNPEDDSLDTNGMFPDESLNLYAPVFHPLPYRSFLGHN 396
                   R  P   +      DN       T  +F  +S+  Y  ++         GH 
Sbjct: 538 --------RVSPDDRYLAISLLDN-------TVKVFFLDSMKFYLSLY---------GHK 573

Query: 397 QDILDIDWS-KNNFVLTGSMDKTVKLWHCDRKQLLKN-FPHPDFVTCVKFHPNDDRFFIS 454
             +L ID S  +  ++T S DK +K+W  D     K+ F H D +  VKF P    FF S
Sbjct: 574 LPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPQSHNFF-S 632

Query: 455 GCLDHKARLWSILDDEVSFEFDCGDLITSLEVSPGDSKYTILGTFNGYVI 504
              D   + W   D E   +F+C   I  L     +     + T  G+V+
Sbjct: 633 CSKDAVVKYW---DGE---KFEC---IQKLYAHQSEVWALAVATDGGFVV 673

>ADR090W [1831] [Homologous to ScYDL195W (SEC31) - SH]
           complement(868744..872445) [3702 bp, 1233 aa]
          Length = 1233

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 27/91 (29%), Positives = 46/91 (50%), Gaps = 10/91 (10%)

Query: 394 GHNQDILDIDWSKNN--FVLTGSMDKTVKLWHCDRKQLLKNFP-HPDFVTCVKFHPNDDR 450
           GH++ IL +DW K++   +L+   D T  LW+ +  Q L  +P   ++    KF P    
Sbjct: 248 GHSKGILSLDWCKHDEKLMLSSGRDNTCILWNPEEAQKLTQYPTRGNWCFKTKFAPEAPD 307

Query: 451 FFISGCLDHKARLWSI------LD-DEVSFE 474
            F S   D+K ++ ++      LD DE +F+
Sbjct: 308 LFASASFDNKIQVQTLQNLANKLDLDETAFK 338

 Score = 33.1 bits (74), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 16/66 (24%), Positives = 33/66 (50%), Gaps = 2/66 (3%)

Query: 401 DIDWSKNNFVLTGSMDKTVKLWHC--DRKQLLKNFPHPDFVTCVKFHPNDDRFFISGCLD 458
           D+DWS++  +L G+++  V  + C  +R+ + +   H   V  V+F+       +SG   
Sbjct: 66  DLDWSRDGAMLAGALENGVVEFFCARERRSVARVARHTTGVRAVRFNAKQANVAVSGGSQ 125

Query: 459 HKARLW 464
            +  +W
Sbjct: 126 GEIFVW 131

>KLLA0F05159g 506007..509702 similar to sp|P38968 Saccharomyces
           cerevisiae YDL195w SEC31 component of the COPII coat of
           ER-golgi vesicles, start by similarity
          Length = 1231

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/70 (32%), Positives = 33/70 (47%), Gaps = 3/70 (4%)

Query: 394 GHNQDILDIDWSKN--NFVLTGSMDKTVKLWHCDRKQLLKNF-PHPDFVTCVKFHPNDDR 450
           GH++ +L +DW K   N +L+   D T  LW+     +L  F P  ++V   KF P    
Sbjct: 249 GHSKGVLSLDWCKQDENLLLSSGRDNTSVLWNPQEGSILTQFAPRGNWVFKSKFAPEAPD 308

Query: 451 FFISGCLDHK 460
            F S   D K
Sbjct: 309 LFASASFDSK 318

>CAGL0H03729g 342948..343859 highly similar to sp|P41318
           Saccharomyces cerevisiae YNL006w LST8, start by
           similarity
          Length = 303

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 54/259 (20%), Positives = 103/259 (39%), Gaps = 40/259 (15%)

Query: 388 PYRSFLGHNQDILDIDWSKNN-FVLTGSMDKTVKLWHCDRKQLLKNFPHPDFVTCVKFHP 446
           P  SF GH  ++  + + ++N +++T S D T+K+W      + +N+ H   V  V  HP
Sbjct: 67  PVASFEGHRGNVTSVSFQQDNKWMVTSSEDGTIKVWDIRSPSVPRNYKHNAPVNEVVIHP 126

Query: 447 NDDRFFISGCLDHKARLWSILDDEVSFEFDCGDLITSLEVSPGDSKYTILGTFNGYVIVL 506
           N     IS   D   R+W + +++ + +    D +    +S       ++   N      
Sbjct: 127 NQGE-LISCDRDGNIRIWDLGENQCTHQLTPEDDVPLQSLSVASDGSMLVAANN------ 179

Query: 507 LTRGLEHVYSFHLSDKQDKKGKDVTTRDLPTSRTNTHHGPKVTGIECFRAVNDMTLKLLV 566
             +G  + Y + + +  D         +L  +     H   +T +     V  M      
Sbjct: 180 --KG--NCYVWEMPNHTDAS-------NLKPATKFKAHPSYITRVLLSSDVKHMA----T 224

Query: 567 TSNDSKIRVFNLKDNI-LQEVLKG-----FENESSQISAHLITGSKNKQQFVIAPSEDHW 620
            S D   R+++++DN  L+  L G     ++   S  SA+L+T S            DH+
Sbjct: 225 CSADHTARIWSVEDNFNLESTLDGHQRWVWDCAFSADSAYLVTASS-----------DHY 273

Query: 621 IYCWKLQSSLMTKDKDKEH 639
           +  W L +  + +     H
Sbjct: 274 VRLWDLSTRDIIRQYGGHH 292

>AAL009C [178] [Homologous to ScYNL006W (LST8) - SH]
           (325785..326696) [912 bp, 303 aa]
          Length = 303

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 58/264 (21%), Positives = 109/264 (41%), Gaps = 46/264 (17%)

Query: 386 PLPYRSFLGHNQDILDIDWSKNN-FVLTGSMDKTVKLWHCDRKQLLKNFPHPDFVTCVKF 444
           P P  SF GH  ++  I + ++N ++++ S D T+K+W      + +N+ H   V  V  
Sbjct: 65  PNPVTSFEGHRGNVTSIAFQQDNKWMVSSSEDGTIKVWDVRSPSVQRNYKHDAPVNEVVI 124

Query: 445 HPNDDRFFISGCLDHKARLWSILDDEVSFEFDCGD--LITSLEVSPGDSKYTILGTFNGY 502
           HPN     IS   D   ++W + +++ + +    D   + SL ++  D    + G   G 
Sbjct: 125 HPNQGE-LISCDQDGNIKIWDLGENQCTNQLALEDNTALQSLSIA-SDGSMLVAGNNKG- 181

Query: 503 VIVLLTRGLEHVYSFHLSDKQDKKGKDVTTRDLPTSRTNTHHGPKVTGIECFRAVNDMTL 562
                     + Y + + +  D      T    P ++  + H   +T     R +  + +
Sbjct: 182 ----------NCYVWKMPNHTD------TASLKPVTKFRS-HSKYIT-----RVLLSVDV 219

Query: 563 KLLVT-SNDSKIRVFNLKDNI-LQEVLKG-----FENESSQISAHLITGSKNKQQFVIAP 615
           K L T S D   RV++++DN  L+  L       ++   S  SA+L+T            
Sbjct: 220 KHLATCSADHTARVWSVEDNFQLETTLDAHSRWVWDCAFSADSAYLVTA----------- 268

Query: 616 SEDHWIYCWKLQSSLMTKDKDKEH 639
             DH++  W L +  + +     H
Sbjct: 269 CSDHYVRLWDLSTREIVRQYGGHH 292

>CAGL0A02772g complement(289274..290599) similar to sp|P40968
           Saccharomyces cerevisiae YDR364c CDC40, hypothetical
           start
          Length = 441

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 34/121 (28%), Positives = 52/121 (42%), Gaps = 8/121 (6%)

Query: 407 NNFVLTGSMDKTVKLW--HCDRKQLLKNFPHPDFVTCVKFHPNDDRFFISGCLDHKARLW 464
            + +L+G  D TVKLW  + DRK L     H   +  + F  +D   F+SG  D + ++W
Sbjct: 161 GHLILSGGNDNTVKLWDFYHDRKCLRDFVGHSKPIKTLDF-TSDSSQFLSGSYDQQVKIW 219

Query: 465 SILDDEVSFEFDCGDLITSLEVSPGDSKYTILGTFNGYVIVLLTR-----GLEHVYSFHL 519
                +V+   +      S E  P      ++G  +  +    TR     GL  VY  HL
Sbjct: 220 DTETGKVTKRLNTYSTPNSAEFRPTSGNEFVVGLSSSKIKHYDTRVSEKDGLVQVYDHHL 279

Query: 520 S 520
           S
Sbjct: 280 S 280

 Score = 32.7 bits (73), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 20/74 (27%), Positives = 36/74 (48%), Gaps = 1/74 (1%)

Query: 390 RSFLGHNQDILDIDW-SKNNFVLTGSMDKTVKLWHCDRKQLLKNFPHPDFVTCVKFHPND 448
           R F+GH++ I  +D+ S ++  L+GS D+ VK+W  +  ++ K           +F P  
Sbjct: 186 RDFVGHSKPIKTLDFTSDSSQFLSGSYDQQVKIWDTETGKVTKRLNTYSTPNSAEFRPTS 245

Query: 449 DRFFISGCLDHKAR 462
              F+ G    K +
Sbjct: 246 GNEFVVGLSSSKIK 259

>KLLA0D16390g 1378884..1381694 similar to sp|Q12220 Saccharomyces
           cerevisiae YLR129w DIP2 DOM34P-interacting protein,
           start by similarity
          Length = 936

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 24/69 (34%), Positives = 36/69 (52%), Gaps = 2/69 (2%)

Query: 389 YRSFLGHNQDILDIDWSKNN-FVLTGSMDKTVKLWHCDRKQLLKN-FPHPDFVTCVKFHP 446
           Y S  GH   +L ID+S ++  ++T S DK +K+W  D     K+ F H D +  V+F  
Sbjct: 557 YLSLYGHKLPVLSIDFSVDSKMLITSSADKNIKIWGVDFGDCHKSIFAHQDSIMSVRFEA 616

Query: 447 NDDRFFISG 455
           +   FF  G
Sbjct: 617 DTHNFFSCG 625

>YBL008W (HIR1) [186] chr2 (209618..212140) Histone transcription
           inhibitor, required for periodic repression of 3 of the
           4 histone gene loci and for autogenous repression of
           HTA1-HTB1 locus by H2A and H2B, member of WD (WD-40)
           repeat family [2523 bp, 840 aa]
          Length = 840

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 52/178 (29%), Positives = 77/178 (43%), Gaps = 27/178 (15%)

Query: 292 SKDGRFLATGGKDRILRIWKVIASPTERLELDSSTMKPSKTVCM-LNGKLISYSRDVPQS 350
           S DG+ LATGG D  +RIW  I S    +EL+S T  P   +   L   L S SR     
Sbjct: 26  SHDGKRLATGGLDGKIRIWS-IDSILRCMELESLT--PEIPLPQDLQMPLCSMSRHTGSI 82

Query: 351 GFARTENGDNPEDDSLDTNGMFPDESLNLYA--------PVF-------HPLPYRSFLGH 395
              +     +P+   L +     D  L ++A        P F       H    +  + H
Sbjct: 83  TCVKF----SPDGKYLASGS--DDRILLIWALDEEQSSQPAFGSEHEREHWTVRKRLVAH 136

Query: 396 NQDILDIDWSKNNFVL-TGSMDKTVKLWHCDRKQLLKNF-PHPDFVTCVKFHPNDDRF 451
           + DI DI W+ ++ +L T  +D++V +W+    + LK F  H   V  V F P +  F
Sbjct: 137 DNDIQDICWAPDSSILVTVGLDRSVIVWNGSTFEKLKRFDVHQSLVKGVVFDPANKYF 194

 Score = 36.2 bits (82), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 14/24 (58%), Positives = 19/24 (79%)

Query: 289 MKFSKDGRFLATGGKDRILRIWKV 312
           +KFS DG++LA+G  DRIL IW +
Sbjct: 85  VKFSPDGKYLASGSDDRILLIWAL 108

 Score = 31.6 bits (70), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 23/82 (28%), Positives = 34/82 (41%), Gaps = 23/82 (28%)

Query: 412 TGSMDKTVKLWHCDR-------KQLLKNFP--------------HPDFVTCVKFHPNDDR 450
           TG +D  +++W  D        + L    P              H   +TCVKF P D +
Sbjct: 34  TGGLDGKIRIWSIDSILRCMELESLTPEIPLPQDLQMPLCSMSRHTGSITCVKFSP-DGK 92

Query: 451 FFISGCLDHKARLWSILDDEVS 472
           +  SG  D    +W+ LD+E S
Sbjct: 93  YLASGSDDRILLIWA-LDEEQS 113

>CAGL0K00957g 94828..97209 similar to sp|P42935 Saccharomyces
           cerevisiae YGR200c subunit of elongating RNA polymerase
           II holoenzyme, start by similarity
          Length = 793

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 57/261 (21%), Positives = 109/261 (41%), Gaps = 39/261 (14%)

Query: 392 FLGHNQDILDIDWSKNNFVLTGSMDKTVKLWH---CDRKQLLKNFP-HPDFVTCVKFHPN 447
           F+G N+      ++K   VL     K + LW+    D + +      H   VTCVKF P 
Sbjct: 10  FIGANKQTQVCSYNKARNVLAFGAGKNIALWNPLDADCRGIYATLKGHEAEVTCVKFMPG 69

Query: 448 DDRFFISGCLDHKARLWSILDDEVSFEFDCGDLITSLEVSPGDSKYTILG--TFNGYVIV 505
            D   +S   DH  +LW     E S E +C   IT          +TI+   T  G +++
Sbjct: 70  TD-ILVSASEDHHVKLWKYKAPE-SEELECIQTITHY-------SHTIVSIETLAGLIVI 120

Query: 506 LLTRGLEHVYSFHLSDKQDKKGKDVTTRDLPTSRTNTHHGPKVTGIECFRAVNDMTLKLL 565
               GL  ++        + +G D          ++ +  P+     CF   N +  K L
Sbjct: 121 GSAGGLVSIWV------PETEGSDTYI------ISHEYSLPRNVFPLCFSLSNVVGNKYL 168

Query: 566 VTSNDSKIRVFNLKDNILQE--VLKGFENESSQISAH--LITGSKNKQQ------FVIAP 615
           +    + +++F +   +L E  V++ F N ++++  H   +   + + Q       + + 
Sbjct: 169 LAIGGTTVKIF-IYSFVLSEGKVIENF-NLAAELEGHEDWVKSIQFRHQETPGDYLLCSG 226

Query: 616 SEDHWIYCWKLQSSLMTKDKD 636
           S+D +I  W+++++ +  D +
Sbjct: 227 SQDRYIRIWRIRTNDLIDDSE 247

>Scas_720.95
          Length = 515

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 31/103 (30%), Positives = 50/103 (48%), Gaps = 6/103 (5%)

Query: 391 SFLGHNQDILDIDWSKN--NFVLTGSMDKTVKLWHCDRKQLLKNFP-HPDFVTCVKFHPN 447
           +  GH   IL   ++ N  + ++TG+ D T ++W CD +        H ++V CV + PN
Sbjct: 138 AIAGHGSTILCSAFAPNTSSRMVTGAGDNTARIWDCDTQTPKATLTGHFNWVLCVSYCPN 197

Query: 448 DDRFFISGCLDHKARLWSILDDEVSFEFDCGDL--ITSLEVSP 488
            +    +G +D+  RLW   D +   +   G L  ITSL   P
Sbjct: 198 GE-VIATGSMDNTIRLWDSKDGKPLGDALRGHLKWITSLAWEP 239

 Score = 35.4 bits (80), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 30/134 (22%), Positives = 51/134 (38%), Gaps = 21/134 (15%)

Query: 289 MKFSKDGRFLATGGKDRILRIWKVIASPTERLELDSSTMKPSKTVCMLNGKLISYSRDVP 348
           + +  +G  +ATG  D  +R+W            DS   KP      L G L  +   + 
Sbjct: 192 VSYCPNGEVIATGSMDNTIRLW------------DSKDGKPLGDA--LRGHL-KWITSLA 236

Query: 349 QSGFARTENGDNPEDDSLDTNGMFPDESLNLYAPVFHPLPYRSFLGHNQDILDIDWSKNN 408
                  + G++P   S   +G      +     ++      +  GH   +  I WS   
Sbjct: 237 WEPIHLVKPGESPRLASASKDGTIRIWDITRRVCLY------TMSGHTNSVSCIKWSGQG 290

Query: 409 FVLTGSMDKTVKLW 422
            + +GS DKTV++W
Sbjct: 291 IIYSGSHDKTVRVW 304

 Score = 31.6 bits (70), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 23/88 (26%), Positives = 38/88 (43%), Gaps = 9/88 (10%)

Query: 388 PYRSFLGHNQDILDIDWSKNNFVL-TGSMDKTVKLWHCDRKQLLKNF--PHPDFVTCVKF 444
           P  +  GH   +L + +  N  V+ TGSMD T++LW     + L +    H  ++T + +
Sbjct: 178 PKATLTGHFNWVLCVSYCPNGEVIATGSMDNTIRLWDSKDGKPLGDALRGHLKWITSLAW 237

Query: 445 H------PNDDRFFISGCLDHKARLWSI 466
                  P +     S   D   R+W I
Sbjct: 238 EPIHLVKPGESPRLASASKDGTIRIWDI 265

>YCR072C (YCR072C) [597] chr3 complement(240800..242347) Protein of
           unknown function, member of WD (WD-40) repeat family
           [1548 bp, 515 aa]
          Length = 515

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 29/100 (29%), Positives = 48/100 (48%), Gaps = 10/100 (10%)

Query: 374 DESLNLYAP--VFHPLPY----RSFLGHNQDILDIDWS--KNNFVLTGSMDKTVKLWHCD 425
           D+   LY P  VF   P      +  GH   IL   ++   ++ ++TG+ D T ++W CD
Sbjct: 115 DQITLLYTPRAVFKVKPVTRSSSAIAGHGSTILCSAFAPHTSSRMVTGAGDNTARIWDCD 174

Query: 426 RKQLLKNFP-HPDFVTCVKFHPNDDRFFISGCLDHKARLW 464
            +  +     H ++V CV + P D     +G +D+  RLW
Sbjct: 175 TQTPMHTLKGHYNWVLCVSWSP-DGEVIATGSMDNTIRLW 213

 Score = 35.4 bits (80), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 30/134 (22%), Positives = 53/134 (39%), Gaps = 21/134 (15%)

Query: 289 MKFSKDGRFLATGGKDRILRIWKVIASPTERLELDSSTMKPSKTVCMLNGKLISYSRDVP 348
           + +S DG  +ATG  D  +R+W     P     L  +    SK +  L+ + I       
Sbjct: 192 VSWSPDGEVIATGSMDNTIRLW----DPKSGQCLGDALRGHSKWITSLSWEPIHL----- 242

Query: 349 QSGFARTENGDNPEDDSLDTNGMFPDESLNLYAPVFHPLPYRSFLGHNQDILDIDWSKNN 408
                  + G  P   S   +G     ++ ++  V     Y +  GH   +  + W    
Sbjct: 243 ------VKPGSKPRLASSSKDG-----TIKIWDTVSRVCQY-TMSGHTNSVSCVKWGGQG 290

Query: 409 FVLTGSMDKTVKLW 422
            + +GS D+TV++W
Sbjct: 291 LLYSGSHDRTVRVW 304

>Kwal_56.24478
          Length = 1296

 Score = 41.6 bits (96), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 22/87 (25%), Positives = 40/87 (45%), Gaps = 3/87 (3%)

Query: 394 GHNQDILDIDWSKNN--FVLTGSMDKTVKLWHCDRKQLLKNFP-HPDFVTCVKFHPNDDR 450
           GH + +L +DW K +   +L+   D +  LW+ +  Q L  FP   ++    KF P    
Sbjct: 249 GHTKGVLSLDWCKQDETLLLSSGRDNSCVLWNPESGQNLTQFPTRGNWCFKTKFAPQAPD 308

Query: 451 FFISGCLDHKARLWSILDDEVSFEFDC 477
            F S   D+K  + ++ +   + + D 
Sbjct: 309 LFASASFDNKIEVQTLQNITCTLDVDA 335

 Score = 33.1 bits (74), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 31/66 (46%), Gaps = 2/66 (3%)

Query: 401 DIDWSKNNFVLTGSMDKTVKLWH--CDRKQLLKNFPHPDFVTCVKFHPNDDRFFISGCLD 458
           D+DWS +N VLTG++D  V  +    + K + K   H   V  V+F+        SG   
Sbjct: 67  DLDWSYDNSVLTGALDNGVVEFFSPSEYKSIAKLAQHSTPVKTVRFNAKQHNVLCSGGSK 126

Query: 459 HKARLW 464
            +  +W
Sbjct: 127 GEIYIW 132

>Scas_658.1
          Length = 442

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 38/153 (24%), Positives = 64/153 (41%), Gaps = 19/153 (12%)

Query: 386 PLPYRSFL---------GHNQDILDIDWSKN--NFVLTGSMDKTVKLW-HCDRKQLLKNF 433
           PL ++ FL         GH      + +  N  N +L+G  D  VK+W    ++ LL+++
Sbjct: 130 PLSFKCFLPKKIKYAMDGHTNGTTSLTFLPNSGNLLLSGGNDNIVKVWDFYHKRNLLRDY 189

Query: 434 P-HPDFVTCVKFHPNDDRFFISGCLDHKARLWSILDDEVSFEFDCGDLITSLEVSPGDSK 492
             H   +  + F+ +D   FIS   DH  ++W     +V  +         ++  P +S 
Sbjct: 190 KGHSKAINSLDFN-DDGTNFISSSFDHTIKIWDTEQGKVKTKLHFKSTPNDVKFRPFNSS 248

Query: 493 YTILGTFNGYVIVLLTR-----GLEHVYSFHLS 520
             I+G  N  +    TR     G   VY  H+S
Sbjct: 249 EFIVGFANSKIYHYDTRISENDGRVQVYDHHMS 281

>Scas_660.8
          Length = 510

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 46/201 (22%), Positives = 85/201 (42%), Gaps = 25/201 (12%)

Query: 435 HPDFVTCVKFHPNDDRFFISGCLDHKARLWSILDD-EVSFEF-DCGDLITSLEVSPGDSK 492
           HP  VT  KFHP D++  I+   D   RLW I +  +   E     D + S+   P    
Sbjct: 125 HPTHVT--KFHPQDNKTLITASDDRVIRLWDISNAYQPQLELTGSTDYVRSVTCVPSAPH 182

Query: 493 YTILGTFNGYVIVLLTRG--------------LEHVYSFHLSDKQDKKGKDVTTRDLPTS 538
             + G+++G + +  TR               +E + S   +      G +    DL ++
Sbjct: 183 MIVSGSYDGIIRLYDTRASGSSPIYSLLHDQPIEDIISISATQIVSCGGSNFKVWDLTSN 242

Query: 539 RTNTHHG---PKVTGIECFRAVND--MTLKLLVTSNDSKIRVFNLKDNILQEVLKGFENE 593
           +     G     VT ++   +++D  M   L+ +S D  ++VF+  D+   +V  G++  
Sbjct: 243 KKLYERGNFNKTVTCLDHVSSLDDSPMNSALIASSLDGHVKVFDPLDDF--KVKFGWKFS 300

Query: 594 SSQISAHLITGSKNKQQFVIA 614
           S+ +S  L  G     + ++A
Sbjct: 301 SAVLSCALSPGDAQGNKHLVA 321

>Scas_713.50
          Length = 983

 Score = 41.2 bits (95), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 44/171 (25%), Positives = 69/171 (40%), Gaps = 25/171 (14%)

Query: 289 MKFSKDGRFLATGGKDRILRIWKVIASPTERLELDSSTMKPS-----KTVCMLNGKLISY 343
           +  + DG+ L TG  D+ ++ W       E +   S    P       T   L+  ++S 
Sbjct: 517 LDLTSDGKRLITGSADKSVKFWN-FQLEQELVPGTSDKFVPKLGLHHDTTLELSDDILSV 575

Query: 344 SRDVPQSGFARTENGDNPEDDSLDTNGMFPDESLNLYAPVFHPLPYRSFLGHNQDILDID 403
            R  P+  F      DN       T  +F  +S+  +  ++         GH   +L ID
Sbjct: 576 -RVSPEDKFLAVSLLDN-------TVKVFFLDSMKFFLSLY---------GHKLPVLSID 618

Query: 404 WS-KNNFVLTGSMDKTVKLWHCDRKQLLKN-FPHPDFVTCVKFHPNDDRFF 452
            S  +  ++T S DK +K+W  D     K+ F H D +  VKF P    FF
Sbjct: 619 ISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFVPESHNFF 669

 Score = 30.8 bits (68), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 19/65 (29%), Positives = 32/65 (49%), Gaps = 1/65 (1%)

Query: 382 PVFHPLPYRSFLGHNQDILDIDWSKNNFVLTGSMDKTVKLWHCDRKQLLKNFPHPDFVTC 441
           P+ + L      G   DI  ID S +N +L  + + ++K+W+   K  ++ F     +TC
Sbjct: 415 PIANKLYNVELQGQRTDIRSIDISDDNKLLATASNGSLKIWNLKTKLCIRTFECGYALTC 474

Query: 442 VKFHP 446
            KF P
Sbjct: 475 -KFLP 478

>KLLA0E11297g complement(994770..996308) similar to sp|P38262
           Saccharomyces cerevisiae YBR103w SIF2 SIR4P interacting
           protein, start by similarity
          Length = 512

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 37/137 (27%), Positives = 61/137 (44%), Gaps = 7/137 (5%)

Query: 373 PDESLNLYAPVFHPLPYRSFLGHNQDILDIDWSKNN-FVLTGSMDKTVKLWHCDRKQLLK 431
           P  SL +Y  + +  P    LGH   I  ++++K+N  +L+ S D T+K+W         
Sbjct: 318 PGGSLLVYT-IGNNKPLGRLLGHTSTITTLEFNKSNKSLLSASDDNTIKVWRGGNSSAAN 376

Query: 432 NFP-HPDFVTCVKFHPNDDRFFISGCLDHKARLWSILDDEVSFEFDC-GDLITSLEVSPG 489
           +F  H   ++    H  +D   IS   D   ++WSI  + +  E     + I    +SP 
Sbjct: 377 DFTDHTKTISSA--HWINDDLIISTAYDGTVKVWSISKNSIVAEASLDSEPIFEASLSP- 433

Query: 490 DSKYTILGTFNGYVIVL 506
           D  +  +GT  G  IV 
Sbjct: 434 DRNWLTVGTLQGSAIVF 450

>Kwal_26.7570
          Length = 218

 Score = 39.3 bits (90), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 27/109 (24%), Positives = 51/109 (46%), Gaps = 3/109 (2%)

Query: 385 HPLPYRSFLGHNQDILDIDWSKNN-FVLTGSMDKTVKLWHCDRKQLLKNF-PHPDFVTCV 442
           + +P RSF GH+  + D   + +  + L+ S DKTV+LW     + ++ F  H   V  V
Sbjct: 54  YGVPVRSFRGHSHIVQDCTVTPDGEYALSASWDKTVRLWELATGKCIQRFVGHKSDVLSV 113

Query: 443 KFHPNDDRFFISGCLDHKARLWSILDDEVSFEFDCGDLITSLEVSPGDS 491
                  +  +S   D   ++W+ L + +       D ++ + V+P +S
Sbjct: 114 TIDRRASQ-IVSASRDKTVKVWNTLGECMVTLLGHNDWVSQVRVAPNES 161

>CAGL0B01529g 137174..138283 highly similar to sp|P39108
           Saccharomyces cerevisiae YDR142c PAS7 peroxisomal import
           protein - peroxin, start by similarity
          Length = 369

 Score = 40.0 bits (92), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 25/67 (37%), Positives = 35/67 (52%), Gaps = 5/67 (7%)

Query: 374 DESLNLYAPVFHPLPYRSFLGHNQDILDIDW---SKNNFVLTGSMDKTVKLWHCDRKQLL 430
           D SL L+       P   F  H++++   +W   SK+NFV + S D  VK+W  +RK  L
Sbjct: 82  DGSLRLFDTTLQKFPIAMFHEHSKEVYSCNWNLVSKSNFV-SSSWDGQVKIWSPNRKASL 140

Query: 431 KNF-PHP 436
             F PHP
Sbjct: 141 ITFSPHP 147

>Scas_711.11
          Length = 695

 Score = 40.4 bits (93), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 63/266 (23%), Positives = 110/266 (41%), Gaps = 50/266 (18%)

Query: 394 GHNQDI--LDIDWSKNNFVLTGSMDKTVKLWHCDR-KQLLKNFPHPDFVTCVKFHPNDDR 450
            H+ +I  LD D         G +D  +K+W   R KQ+ +   H   V C++   N   
Sbjct: 370 AHDDNITCLDFDLPFGTLCTAGHLDHVIKIWDLSRSKQIGRMTGHVATVNCMQITNN--- 426

Query: 451 FFISGCLDHKARLWSILDDEVSFEFDCGDLITSLEVSPGDSKYTILGTFNGYV--IVLLT 508
             +SG  D   +LW++     SF        ++LE  P  S  + + TF+ +V  I  +T
Sbjct: 427 MLVSGGKDALLKLWNLNVGVQSFRNVLPTNNSNLE--PISSSASCIHTFDSHVDEITSVT 484

Query: 509 RGLEHVYSFHLSDKQDK--------KGKDVTTRDL--------PTSRTN------THHGP 546
              E++    +S  QD+         GK + T DL        P   T+      T    
Sbjct: 485 VAGENL----ISGSQDRTIRQWDIPSGKCLQTIDLSFVAIASPPIQVTDSPFLTTTKATA 540

Query: 547 KVTGIECFRAVNDMTLKLLVTSNDSKIRVFNLKDNILQEVLKGFENESSQISAHLITGSK 606
            +  ++CF A       L   + D  +R+++L+     +V++  E  S  I+  L   +K
Sbjct: 541 IIGALQCFDAA------LATGTRDGIVRLWDLRAG---KVVRALEGHSGSITC-LKFDNK 590

Query: 607 NKQQFVIAPSEDHWIYCWKLQSSLMT 632
           N    ++  S D  +  W L+S +++
Sbjct: 591 N----IVTGSIDKTVRIWDLRSGILS 612

>Scas_695.15
          Length = 327

 Score = 40.0 bits (92), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 26/101 (25%), Positives = 50/101 (49%), Gaps = 2/101 (1%)

Query: 386 PLPYRSFLGHNQDILDIDWSKNN-FVLTGSMDKTVKLWHCDRKQLLKNFPHPDFVTCVKF 444
           P    +F GH  ++  + + ++N +++T S D T+K+W      + +N+ H   V  V  
Sbjct: 85  PNAVATFEGHKGNVTSVSFQQDNKWMVTSSEDGTIKVWDVRSPSVPRNYKHNAPVNEVVI 144

Query: 445 HPNDDRFFISGCLDHKARLWSILDDEVSFEFDCGDLITSLE 485
           HPN     IS   D   ++W + +++ + +    D  TSL+
Sbjct: 145 HPNQGE-LISCDRDGTIKIWDLGENQCTHQLIPDDDNTSLQ 184

 Score = 32.3 bits (72), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 46/219 (21%), Positives = 83/219 (37%), Gaps = 39/219 (17%)

Query: 289 MKFSKDGRFLATGGKDRILRIWKVIASPTER-----LELDSSTMKPSKTVCMLNGKLISY 343
           + F +D +++ T  +D  +++W V +    R       ++   + P++      G+LIS 
Sbjct: 101 VSFQQDNKWMVTSSEDGTIKVWDVRSPSVPRNYKHNAPVNEVVIHPNQ------GELISC 154

Query: 344 SRDVPQSGFARTENGDN----PEDD--SLDTNGMFPDESLNLYA---------------P 382
            RD     +   EN       P+DD  SL +  +  D S+ + A                
Sbjct: 155 DRDGTIKIWDLGENQCTHQLIPDDDNTSLQSLSVASDGSMLVAANNKGDCYVWEMPNHTD 214

Query: 383 VFHPLPYRSFLGHNQDILDIDWSKN-NFVLTGSMDKTVKLWHCDRKQLLKNFP-----HP 436
             +  P   F  H   I  +  S +   + T S D+T K+W     +   N       H 
Sbjct: 215 ASNLKPINKFSAHKDYITRVVLSSDVKHMATCSADRTAKIWSVGETEDDFNLETTLDGHQ 274

Query: 437 DFVTCVKFHPNDDRFFISGCLDHKARLWSILDDEVSFEF 475
            +V    F   D  + ++   DH  RLW +   E+  ++
Sbjct: 275 RWVWDCAFSA-DSAYLVTASSDHYVRLWDLSTREIVRQY 312

>Scas_707.22
          Length = 730

 Score = 40.4 bits (93), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 24/90 (26%), Positives = 44/90 (48%), Gaps = 4/90 (4%)

Query: 378 NLYAPVFHPLPYRSFLGHNQDILDIDWSKNNFVLTGSMDKTVKLWHCDRKQLLKNFP-HP 436
           N Y P F P    +  GH   ++     ++++V+TG+ D+ ++++    K+ LK    H 
Sbjct: 338 NWYNPSFKP-ERTTLTGHATSVVTCLQFEDDYVITGADDRQLRIYDARSKKFLKELSGHE 396

Query: 437 DFVTCVKFHPNDDRFFISGCLDHKARLWSI 466
             V  +K+  + D   +SG  D   R+W I
Sbjct: 397 GGVWALKY--DADGIIVSGSTDRSVRIWDI 424

 Score = 35.4 bits (80), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 16/79 (20%), Positives = 39/79 (49%), Gaps = 2/79 (2%)

Query: 394 GHNQDILDIDWSKNNFVLTGSMDKTVKLWHCDRKQLLKNFP-HPDFVTCVKFHPNDD-RF 451
           GH   +  + +  +  +++GS D++V++W   R      F  H   V C++     + ++
Sbjct: 394 GHEGGVWALKYDADGIIVSGSTDRSVRIWDIKRGCCTHVFKGHTSTVRCLEIVTYKNMKY 453

Query: 452 FISGCLDHKARLWSILDDE 470
            ++G  D+   +W ++ +E
Sbjct: 454 IVTGSRDNTLHVWKLIKEE 472

>AER263C [2765] [Homologous to ScYCR072C - SH] (1118228..1119769)
           [1542 bp, 513 aa]
          Length = 513

 Score = 40.0 bits (92), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 35/62 (56%), Gaps = 3/62 (4%)

Query: 388 PYRSFLGHNQDILDIDWSKNNFVL-TGSMDKTVKLWHCDRKQLLKNF--PHPDFVTCVKF 444
           P  +  GH+  +L + WS +  V+ TGSMD T++LW  ++ Q L +    H  ++T + +
Sbjct: 176 PLCTLKGHSNWVLCVAWSADGEVIATGSMDATIRLWDSEKGQSLGDALRGHTKWITSLSW 235

Query: 445 HP 446
            P
Sbjct: 236 EP 237

 Score = 37.4 bits (85), Expect = 0.060,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 29/56 (51%), Gaps = 2/56 (3%)

Query: 410 VLTGSMDKTVKLWHCDRKQLLKNFP-HPDFVTCVKFHPNDDRFFISGCLDHKARLW 464
           ++TG+ D T ++W CD +  L     H ++V CV +   D     +G +D   RLW
Sbjct: 157 MVTGAGDNTARIWDCDTQTPLCTLKGHSNWVLCVAWSA-DGEVIATGSMDATIRLW 211

 Score = 30.8 bits (68), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 13/30 (43%), Positives = 19/30 (63%), Gaps = 1/30 (3%)

Query: 394 GHNQDILDIDWSKNN-FVLTGSMDKTVKLW 422
           GHN ++  +DWS +   V +G  DK V+LW
Sbjct: 482 GHNDEVYTVDWSVDGKRVCSGGKDKMVRLW 511

>CAGL0L02629g complement(307323..309710) similar to sp|P07834
           Saccharomyces cerevisiae YFL009w CDC4 cell division
           control, hypothetical start
          Length = 795

 Score = 40.4 bits (93), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 27/91 (29%), Positives = 46/91 (50%), Gaps = 6/91 (6%)

Query: 378 NLYAPVFHPLPYRSFL-GHNQDILDIDWSKNNFVLTGSMDKTVKLWHCDRKQLLKNFP-H 435
           N Y P F  +P R+ L GH   ++     ++N+V+TG+ DK ++++    K+ L     H
Sbjct: 351 NWYNPDF--IPQRTTLKGHMTSVVTCLQFEDNYVITGADDKMIRIYDSITKKFLIELSGH 408

Query: 436 PDFVTCVKFHPNDDRFFISGCLDHKARLWSI 466
              V  +K+  N     +SG  D   R+W+I
Sbjct: 409 DGGVWALKYAGNG--ILVSGSTDRSVRIWNI 437

 Score = 35.0 bits (79), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 15/75 (20%), Positives = 39/75 (52%), Gaps = 2/75 (2%)

Query: 394 GHNQDILDIDWSKNNFVLTGSMDKTVKLWHCDRKQLLKNFP-HPDFVTCVKFHPNDD-RF 451
           GH+  +  + ++ N  +++GS D++V++W+    +    F  H   V C+    ++  ++
Sbjct: 407 GHDGGVWALKYAGNGILVSGSTDRSVRIWNIHLGKCTHVFKGHTSTVRCLDIVEHEGVKY 466

Query: 452 FISGCLDHKARLWSI 466
            ++G  D+   +W +
Sbjct: 467 IVTGSRDNTLHIWKL 481

>Kwal_27.12667
          Length = 721

 Score = 40.0 bits (92), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 54/253 (21%), Positives = 102/253 (40%), Gaps = 41/253 (16%)

Query: 400 LDIDWSKNNFVLTGSMDKTVKLWHCDRKQLLKNFP-HPDFVTCVKFHPNDDRFFISGCLD 458
           LD D         G +D +VK+W+  +K  +   P H   V+C++    D    I+G  D
Sbjct: 410 LDFDLPFGTMCTAGKLDHSVKIWNLSKKTQIGALPGHLASVSCMQME--DSHSLITGGRD 467

Query: 459 HKARLWSILDDEVSFEFDCGDLITSLEVSPGDS---KYTILGTFNGYVIV---------- 505
              +LW I   E  +     +    L V   D+   + T L  F G  +V          
Sbjct: 468 ALLKLWDIEKAEELYNDGATEGEEELCVHTFDAHVDEITAL-HFEGNSLVSGSQDRTIRQ 526

Query: 506 --LLTRGLEHVYSFHLSDKQDKKG-KDVTTRDLPTSRTNTHHGPKVTG-IECFRAVNDMT 561
             L T         + +++    G   +++ +  +S   TH+ P V G ++C+ A     
Sbjct: 527 WDLTTGKCLQTIDINFANRGTSGGFSKISSNNPRSSILLTHNDPPVIGALQCYDAA---- 582

Query: 562 LKLLVTSNDSKIRVFNLKDNILQEVLKGFENESSQI---SAHLITGSKNKQQFVIAPSED 618
             +   + D  +R+++L+   +   L+G  +  + +   S +L+TGS ++          
Sbjct: 583 --MATGTKDGLVRLWDLRSGQVIRTLEGHTDAVTGLQFDSVNLVTGSLDRS--------- 631

Query: 619 HWIYCWKLQSSLM 631
             I  W L++ L+
Sbjct: 632 --IRIWDLRTGLL 642

>AEL314W [2191] [Homologous to ScYJL112W (MDV1) - SH; ScYKR036C
           (CAF4) - SH] complement(52978..55125) [2148 bp, 715 aa]
          Length = 715

 Score = 40.0 bits (92), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 45/191 (23%), Positives = 86/191 (45%), Gaps = 26/191 (13%)

Query: 298 LATGGKDRILRIWKVIASPTERLELDSSTMKPSKTVCMLNGKLISYSRDVPQSGFARTEN 357
           L TGG+D +L++W +      +  +D+ ++ PS  VC+      S+  ++    F     
Sbjct: 468 LITGGRDALLKMWDI------QKAIDNDSI-PSDEVCIYT--FDSHIDEITALSFEANNL 518

Query: 358 GDNPEDDSL---DTNGMFPDESLNL-YAP---VFHPLPYRSFLGHNQD--ILDIDWSKNN 408
               +D ++   D N     ++L++ +A    +   +    FL  N D  I+      + 
Sbjct: 519 VSGSQDRTIRQWDLNNGKCVQTLDINFATGGNLSRSMIGSGFLNTNNDHPIIGAIQCYDA 578

Query: 409 FVLTGSMDKTVKLWHCDRKQLLKNFP-HPDFVTCVKFHPNDDRFFISGCLDHKARLWSI- 466
            + TG+ D  V+LW     ++++    H D VT ++F   D    ++G LD+  R+W + 
Sbjct: 579 ALATGTKDGIVRLWDLRSGRVVRTLEGHSDAVTSLQF---DSLNLVTGSLDNSIRIWDLR 635

Query: 467 ---LDDEVSFE 474
              L D  S+E
Sbjct: 636 TGTLADTFSYE 646

 Score = 37.7 bits (86), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 41/158 (25%), Positives = 69/158 (43%), Gaps = 26/158 (16%)

Query: 298 LATGGKDRILRIWKVI-ASPTERLELDSSTMKPSKTVCMLNGKLISYSRDVPQSGFARTE 356
           L +G +DR +R W +      + L+++ +T           G L   SR +  SGF  T 
Sbjct: 518 LVSGSQDRTIRQWDLNNGKCVQTLDINFAT----------GGNL---SRSMIGSGFLNT- 563

Query: 357 NGDNP-------EDDSLDTNGMFPDESLNLYAPVFHPLPYRSFLGHNQDILDIDWSKNNF 409
           N D+P        D +L T     D  + L+  +      R+  GH+  +  + +   N 
Sbjct: 564 NNDHPIIGAIQCYDAALATGT--KDGIVRLW-DLRSGRVVRTLEGHSDAVTSLQFDSLNL 620

Query: 410 VLTGSMDKTVKLWHCDRKQLLKNFPHPDFVTCVKFHPN 447
           V TGS+D ++++W      L   F +   VTC++F  N
Sbjct: 621 V-TGSLDNSIRIWDLRTGTLADTFSYEHPVTCLQFDLN 657

 Score = 32.7 bits (73), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 45/219 (20%), Positives = 85/219 (38%), Gaps = 46/219 (21%)

Query: 391 SFLGHNQDILDIDWSKNNFVLTGSMDKTVKLWHCDRKQLLKNFP-----------HPDFV 439
           S  GH   +  +   + N ++TG  D  +K+W   +     + P           H D +
Sbjct: 449 SITGHLATVSCMQMDQYNTLITGGRDALLKMWDIQKAIDNDSIPSDEVCIYTFDSHIDEI 508

Query: 440 TCVKFHPNDDRFFISGCLDHKARLWSILDDE----VSFEFDCGDLITSLEVSPG----DS 491
           T + F  N+    +SG  D   R W + + +    +   F  G  ++   +  G    ++
Sbjct: 509 TALSFEANN---LVSGSQDRTIRQWDLNNGKCVQTLDINFATGGNLSRSMIGSGFLNTNN 565

Query: 492 KYTILGTFNGYVIVLLTR---GLEHVYSFHLSDKQDKKGKDVTTRDLPTSRTNTHHGPKV 548
            + I+G    Y   L T    G+  ++         + G+ V        RT   H   V
Sbjct: 566 DHPIIGAIQCYDAALATGTKDGIVRLWDL-------RSGRVV--------RTLEGHSDAV 610

Query: 549 TGIECFRAVNDMTLKLLVTSNDSKIRVFNLKDNILQEVL 587
           T ++ F ++N     L+  S D+ IR+++L+   L +  
Sbjct: 611 TSLQ-FDSLN-----LVTGSLDNSIRIWDLRTGTLADTF 643

>AGL024W [4287] [Homologous to ScYFL009W (CDC4) - SH; ScYER066W -
           NSH] complement(667539..669809) [2271 bp, 756 aa]
          Length = 756

 Score = 40.0 bits (92), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 31/120 (25%), Positives = 55/120 (45%), Gaps = 16/120 (13%)

Query: 388 PYRSFL-GHNQDILDIDWSKNNFVLTGSMDKTVKLWHCDRKQL-LKNFPHPDFVTCVKFH 445
           P R+ L GH   ++     + N+++TG+ DK + ++  DR+Q  L+   H   V  +K+ 
Sbjct: 357 PGRTCLDGHRTKVVTCFQFEGNYIITGADDKRINVYDADREQFKLELVGHEGGVWALKY- 415

Query: 446 PNDDRFFISGCLDHKARLWSILDDEVSFEF-------DCGDLITSLEVSPGDSKYTILGT 498
              D   +SG  D   R+W++   + +  F        C D+     V  G  KY + G+
Sbjct: 416 -AGDEILVSGSTDRTVRIWNVKAGKCTHVFRGHTSTVRCLDV-----VEHGGIKYVVTGS 469

 Score = 37.0 bits (84), Expect = 0.091,   Method: Compositional matrix adjust.
 Identities = 74/343 (21%), Positives = 136/343 (39%), Gaps = 52/343 (15%)

Query: 289 MKFSKDGRFLATGGKDRILRIWKVIASP-TERLELDSSTMKPSKTVCMLNGKLISYSRDV 347
           +K++ D   L +G  DR +RIW V A   T      +ST++     C+          DV
Sbjct: 413 LKYAGD-EILVSGSTDRTVRIWNVKAGKCTHVFRGHTSTVR-----CL----------DV 456

Query: 348 PQSG---FARTENGDN-------PEDDSLDTNGMFPDESLNLYAPVFHPLPYRSFLGHNQ 397
            + G   +  T + DN       P+ +S D N   P+      +   +P       GH  
Sbjct: 457 VEHGGIKYVVTGSRDNTLHVWKLPDPNSPDYN---PNAMRQFNSIEDNPFFVGVLRGHMA 513

Query: 398 DILDIDWSKNNFVLTGSMDKTVKLWHCDRKQLLKNFP-HPDFVTCVKFHPNDDRFFISGC 456
            +  +     N V++GS D  + +W   + +LL     H D +    +     R  IS  
Sbjct: 514 SVRTVS-GHGNIVVSGSYDHNLMVWDIAKMKLLYVLTGHTDRIYSTLYDHKRKR-CISAS 571

Query: 457 LDHKARLWSILDDEVSFEFDCGDLITSLEVSPGDSKYTILGTFNGYVIVLLTRGLEHVYS 516
           +D   ++W + D   +      +  ++L+VS        + T  G+  ++   GL   Y 
Sbjct: 572 MDTTVKVWDLSDINNNGPVSQINSTSALKVSGS------VRTLCGHTALVGLLGLSDKYL 625

Query: 517 FHLSDKQDKKGKDVTTRDLPTSRTNTHHGPKVTGIECFRAVNDMTLKLLVTSNDSKIRVF 576
              +     +G D +     + R + HH  +      F + N     +LV+ ++ +  ++
Sbjct: 626 VSAAADGSLRGWDASDY---SKRFSFHHTNQSAITTFFVSDN-----ILVSGSEHQFNIY 677

Query: 577 NLKDNILQEVLKGFENESSQISAHLITGSKNKQQFVIAPSEDH 619
           +L+   L  V +   N+++QI         N++  V   SEDH
Sbjct: 678 DLRTGRL--VHRHLLNDAAQIWG---VKFNNRKLVVAVESEDH 715

 Score = 33.5 bits (75), Expect = 0.88,   Method: Compositional matrix adjust.
 Identities = 16/79 (20%), Positives = 39/79 (49%), Gaps = 2/79 (2%)

Query: 392 FLGHNQDILDIDWSKNNFVLTGSMDKTVKLWHCDRKQLLKNF-PHPDFVTCVKFHPNDD- 449
            +GH   +  + ++ +  +++GS D+TV++W+    +    F  H   V C+    +   
Sbjct: 403 LVGHEGGVWALKYAGDEILVSGSTDRTVRIWNVKAGKCTHVFRGHTSTVRCLDVVEHGGI 462

Query: 450 RFFISGCLDHKARLWSILD 468
           ++ ++G  D+   +W + D
Sbjct: 463 KYVVTGSRDNTLHVWKLPD 481

>AGL196C [4116] [Homologous to ScYLR129W (DIP2) - SH]
           (328838..331645) [2808 bp, 935 aa]
          Length = 935

 Score = 40.0 bits (92), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 38/78 (48%), Gaps = 3/78 (3%)

Query: 389 YRSFLGHNQDILDIDWSKNN-FVLTGSMDKTVKLWHCDRKQLLKN-FPHPDFVTCVKFHP 446
           + S  GH   +L +D S ++  ++T S DK +K+W  D     K+ F H D +  VKF P
Sbjct: 560 FLSLYGHKLPVLSMDISHDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLP 619

Query: 447 NDDRFFISGCLDHKARLW 464
               FF S   D   + W
Sbjct: 620 ESHNFF-SCSKDGTVKYW 636

>Scas_702.16
          Length = 816

 Score = 40.0 bits (92), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 44/175 (25%), Positives = 73/175 (41%), Gaps = 21/175 (12%)

Query: 292 SKDGRFLATGGKDRILRIWKV--------IASPTERLELDSSTMKPSKTVCMLNGKLISY 343
           S DG+ +ATGG D  +RIW V        I S  + + +D    KP  ++    G  ++ 
Sbjct: 26  SPDGKRVATGGLDGKIRIWSVDSIKQIVKILSLKDEVPIDKELKKPLASMSRHTGS-VTC 84

Query: 344 SRDVPQSGFARTENGDN-----PEDDSLDTNGMFPDESLNLYAPVFHPLPYRSFLGHNQD 398
            +  P   +  + + D        D+      +F  ES      V      +  + H+ D
Sbjct: 85  LKFSPNGKYLASGSDDRILLIWTLDEERPIQPIFGGESEKERWAV-----RKRLVAHDND 139

Query: 399 ILDIDWSKNNFVLTG-SMDKTVKLWHCDRKQLLKNF-PHPDFVTCVKFHPNDDRF 451
           I DI W+ ++ +L    +D+ V +W+    + LK F  H   V  V F P +  F
Sbjct: 140 IQDICWAPDSSLLVSVGLDRAVIIWNGITFEKLKRFDVHQSHVKGVIFDPANKYF 194

 Score = 34.7 bits (78), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 13/22 (59%), Positives = 18/22 (81%)

Query: 289 MKFSKDGRFLATGGKDRILRIW 310
           +KFS +G++LA+G  DRIL IW
Sbjct: 85  LKFSPNGKYLASGSDDRILLIW 106

>KLLA0F21406g complement(1996260..1998377) similar to sp|P47025
           Saccharomyces cerevisiae YJL112w MDV1, start by
           similarity
          Length = 705

 Score = 40.0 bits (92), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 56/260 (21%), Positives = 112/260 (43%), Gaps = 45/260 (17%)

Query: 394 GHNQDI--LDIDWSKNNFVLTGSMDKTVKLWHCDRKQLLKNF-PHPDFVTCVKFHPNDDR 450
            H++DI  LD D         GS+D +VK+W   +K+ +     H   ++C++     D+
Sbjct: 395 AHDEDITCLDFDMPFGTMCSAGSLDHSVKVWDLSKKKQIATLHGHLASISCMQI----DQ 450

Query: 451 F--FISGCLDHKARLWSI---LDDEVSFEFDCGDLITSLEVSPGDSKYTILGTFNGYVIV 505
           +   I+G  D   +LW I   + DE S   +  D       S  D    I  +F+G  +V
Sbjct: 451 YSTLITGGRDAVLKLWDIDKAMADEASNSSEDNDACLYTFDSHVDEITAI--SFDGDNLV 508

Query: 506 LLTRGLEHVYSFHLSDKQDKKGKDV--------TTRDLP--TSRTNTHHGPKVTGIECFR 555
             ++    V  + L+  +  +  D+        + R++P   S   T   P +  ++CF 
Sbjct: 509 SGSQD-RTVRQWDLNSGKCTQTIDISFATGPMRSQRNIPLRNSVLLTKEPPAIGALQCFD 567

Query: 556 AVNDMTLKLLVTSNDSKIRVFNLKDNILQEVLKGFENESSQI---SAHLITGSKNKQQFV 612
           A       L   + D  +R+++L+   +  +L+G  +  + +   S +L+TG+ ++    
Sbjct: 568 AA------LATGTKDGIVRLWDLRSGKVVRMLEGHTDAITSLQFDSVNLVTGAMDRS--- 618

Query: 613 IAPSEDHWIYCWKLQSSLMT 632
                   I  W L++ +++
Sbjct: 619 --------IRIWDLRTGILS 630

 Score = 32.0 bits (71), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 64/256 (25%), Positives = 97/256 (37%), Gaps = 48/256 (18%)

Query: 394 GHNQDILDIDWSKNNFVLTGSMDKTVKLWHCDRKQ-------------LLKNF-PHPDFV 439
           GH   I  +   + + ++TG  D  +KLW  D+                L  F  H D +
Sbjct: 438 GHLASISCMQIDQYSTLITGGRDAVLKLWDIDKAMADEASNSSEDNDACLYTFDSHVDEI 497

Query: 440 TCVKFHPNDDRFFISGCLDHKARLWSILDDEVSFEFDCGDLITSLEVSPGDSKYTILGTF 499
           T + F   D    +SG  D   R W +   + +   D      S    P  S+  I    
Sbjct: 498 TAISF---DGDNLVSGSQDRTVRQWDLNSGKCTQTIDI-----SFATGPMRSQRNIPLRN 549

Query: 500 NGYVIVLLTRGLEHVYSFHLSDKQDKKG-KDVTTR--DLPTS---RTNTHHGPKVTGIEC 553
           +    VLLT+    + +    D     G KD   R  DL +    R    H   +T ++ 
Sbjct: 550 S----VLLTKEPPAIGALQCFDAALATGTKDGIVRLWDLRSGKVVRMLEGHTDAITSLQ- 604

Query: 554 FRAVNDMTLKLLVTSNDSKIRVFNLKDNILQEVLKGFENESSQISAHL----ITGSKNKQ 609
           F +VN     L+  + D  IR+++L+  IL +V   F  E    S H     I  S N+ 
Sbjct: 605 FDSVN-----LVTGAMDRSIRIWDLRTGILSDV---FAYEQPITSLHFDLDKIVISNNEP 656

Query: 610 QFVIAPSED--HWIYC 623
              I   +D  HW +C
Sbjct: 657 TVKIYNRKDGNHW-FC 671

>CAGL0C02937g 290289..291692 similar to sp|P39946 Saccharomyces
           cerevisiae YOR269w PAC1, hypothetical start
          Length = 467

 Score = 39.7 bits (91), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 27/78 (34%), Positives = 41/78 (52%), Gaps = 7/78 (8%)

Query: 390 RSFLGHNQDILDID-WSKNNFVL--TGSMDKTVKLWHCDRKQLLKNF-PHPDFVTCVKFH 445
           RSF  H+  +     W K+N VL  + S D TVK+W  +  + L++F PH ++V  +   
Sbjct: 215 RSFNAHDSTVSSQKTWQKDNDVLLASSSRDATVKVWRVNDSRCLQSFSPHSEWVKSIDVL 274

Query: 446 PNDDRFFISGCLDHKARL 463
              D + +SG LD   RL
Sbjct: 275 ---DEYILSGSLDSTLRL 289

>Kwal_27.12586
          Length = 509

 Score = 39.7 bits (91), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 37/120 (30%), Positives = 54/120 (45%), Gaps = 4/120 (3%)

Query: 388 PYRSFLGHNQDILDIDW-SKNNFVLTGSMDKTVKLWHCDRKQLLKNFPHPDFVTCVKFHP 446
           P     GH+  I   D+ S+NN +L+GS DKT+++W          F          F  
Sbjct: 327 PLGKLNGHSATITAFDFNSENNMLLSGSDDKTLRVWRSGSLSSSNCFMGNTLGITSAFWI 386

Query: 447 NDDRFFISGCLDHKARLWSILDDEV-SFEFDCGDLITSLEVSPGDSKYTILGTFNGYVIV 505
           +DD+  I+  LD   RLWS L + + +     G  I    +SP   K+ I G  +G V V
Sbjct: 387 DDDK-VIATSLDGSVRLWSHLTNTLQAISMVDGVPIFCGSLSPDKLKFAI-GKMDGEVTV 444

>Sklu_2173.2 YCR072C, Contig c2173 2732-4279
          Length = 515

 Score = 39.3 bits (90), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 17/56 (30%), Positives = 31/56 (55%), Gaps = 2/56 (3%)

Query: 410 VLTGSMDKTVKLWHCDRKQLLKNFP-HPDFVTCVKFHPNDDRFFISGCLDHKARLW 464
           ++TG+ D T ++W C+ +  +     H ++V CV + P D     +G +D+  RLW
Sbjct: 159 MITGAGDNTARIWDCNTQTPMSTLKGHFNWVLCVSWSP-DGELIATGSMDNTIRLW 213

 Score = 37.7 bits (86), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 24/77 (31%), Positives = 38/77 (49%), Gaps = 3/77 (3%)

Query: 391 SFLGHNQDILDIDWSKN-NFVLTGSMDKTVKLWHCDRKQLLKNFP-HPDFVTCVKFHPND 448
           +F GH   +  + WS +   +++ S D T+K+W    K+L  + P H D V  V +  + 
Sbjct: 439 TFRGHVASVYQVAWSSDCRLLVSCSKDTTLKVWDVKTKKLAVDLPGHKDEVYTVDWSVDG 498

Query: 449 DRFFISGCLDHKARLWS 465
            R   SG  D   RLW+
Sbjct: 499 KR-VCSGGKDKMVRLWT 514

 Score = 37.7 bits (86), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 18/62 (29%), Positives = 33/62 (53%), Gaps = 3/62 (4%)

Query: 388 PYRSFLGHNQDILDIDWSKNN-FVLTGSMDKTVKLWHCDRKQLLKNF--PHPDFVTCVKF 444
           P  +  GH   +L + WS +   + TGSMD T++LW  ++ Q + +    H  ++T + +
Sbjct: 178 PMSTLKGHFNWVLCVSWSPDGELIATGSMDNTIRLWEGNKGQPVGDALRGHGKWITSLSW 237

Query: 445 HP 446
            P
Sbjct: 238 EP 239

>YDL195W (SEC31) [678] chr4 (107209..111030) Component (p150) of the
           COPII coat of secretory pathway vesicles involved in
           endoplasmic reticulum to Golgi transport, associated
           with Sec13p, member of WD (WD-40) repeat family [3822
           bp, 1273 aa]
          Length = 1273

 Score = 39.7 bits (91), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 21/76 (27%), Positives = 35/76 (46%), Gaps = 3/76 (3%)

Query: 394 GHNQDILDIDWSKNN--FVLTGSMDKTVKLWHCDRKQLLKNFP-HPDFVTCVKFHPNDDR 450
           GH + IL +DW   +   +L+   D TV LW+ +  + L  FP   ++    KF P    
Sbjct: 255 GHQKGILSLDWCHQDEHLLLSSGRDNTVLLWNPESAEQLSQFPARGNWCFKTKFAPEAPD 314

Query: 451 FFISGCLDHKARLWSI 466
            F     D+K  + ++
Sbjct: 315 LFACASFDNKIEVQTL 330

 Score = 31.2 bits (69), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 18/72 (25%), Positives = 35/72 (48%), Gaps = 6/72 (8%)

Query: 401 DIDWSKNNFVLTGSMDK-TVKLWHCDRK-----QLLKNFPHPDFVTCVKFHPNDDRFFIS 454
           D+DWS NN ++ G++D  +++L+  +        + +   H   V  VKF+   D    S
Sbjct: 67  DLDWSHNNKIIAGALDNGSLELYSTNEANNAINSMARFSNHSSSVKTVKFNAKQDNVLAS 126

Query: 455 GCLDHKARLWSI 466
           G  + +  +W +
Sbjct: 127 GGNNGEIFIWDM 138

>CAGL0D04884g 475678..477369 highly similar to tr|Q06506
           Saccharomyces cerevisiae YPR137w RRP9, start by
           similarity
          Length = 563

 Score = 39.3 bits (90), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 23/77 (29%), Positives = 40/77 (51%), Gaps = 5/77 (6%)

Query: 394 GHNQDILDIDWS-KNNFVLTGSMDKTVKLWHCDRKQLLKNFPHPDF---VTCVKFHPNDD 449
           GH  +IL +  S K + V+TG  D+ + +W  +    +K  P  D    +  + F  N D
Sbjct: 225 GHYDEILTVAASPKGDVVVTGGRDRKLIVWSTESLAPIKVIPTKDRKGQILSLTFRRNSD 284

Query: 450 RFFISGCLDHKARLWSI 466
           + +++ C D+K R +SI
Sbjct: 285 QLYVA-CADYKIRTYSI 300

>KLLA0E21263g 1892524..1893813 similar to sp|P40968 Saccharomyces
           cerevisiae YDR364c CDC40 cell division control protein
           singleton, start by similarity
          Length = 429

 Score = 38.9 bits (89), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 20/74 (27%), Positives = 37/74 (50%), Gaps = 1/74 (1%)

Query: 390 RSFLGHNQDILDIDWSKNNFVL-TGSMDKTVKLWHCDRKQLLKNFPHPDFVTCVKFHPND 448
           R++ GH+  I D++++ N     + S DK VK+W+ ++  + K         C+ FHP D
Sbjct: 173 RTYEGHSMTIKDLNFTDNGHSFASASFDKWVKIWNTEKGIIDKRLRFNSVPNCITFHPKD 232

Query: 449 DRFFISGCLDHKAR 462
               + G  + + R
Sbjct: 233 KNQLVVGLSNSEIR 246

>Sklu_2435.13 YPR137W, Contig c2435 18346-20073
          Length = 575

 Score = 38.9 bits (89), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 24/77 (31%), Positives = 39/77 (50%), Gaps = 5/77 (6%)

Query: 394 GHNQDILDIDWSKNN-FVLTGSMDKTVKLWHCDRKQLLKNFPHPDF---VTCVKFHPNDD 449
           GH  +IL +  S +  +V+TG  D+ + +W  +    +K  P  D    V  + F  N D
Sbjct: 236 GHYDEILTVAASPDGKYVVTGGRDRKLIVWSTESLSPVKVIPTKDRRGEVLSLAFRKNSD 295

Query: 450 RFFISGCLDHKARLWSI 466
           + F S C D+K R ++I
Sbjct: 296 QLFAS-CADYKVRTYAI 311

 Score = 33.9 bits (76), Expect = 0.66,   Method: Compositional matrix adjust.
 Identities = 18/68 (26%), Positives = 34/68 (50%), Gaps = 6/68 (8%)

Query: 424 CDRKQLLKNFPHPDFVTCVKFHPNDDRFFISGCLDHKARLWSILDDEVSFEF-----DCG 478
           C ++   KN  HP ++T +   P  +  F+SG  +   +LW I ++   FE      +C 
Sbjct: 462 CQQQLQDKNLTHPYWITSLHAIPYSN-VFVSGSWNGSLKLWKISENLREFEILAELPNCR 520

Query: 479 DLITSLEV 486
            L+T+++ 
Sbjct: 521 GLVTNIQA 528

>Scas_719.30
          Length = 940

 Score = 38.9 bits (89), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 19/76 (25%), Positives = 35/76 (46%), Gaps = 1/76 (1%)

Query: 390 RSFLGHNQDILDIDWSKNN-FVLTGSMDKTVKLWHCDRKQLLKNFPHPDFVTCVKFHPND 448
           R F GH+  I  +D+S +  ++++ S+D T++ W       +         T VKF PN 
Sbjct: 580 RQFWGHSNRITALDFSPDGRWIVSASLDSTIRTWDLPTGGCIDGIKLESVATDVKFSPNG 639

Query: 449 DRFFISGCLDHKARLW 464
           D    +  + +   +W
Sbjct: 640 DMLATTHVIGNGIYIW 655

>CAGL0J04818g 455846..457810 highly similar to sp|Q06440
           Saccharomyces cerevisiae YLR429w CRN1, start by
           similarity
          Length = 654

 Score = 38.9 bits (89), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 26/114 (22%), Positives = 48/114 (42%), Gaps = 18/114 (15%)

Query: 392 FLGHNQDILDIDWSK--NNFVLTGSMDKTVKLWHCDR---------KQLLKNFPHPDFVT 440
           F GH   +LD D+    +N V + S D  + +W   +          + +K+     F+T
Sbjct: 77  FRGHTAQVLDTDFDPFDDNRVASSSDDGKIGIWDIPQDYSILKSGDNEEIKDIEPTKFLT 136

Query: 441 C-------VKFHPNDDRFFISGCLDHKARLWSILDDEVSFEFDCGDLITSLEVS 487
                   + +HP       S  LD+  R+W++   E  ++    D++TS+  S
Sbjct: 137 GHSRKVGHILYHPTAKDVLASSSLDYTVRIWNVETGEDIYKLKHPDMVTSMSFS 190

 Score = 32.0 bits (71), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 13/24 (54%), Positives = 16/24 (66%)

Query: 289 MKFSKDGRFLATGGKDRILRIWKV 312
           M FS DG  LAT  +D+ LR+W V
Sbjct: 187 MSFSYDGTHLATVARDKKLRVWNV 210

>AER114W [2619] [Homologous to ScYLR429W (CRN1) - SH]
           complement(850726..850730,850789..852685) [1902 bp, 633
           aa]
          Length = 633

 Score = 38.9 bits (89), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 30/117 (25%), Positives = 42/117 (35%), Gaps = 19/117 (16%)

Query: 392 FLGHNQDILDIDWSK--NNFVLTGSMDKTVKLWHCDRKQLLKNFPHPD----FVTCVKF- 444
           F GH   +LD D+       +++GS D  + +W         N    D     V  VKF 
Sbjct: 77  FRGHTAQVLDTDFDPFDERMLVSGSDDGRIGVWEIPATYSFHNAQDEDGNVEHVAPVKFL 136

Query: 445 ------------HPNDDRFFISGCLDHKARLWSILDDEVSFEFDCGDLITSLEVSPG 489
                       HP       S  LDH  RLW++            D++TS+  S G
Sbjct: 137 TGHQRKVGHVLYHPTAQGVLASSSLDHTVRLWNVEQGTNPIVLTHPDMVTSMSFSYG 193

>YBR175W (SWD3) [360] chr2 (582365..583312) Component of SET1 and
           COMPASS complex, has several WD (WD-40) repeats and may
           be involved in chromatin remodeling [948 bp, 315 aa]
          Length = 315

 Score = 38.5 bits (88), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 26/94 (27%), Positives = 44/94 (46%), Gaps = 7/94 (7%)

Query: 372 FPDESLNLYAPVFHPLPYRSFLGHNQDILDIDWS-KNNFVLTGSMDKTVKLWHCDRKQLL 430
           F  E ++L   + H     +F+GH   ++ + ++ K N + T SMD+++K+W      L+
Sbjct: 77  FSVEIIHLSYGLLH-----TFIGHTAPVISLTFNRKGNLLFTSSMDESIKIWDTLNGSLM 131

Query: 431 KNF-PHPDFVTCVKFHPNDDRFFISGCLDHKARL 463
           K    H + V  V    ND     SG  D   R+
Sbjct: 132 KTISAHSEAVVSVDVPMNDSSILSSGSYDGLIRI 165

>YFL009W (CDC4) [1673] chr6 (116139..118478) F-box protein and
           component of the SCF-Cdc4p complex
           (Skp1p-Cdc53p-Cdc34p-Cdc4p) which targets Sic1p, Far1p,
           Cdc6p, Ctf13p and Gcn4p for ubiquitin-dependent
           degradation, has WD (WD-40) repeats [2340 bp, 779 aa]
          Length = 779

 Score = 38.9 bits (89), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 61/298 (20%), Positives = 120/298 (40%), Gaps = 24/298 (8%)

Query: 289 MKFSKDGRFLATGGKDRILRIWKVI-ASPTERLELDSSTMKPSKTVCMLNGK-LISYSRD 346
           +K++  G  L +G  DR +R+W +     T   +  +ST++    V   N K +++ SRD
Sbjct: 428 LKYAHGG-ILVSGSTDRTVRVWDIKKGCCTHVFKGHNSTVRCLDIVEYKNIKYIVTGSRD 486

Query: 347 VPQSGFARTENGDNPEDDSLDTNGMFPDESLNLYAPVFHPLPYRSFLGHNQDILDIDWSK 406
                +        P++ S+  +G   D  L  + P  +P       GH   +  +    
Sbjct: 487 NTLHVWKL------PKESSVPDHGEEHDYPLVFHTPEENPYFVGVLRGHMASVRTVS-GH 539

Query: 407 NNFVLTGSMDKTVKLWHCDRKQLLKNFP-HPDFVTCVKFHPNDDRFFISGCLDHKARLWS 465
            N V++GS D T+ +W   + + L     H D +    +     R  IS  +D   R+W 
Sbjct: 540 GNIVVSGSYDNTLIVWDVAQMKCLYILSGHTDRIYSTIYDHERKR-CISASMDTTIRIWD 598

Query: 466 ILDDEVSFEFDCGDLITSLEVSPGDSKYTILGTFNGYVIVLLTRGLEHVYSFHLSDKQDK 525
           +  + +    +C     S   SP       + T  G+  ++    L   +    +     
Sbjct: 599 L--ENIWNNGECSYATNS--ASPCAKILGAMYTLQGHTALVGLLRLSDKFLVSAAADGSI 654

Query: 526 KGKDVTTRDLPTSRTNTHHGPKVTGIECFRAVNDMTLKLLVTSNDSKIRVFNLKDNIL 583
           +G D        SR  ++H   ++ I  F   ++    +LV+ ++++  ++NL+   L
Sbjct: 655 RGWDANDY----SRKFSYHHTNLSAITTFYVSDN----ILVSGSENQFNIYNLRSGKL 704

 Score = 38.9 bits (89), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 27/91 (29%), Positives = 47/91 (51%), Gaps = 6/91 (6%)

Query: 378 NLYAPVFHPLPYRSFL-GHNQDILDIDWSKNNFVLTGSMDKTVKLW-HCDRKQLLKNFPH 435
           N Y P F  +P R+ L GH   ++     ++N+V+TG+ DK ++++   ++K LL+   H
Sbjct: 364 NWYNPKF--VPQRTTLRGHMTSVITCLQFEDNYVITGADDKMIRVYDSINKKFLLQLSGH 421

Query: 436 PDFVTCVKFHPNDDRFFISGCLDHKARLWSI 466
              V  +K+        +SG  D   R+W I
Sbjct: 422 DGGVWALKYAHGG--ILVSGSTDRTVRVWDI 450

 Score = 32.0 bits (71), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 15/75 (20%), Positives = 36/75 (48%), Gaps = 2/75 (2%)

Query: 394 GHNQDILDIDWSKNNFVLTGSMDKTVKLWHCDRKQLLKNFP-HPDFVTCVKF-HPNDDRF 451
           GH+  +  + ++    +++GS D+TV++W   +      F  H   V C+      + ++
Sbjct: 420 GHDGGVWALKYAHGGILVSGSTDRTVRVWDIKKGCCTHVFKGHNSTVRCLDIVEYKNIKY 479

Query: 452 FISGCLDHKARLWSI 466
            ++G  D+   +W +
Sbjct: 480 IVTGSRDNTLHVWKL 494

 Score = 30.8 bits (68), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 21/76 (27%), Positives = 36/76 (47%), Gaps = 4/76 (5%)

Query: 564 LLVTSNDSKIRVFNLKDNILQEVLKGFENESSQISAHLITGSKNKQQFVIAPSEDHWIYC 623
           L+  S D  +RV+++K      V KG    +S +    I   KN  ++++  S D+ ++ 
Sbjct: 436 LVSGSTDRTVRVWDIKKGCCTHVFKG---HNSTVRCLDIVEYKN-IKYIVTGSRDNTLHV 491

Query: 624 WKLQSSLMTKDKDKEH 639
           WKL       D  +EH
Sbjct: 492 WKLPKESSVPDHGEEH 507

>Scas_512.3
          Length = 534

 Score = 38.5 bits (88), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 23/81 (28%), Positives = 45/81 (55%), Gaps = 3/81 (3%)

Query: 398 DILDIDWSK-NNFVLTGSMDKTVKLWHCDRKQLLKNFP-HPDFVTCVKFHPNDDRFFISG 455
           +I D+DWS  + +V++GSMD +++++  +  +LL  +  H  +V  V + P ++ F +S 
Sbjct: 148 EIYDLDWSPCDRYVVSGSMDNSIRVFDIESGKLLGTYADHNHYVQGVTWDPLNE-FILSQ 206

Query: 456 CLDHKARLWSILDDEVSFEFD 476
             D    ++ I+ D  S   D
Sbjct: 207 SADRSVNIYQIIWDSDSNTID 227

>Scas_718.6*
          Length = 546

 Score = 38.5 bits (88), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 19/76 (25%), Positives = 40/76 (52%), Gaps = 2/76 (2%)

Query: 392 FLGHNQDILDIDWSKNNFVLTGSMDKTVKLWHCDRKQLL-KNFPHPDFVTCVKFHPNDDR 450
           F GH+Q I+ + W  ++ V++ SMD +V++W      L+       + + C K   + ++
Sbjct: 408 FYGHSQSIISLSWINDDLVISASMDGSVRIWSVVENCLVGMAMVDGNAIICGKISHDKNK 467

Query: 451 FFISGCLDHKARLWSI 466
           F I G ++ +  ++ I
Sbjct: 468 FAI-GSMNGQINVYDI 482

 Score = 30.4 bits (67), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 14/66 (21%), Positives = 33/66 (50%), Gaps = 1/66 (1%)

Query: 400 LDIDWSKNNFVLTGSMDKTVKLWHCD-RKQLLKNFPHPDFVTCVKFHPNDDRFFISGCLD 458
           +DI+W   + ++   ++ ++ ++  D  K + K   H   ++C++F+ N      S   D
Sbjct: 332 VDIEWVDKDKLVVPGVNGSILVYSIDDNKPIGKLLGHQGTISCIEFNVNSRLLLTSSDSD 391

Query: 459 HKARLW 464
           +  R+W
Sbjct: 392 YSIRIW 397

>AER255C [2757] [Homologous to ScYDR364C (CDC40) - SH]
           (1107932..1109335) [1404 bp, 467 aa]
          Length = 467

 Score = 38.1 bits (87), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 24/90 (26%), Positives = 38/90 (42%), Gaps = 1/90 (1%)

Query: 374 DESLNLYAPVFHPLPYRSFLGHNQDILDIDWSKNNFVL-TGSMDKTVKLWHCDRKQLLKN 432
           D  L ++      L  R + GH + I    +S +N    + S DKTVK+W  +   ++  
Sbjct: 196 DGVLKIWDMYHERLLLRDYCGHRKAISATSFSHDNVQFASSSYDKTVKIWDTETGDIINR 255

Query: 433 FPHPDFVTCVKFHPNDDRFFISGCLDHKAR 462
                   C+ FHP +    + G  D K R
Sbjct: 256 LSFKATPNCMTFHPQNKEQLLVGFSDSKIR 285

>ABL044C [548] [Homologous to ScYMR093W - SH] (312378..313934) [1557
           bp, 518 aa]
          Length = 518

 Score = 38.1 bits (87), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 47/206 (22%), Positives = 78/206 (37%), Gaps = 25/206 (12%)

Query: 430 LKNFPHPDFVTCVKFHPNDDRFFISGCLDHKARLWSILDD-EVSFE-FDCGDLITSLEVS 487
           +K   HP  VT  KFHP D +  ++   D   R+W I    E + E     D + S+   
Sbjct: 120 IKASTHPAHVT--KFHPLDKQTLVTATDDRVVRVWDISHAYEPTLELLGASDYVRSVCFV 177

Query: 488 PGDSKYTILGTFNGYV------------IVLLTRGL--EHVYSFHLSDKQDKKGKDVTTR 533
           PG     + G ++G V            +  L  G+  E + +   +      G      
Sbjct: 178 PGAPHMVVSGCYDGVVRLHDTRTRSAQPVTQLNHGMSVEDIVAISPTQLVSCGGSKFKVW 237

Query: 534 DLPTSRTNTHHGPKVTGIECFRAVN-----DMTLKLLVTSNDSKIRVFNLKDNILQEVLK 588
           DL  ++     G     + C   VN      M   LL +S D  ++VF+  D     V  
Sbjct: 238 DLTGNKLLHERGNFAKTVTCLDYVNMPDGGAMNSCLLASSLDGHVKVFDPLDGY--RVKF 295

Query: 589 GFENESSQISAHLITGSKNKQQFVIA 614
           G++  S+ +S  +  G     + ++A
Sbjct: 296 GWKFSSAVLSCAISPGDAQGNKHLVA 321

>Scas_720.83d
          Length = 915

 Score = 38.5 bits (88), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 22/78 (28%), Positives = 40/78 (51%), Gaps = 8/78 (10%)

Query: 380 YAPVFHPLPYRSFLGHNQDILDIDWSKNN-FVLTGSMDKTVKLWHCDRKQ----LLKNFP 434
           +AP    + YR   GH QDIL + WS ++ F+++ S D T ++W  D ++     +    
Sbjct: 133 FAPF---VRYRVHAGHFQDILSLTWSLDSRFIISTSKDLTARIWSIDSEEKDLASMTFAG 189

Query: 435 HPDFVTCVKFHPNDDRFF 452
           H D+V    F  + ++ +
Sbjct: 190 HRDYVMGAFFSADQEKIY 207

>Kwal_23.5035
          Length = 744

 Score = 38.5 bits (88), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 17/75 (22%), Positives = 37/75 (49%), Gaps = 2/75 (2%)

Query: 394 GHNQDILDIDWSKNNFVLTGSMDKTVKLWHCDRKQLLKNFP-HPDFVTCVKF-HPNDDRF 451
           GH+  +  + +  +  +++GS D++V++W+    +    F  H   V C+     N  +F
Sbjct: 408 GHDGGVWALKYGHDGILVSGSTDRSVRVWNIKSGKCTHVFKGHTSTVRCLDIVEHNGKKF 467

Query: 452 FISGCLDHKARLWSI 466
            ++G  DH   +W +
Sbjct: 468 IVTGSRDHTLHVWKL 482

 Score = 36.2 bits (82), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 21/81 (25%), Positives = 42/81 (51%), Gaps = 4/81 (4%)

Query: 388 PYRSFL-GHNQDILDIDWSKNNFVLTGSMDKTVKLWHCDRKQLLKNFP-HPDFVTCVKFH 445
           P+R+ L GH   I+     ++++V+TG+ DK ++++    ++ +     H   V  +K+ 
Sbjct: 360 PHRTTLRGHTMKIVTCLQFEDDYVITGADDKMIRVYDAKTEKFITQLSGHDGGVWALKY- 418

Query: 446 PNDDRFFISGCLDHKARLWSI 466
              D   +SG  D   R+W+I
Sbjct: 419 -GHDGILVSGSTDRSVRVWNI 438

 Score = 34.7 bits (78), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 32/63 (50%), Gaps = 4/63 (6%)

Query: 564 LLVTSNDSKIRVFNLKDNILQEVLKGFENESSQISAHLITGSKNKQQFVIAPSEDHWIYC 623
           L+  S D  +RV+N+K      V KG    +S +    I    N ++F++  S DH ++ 
Sbjct: 424 LVSGSTDRSVRVWNIKSGKCTHVFKG---HTSTVRCLDIV-EHNGKKFIVTGSRDHTLHV 479

Query: 624 WKL 626
           WKL
Sbjct: 480 WKL 482

>KLLA0C08547g 749737..751284 highly similar to sp|P25382
           Saccharomyces cerevisiae YCR072c, start by similarity
          Length = 515

 Score = 38.1 bits (87), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 22/77 (28%), Positives = 38/77 (49%), Gaps = 4/77 (5%)

Query: 391 SFLGHNQDILDIDWSKN--NFVLTGSMDKTVKLWHCDRKQLLKNFP-HPDFVTCVKFHPN 447
           +  GH   IL   ++ N  + ++TG+ D T  +W CD +  +     H ++V C  + P 
Sbjct: 138 AIAGHGSTILCSAFAPNTSSRMVTGAGDNTACIWDCDTQTRMCTLQGHHNWVLCCSWSP- 196

Query: 448 DDRFFISGCLDHKARLW 464
           D     +G +D+  RLW
Sbjct: 197 DGELIATGSMDNTIRLW 213

 Score = 33.5 bits (75), Expect = 0.90,   Method: Compositional matrix adjust.
 Identities = 27/89 (30%), Positives = 37/89 (41%), Gaps = 12/89 (13%)

Query: 388 PYRSFL-GHNQDILDIDWSKNNFV--------LTGSMDKTVKLWHCDRKQ-LLKNFPHPD 437
           PY   L GH++ I  + W   + V         T S D T+K+W   R+  LL    H  
Sbjct: 220 PYGDALRGHSKWITSLSWEPIHLVKPGDKPRLATASKDGTIKIWDTTRRVCLLTLCGHTS 279

Query: 438 FVTCVKFHPNDDRFFISGCLDHKARLWSI 466
            V+CVK+         SG  D   R W +
Sbjct: 280 SVSCVKW--GGKNVLYSGSHDKTIRCWDM 306

 Score = 32.7 bits (73), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 16/59 (27%), Positives = 30/59 (50%), Gaps = 3/59 (5%)

Query: 391 SFLGHNQDILDIDWSKNN-FVLTGSMDKTVKLWHCDRKQLLKNF--PHPDFVTCVKFHP 446
           +  GH+  +L   WS +   + TGSMD T++LW   + +   +    H  ++T + + P
Sbjct: 181 TLQGHHNWVLCCSWSPDGELIATGSMDNTIRLWESSKGKPYGDALRGHSKWITSLSWEP 239

>CAGL0G04345g 408842..410977 similar to sp|P47025 Saccharomyces
           cerevisiae YJL112w MDV1, hypothetical start
          Length = 711

 Score = 38.1 bits (87), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 23/70 (32%), Positives = 36/70 (51%), Gaps = 8/70 (11%)

Query: 410 VLTGSMDKTVKLWHCDRKQLLKNFP-HPDFVTCVKFHPNDDRFFISGCLDHKARLWSI-- 466
           + TG+ D  ++LW     ++++    H D +T +KF   D    ISG LD   RLW +  
Sbjct: 577 LATGTKDGLIRLWDMRTGEVVRVLEGHMDAITSLKF---DATTIISGSLDGTIRLWDLRS 633

Query: 467 --LDDEVSFE 474
             L D +S+E
Sbjct: 634 NNLTDIISYE 643

 Score = 32.7 bits (73), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 11/31 (35%), Positives = 17/31 (54%)

Query: 434 PHPDFVTCVKFHPNDDRFFISGCLDHKARLW 464
            H D +TC+ F P+      +G +DH  +LW
Sbjct: 402 AHDDAITCLDFDPHFSTLCTAGYMDHIVKLW 432

>YPR178W (PRP4) [5592] chr16 (892326..893723) U4/U6 snRNA-associated
           splicing factor, member of WD (WD-40) repeat family
           [1398 bp, 465 aa]
          Length = 465

 Score = 38.1 bits (87), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 33/135 (24%), Positives = 62/135 (45%), Gaps = 26/135 (19%)

Query: 289 MKFSKDGRFLATGGKDRILRIWKVIASPTERLELDSSTMKPSKTVCMLNGKLISYSRDVP 348
           + +S +G  +ATGG D I+ +W +      +L                  +++++   V 
Sbjct: 355 VAWSPNGYQVATGGGDGIINVWDIRKRDEGQLN-----------------QILAHRNIVT 397

Query: 349 QSGFARTENGDNPEDDSLDTNGMFPDESLNLYAPVFHPLPYRSFLGHNQDILDIDWSKNN 408
           Q  F++ + G       L + G   D  +N+Y+     L   S  GH   I+ +D S N+
Sbjct: 398 QVRFSKEDGGKK-----LVSCGY--DNLINVYSSDTW-LKMGSLAGHTDKIISLDISNNS 449

Query: 409 -FVLTGSMDKTVKLW 422
            F+++G  D+++KLW
Sbjct: 450 HFLVSGGWDRSIKLW 464

 Score = 36.2 bits (82), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 27/98 (27%), Positives = 43/98 (43%), Gaps = 6/98 (6%)

Query: 363 DDSLDTNGMFPDESLNLYAPVFHPLPYRSFLGHNQDILDIDWSKNNF-VLTGSMDKTVKL 421
           D SL  +G    +SL++   +       +  GH++ I  + WS N + V TG  D  + +
Sbjct: 318 DGSLVCSGGM--DSLSMLWDIRSGSKVMTLAGHSKPIYTVAWSPNGYQVATGGGDGIINV 375

Query: 422 WHC---DRKQLLKNFPHPDFVTCVKFHPNDDRFFISGC 456
           W     D  QL +   H + VT V+F   D    +  C
Sbjct: 376 WDIRKRDEGQLNQILAHRNIVTQVRFSKEDGGKKLVSC 413

>Sklu_2291.4 YPL183C, Contig c2291 6003-8996 reverse complement
          Length = 997

 Score = 38.1 bits (87), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 26/86 (30%), Positives = 43/86 (50%), Gaps = 3/86 (3%)

Query: 383 VFHPLPYRSFLGHNQDILDIDWSKNN-FVLTGSMDKTVKLWHCDRKQLLK-NFPHPDFVT 440
           +F      + LGH   I  +  SKN  +V++ S D+++KLW+    +LL   + H   + 
Sbjct: 168 LFSETKVHNLLGHEGSIFYVTLSKNGEYVVSCSDDRSIKLWNLKSGELLSTGWGHTARIW 227

Query: 441 CVKFHPNDDRFFISGCLDHKARLWSI 466
            +KF  ND +  +S   D   R+W I
Sbjct: 228 QLKFIDNDTK-VVSVSEDCTCRVWDI 252

>Kwal_23.6324
          Length = 514

 Score = 38.1 bits (87), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 26/82 (31%), Positives = 38/82 (46%), Gaps = 4/82 (4%)

Query: 410 VLTGSMDKTVKLWHCDRKQLLKNFP-HPDFVTCVKFHPNDDRFFISGCLDHKARLWSILD 468
           ++TGS D T ++W C+    +     H ++V CV + P D     +G +D+  RLW    
Sbjct: 158 MVTGSGDNTARIWDCNTNTPMYTLKGHFNWVLCVAWCP-DGELIATGSMDNTIRLWDSNK 216

Query: 469 DEVSFEFDCG--DLITSLEVSP 488
            E   E   G    ITSL   P
Sbjct: 217 GESYGEALRGHAKWITSLTWEP 238

 Score = 33.1 bits (74), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 16/62 (25%), Positives = 30/62 (48%), Gaps = 3/62 (4%)

Query: 388 PYRSFLGHNQDILDIDWSKNN-FVLTGSMDKTVKLWHCDRKQLLKNF--PHPDFVTCVKF 444
           P  +  GH   +L + W  +   + TGSMD T++LW  ++ +        H  ++T + +
Sbjct: 177 PMYTLKGHFNWVLCVAWCPDGELIATGSMDNTIRLWDSNKGESYGEALRGHAKWITSLTW 236

Query: 445 HP 446
            P
Sbjct: 237 EP 238

>Kwal_55.21144
          Length = 570

 Score = 38.1 bits (87), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 23/77 (29%), Positives = 39/77 (50%), Gaps = 5/77 (6%)

Query: 394 GHNQDILDIDWSKNN-FVLTGSMDKTVKLWHCDRKQLLKNFPHPDF---VTCVKFHPNDD 449
           GH  +IL +  S +  +V+TG  D+ + +W  +    +K  P  D    V  + F  N D
Sbjct: 231 GHYDEILTLAASPDGKYVITGGRDRKLIIWSTESLAPVKVIPTKDRRGEVLSLVFRKNSD 290

Query: 450 RFFISGCLDHKARLWSI 466
           + + + C D+K R +SI
Sbjct: 291 QLY-AACADYKIRTYSI 306

>YKR036C (CAF4) [3289] chr11 complement(508344..510323) Protein that
           associates with Ccr4p, contains WD (WD-40) repeats [1980
           bp, 659 aa]
          Length = 659

 Score = 38.1 bits (87), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 54/218 (24%), Positives = 88/218 (40%), Gaps = 36/218 (16%)

Query: 293 KDGRFLATGGKDRILRIWKVIASPTERLELDSSTMKPSK----TVCMLNGKLISYSRDVP 348
           K+   L TG KD  L++W +  S    + LD S +K       T C+ N +L  +  ++ 
Sbjct: 389 KNYNMLITGSKDATLKLWDLNLS--REIYLDHSPLKEKTEEIVTPCIHNFEL--HKDEIT 444

Query: 349 QSGFARTENGDNPEDDSLDTNGMFPDESLNLYAPVFHP------LPYRS------FLGHN 396
              F          D  +    +   + +     +F P      +P RS       LG  
Sbjct: 445 ALSFDSEALVSGSRDKKIFHWDLTTGKCIQQLDLIFTPTHSDIKMPARSLNNGACLLGTE 504

Query: 397 QDILDIDWSKNNFVLTGSMDKTVKLWHCDRKQLLKNFP-HPDFVTCVKFHPNDDRFFISG 455
             ++      N+ + TG+ D  V+LW     + ++    H D +T +KF   D    ++G
Sbjct: 505 APMIGALQCYNSALATGTKDGIVRLWDLRVGKPVRLLEGHTDGITSLKF---DSEKLVTG 561

Query: 456 CLDHKARLW-----SILDDEV------SFEFDCGDLIT 482
            +D+  R+W     SILD         S +FD G LIT
Sbjct: 562 SMDNSVRIWDLRTSSILDVIAYDLPVSSLDFD-GKLIT 598

>AEL269C [2236] [Homologous to ScYPR178W (PRP4) - SH]
           (134760..136127) [1368 bp, 455 aa]
          Length = 455

 Score = 37.7 bits (86), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 48/225 (21%), Positives = 87/225 (38%), Gaps = 35/225 (15%)

Query: 395 HNQDILDIDWSKN-NFVLTGSMDKTVKLWHCDRKQLLKNFPHPDFVTCVKFHPNDDRFFI 453
           H   I  +DW  + N +L+G  D  VKLW        +   H   V+ VK HP+  R   
Sbjct: 214 HEGKIGGLDWHPDGNHLLSGGGDNLVKLWDMTSNSFEELRGHAGRVSRVKVHPS-GRLAA 272

Query: 454 SGCLDHKARLWSILDDEVSFEFDCGDLITSLEVSPGDSKYTILGTFNGYVIVLLTRGLEH 513
           S   D    LW +            +    L++  G SK      F     +L + GL+ 
Sbjct: 273 SASFDLTWILWDL------------ERKVELQLQEGHSKAVYTIAFQSDGALLASAGLDA 320

Query: 514 VYSFHLSDKQDKKGKDVTTRDLPTSRTNTHHGPKVTGIECFRAVNDMTLKLLVTSNDSKI 573
           V +            D+ + + P  +   H G  ++G++     +    +L     D  +
Sbjct: 321 VCAIW----------DLRSGE-PIMKLEGHAGA-ISGVDW----SPNGYQLATAGADGTV 364

Query: 574 RVFNLKDNILQEVLKGFENESSQISAHLITGSKNKQQFVIAPSED 618
           RV+++++   +  L      + Q++A  +   KN   F+++   D
Sbjct: 365 RVWDIRNVGTESALL-----AHQVAALDVKFKKNNGTFLVSCGHD 404

 Score = 35.4 bits (80), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 38/184 (20%), Positives = 73/184 (39%), Gaps = 22/184 (11%)

Query: 289 MKFSKDGRFLATGGKDRILRIWKVIASPTERLELDSSTMKPSKTVCMLNGKLISYSR--- 345
           + +  DG  L +GG D ++++W + ++  E  EL     + S+     +G+L + +    
Sbjct: 221 LDWHPDGNHLLSGGGDNLVKLWDMTSNSFE--ELRGHAGRVSRVKVHPSGRLAASASFDL 278

Query: 346 -----DVPQSGFARTENGDNPEDDSL---DTNGMFPDESLNLYAPVF---HPLPYRSFLG 394
                D+ +    + + G +    ++       +     L+    ++      P     G
Sbjct: 279 TWILWDLERKVELQLQEGHSKAVYTIAFQSDGALLASAGLDAVCAIWDLRSGEPIMKLEG 338

Query: 395 HNQDILDIDWSKNNFVL-TGSMDKTVKLW---HCDRKQLLKNFPHPDFVTCVKFHPNDDR 450
           H   I  +DWS N + L T   D TV++W   +   +  L    H      VKF  N+  
Sbjct: 339 HAGAISGVDWSPNGYQLATAGADGTVRVWDIRNVGTESAL--LAHQVAALDVKFKKNNGT 396

Query: 451 FFIS 454
           F +S
Sbjct: 397 FLVS 400

>YCR057C (PWP2) [586] chr3 complement(220452..223223) Essential
           protein required for cell separation, has eight WD
           (WD-40) repeats, component of U3 snoRNP (also called
           small subunit processome), which is required for 18S
           rRNA biogenesis [2772 bp, 923 aa]
          Length = 923

 Score = 37.7 bits (86), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 24/80 (30%), Positives = 41/80 (51%), Gaps = 12/80 (15%)

Query: 380 YAPVFHPLPYRSFLGHNQDILDIDWSKNN-FVLTGSMDKTVKLWHCDRKQLLKNFP---- 434
           +AP    + +R   GH QDI  + WS+++ F+LT S D + K+W  D ++  KN      
Sbjct: 133 FAPF---VRHRVHAGHFQDITSLTWSQDSRFILTTSKDLSAKIWSVDSEE--KNLAATTF 187

Query: 435 --HPDFVTCVKFHPNDDRFF 452
             H D+V    F  + ++ +
Sbjct: 188 NGHRDYVMGAFFSHDQEKIY 207

>Scas_465.4
          Length = 1002

 Score = 37.7 bits (86), Expect = 0.055,   Method: Compositional matrix adjust.
 Identities = 58/242 (23%), Positives = 98/242 (40%), Gaps = 23/242 (9%)

Query: 379 LYAPVFHPLPYRSFLGHNQDILDIDWSKNN-FVLTGSMDKTVKLWHCDR-KQLLKNFPHP 436
           L   +F      + +GH   I     S N  ++ + S D+++KLW+    ++L   + H 
Sbjct: 162 LIWDLFLETKLYNLVGHEGSIFYATISDNGRYITSCSDDRSIKLWNLQTGEELCTGWGHT 221

Query: 437 DFVTCVKFHPNDDRFFISGCLDHKARLWSILDDEVSFEFDCGDLITSLEVSPGDSKYTIL 496
             +  +KF  ND +  IS   D+  R+W IL DE       G+  TSL +S     + I 
Sbjct: 222 ARIWNLKFFNNDTQL-ISVSEDNTCRVWDILQDE-------GNGNTSLTLSQIYEVHLIK 273

Query: 497 GTFNGYV----IVLLTRGLEHVYSFHLSDKQDKKGKDVTTRDLPTSRTNTHHGPKVTGIE 552
             +   +    +V +T G +      L+  QD K  +           +TH   K +  E
Sbjct: 274 NVWGVDIQEKDMVAVTSGNDG--RLKLTKIQDTKTMNAQEVSFSLEDISTHSVIKFSKGE 331

Query: 553 CFRAVNDMTLKLLVTSNDSKIRVFNLKDNILQEVLKGFENESSQISAH------LITGSK 606
             +        L+  ++  KI  +   DN+ + +L   EN  S    H      ++T S 
Sbjct: 332 IIKGFQKFEFGLIAITSLGKIIQYFECDNLWKLLLVS-ENLVSYSVTHGIMEHNIVTFSN 390

Query: 607 NK 608
           NK
Sbjct: 391 NK 392

>Scas_720.45
          Length = 755

 Score = 37.4 bits (85), Expect = 0.060,   Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 21/38 (55%)

Query: 441 CVKFHPNDDRFFISGCLDHKARLWSILDDEVSFEFDCG 478
           CV F+P D   F SGCLD   ++WS+     +F  + G
Sbjct: 2   CVAFNPKDPNTFASGCLDRTVKVWSLGQATPNFTLNSG 39

>KLLA0B02827g 254447..257275 similar to sp|Q06078 Saccharomyces
           cerevisiae YLR409c singleton, start by similarity
          Length = 942

 Score = 37.4 bits (85), Expect = 0.062,   Method: Compositional matrix adjust.
 Identities = 18/77 (23%), Positives = 35/77 (45%), Gaps = 1/77 (1%)

Query: 390 RSFLGHNQDILDIDWSKNN-FVLTGSMDKTVKLWHCDRKQLLKNFPHPDFVTCVKFHPND 448
           R   GH+  I   D+S +  ++++ S+D T++ W       +      + +T +KF PN 
Sbjct: 581 RQLWGHSNRISSFDFSPDGRWIVSSSLDSTIRTWDLPTGGCIDGMKVENVITNIKFSPNG 640

Query: 449 DRFFISGCLDHKARLWS 465
           D    +    +   LW+
Sbjct: 641 DLLATTSVSGNGISLWA 657

>Kwal_33.15591
          Length = 714

 Score = 37.4 bits (85), Expect = 0.063,   Method: Compositional matrix adjust.
 Identities = 29/78 (37%), Positives = 38/78 (48%), Gaps = 6/78 (7%)

Query: 390 RSFLGHNQDIL---DIDWSKNNFVLTGSMDKTVKLWHCDRKQLLKNFPHPDFVTCVKFHP 446
           ++F G + D++   DID S   F  + S D TVK+   + K L     H  FV  VKF P
Sbjct: 177 KTFTGLHTDVIRHIDIDASGEKFA-SCSNDGTVKINDMEGKTLKTLVGHESFVYSVKFAP 235

Query: 447 NDDRFFISGCLDHKARLW 464
           N D   IS   D   R+W
Sbjct: 236 NGD--VISCGEDRTVRIW 251

 Score = 32.7 bits (73), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 23/74 (31%), Positives = 36/74 (48%), Gaps = 5/74 (6%)

Query: 392 FLGHNQDILDIDWSKNNFVLTGSMDKTVKLW-HCDRKQLLKNFPHPDFVTCVKFHPNDDR 450
            +GH  ++  ++ S   +VL+GS D T K+W     K  LK   H   V  VK  P +  
Sbjct: 101 LIGHENNVCVLN-SSQGYVLSGSWDTTAKVWFQGALKHELKG--HTASVWDVKMLP-EVG 156

Query: 451 FFISGCLDHKARLW 464
           F+++   D   +LW
Sbjct: 157 FYMTASADGTIKLW 170

 Score = 31.6 bits (70), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 21/79 (26%), Positives = 41/79 (51%), Gaps = 8/79 (10%)

Query: 390 RSFLGHNQDILDIDWSKNNFVLTGSMDKTVKLWHCDR--KQLLKNFPHPDFVTC-VKFHP 446
           ++ +GH   +  + ++ N  V++   D+TV++W  D   KQ+++    P   T  +   P
Sbjct: 219 KTLVGHESFVYSVKFAPNGDVISCGEDRTVRIWKADGTVKQVIR---VPAVSTWDLDILP 275

Query: 447 NDDRFFISGCLDHKARLWS 465
           N D   + GC D  AR+++
Sbjct: 276 NGD--ILIGCSDSFARIFT 292

>YMR093W (UTP15) [4051] chr13 (454014..455555) Protein component of
           U3 snoRNP (renamed small subunit processome) which is
           required for 18S biogenesis, has WD (WD-40) repeats
           [1542 bp, 513 aa]
          Length = 513

 Score = 37.4 bits (85), Expect = 0.067,   Method: Compositional matrix adjust.
 Identities = 38/168 (22%), Positives = 64/168 (38%), Gaps = 22/168 (13%)

Query: 435 HPDFVTCVKFHPNDDRFFISGCLDHKARLWSILDD-EVSFEF-DCGDLITSLEVSPGDSK 492
           HP  VT  KFH  D++   +   D   RLW I +  E   E     D + +L   P    
Sbjct: 125 HPTHVT--KFHTQDNKILATASDDRVTRLWDISNAYEPQLELTGATDYVRTLSFIPAAPH 182

Query: 493 YTILGTFNGYVIVLLTRG--------------LEHVYSFHLSDKQDKKGKDVTTRDLPTS 538
               G+++G + +  TR               +E+V +   +      G +    DL ++
Sbjct: 183 LVATGSYDGLIRLYDTRSSGSTPIYSLNHDQPVENVIAVSPTQIVSCGGNNFKVWDLTSN 242

Query: 539 RTNTHHGPKVTGIECFRAVND----MTLKLLVTSNDSKIRVFNLKDNI 582
           +     G     + C   V +    M   L+ +S D  ++VF+  DN 
Sbjct: 243 KKLYERGNFNKAVTCLDYVENFDSPMQSALIASSLDGHVKVFDPLDNF 290

>CAGL0G09845g 940598..942100 similar to sp|P20053 Saccharomyces
           cerevisiae YPR178w PRP4 U4/U6 snRNP, hypothetical start
          Length = 500

 Score = 37.0 bits (84), Expect = 0.068,   Method: Compositional matrix adjust.
 Identities = 37/135 (27%), Positives = 60/135 (44%), Gaps = 29/135 (21%)

Query: 289 MKFSKDGRFLATGGKDRILRIWKVIASPTERLELDSSTMKPSKTVCMLNGKLISYSRDVP 348
           M +S DG  LATGG D ++ IW +    +++L                  K+  +   V 
Sbjct: 388 MDWSIDGHTLATGGGDGVITIWDL--RKSDKLT-----------------KITEHKSIVT 428

Query: 349 QSGFARTENGDNPEDDSLDTNGMFPDESLNLYAPVFHPLPYRSFLGHNQDILDIDWSKNN 408
              F      D   D +L ++G   D S+ +Y+   + L   S +GH   +L  D  KNN
Sbjct: 429 SLKF------DKANDHNLISSGY--DRSIFVYSKDNY-LKVSSLIGHADKVLTFDIDKNN 479

Query: 409 F-VLTGSMDKTVKLW 422
             +++G  D++VK W
Sbjct: 480 KNLISGGWDRSVKHW 494

 Score = 31.6 bits (70), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 27/59 (45%), Gaps = 2/59 (3%)

Query: 409 FVLTGSMDKTVKLWHCDR-KQLLKNFPHPDFVTCVKFHPNDDRFFISGCLDHKARLWSI 466
           F+ T S D T +LW  ++ KQLL    H   + C+ F   D     +   D  A +W +
Sbjct: 312 FIGTSSFDSTWRLWDIEKQKQLLLQEGHSKELYCLAFQA-DGALVSTAGTDKTAIIWDL 369

>YDR364C (CDC40) [1190] chr4 complement(1202831..1204198) Protein
           required for the second catalytic step of mRNA splicing,
           member of WD (WD-40) repeat family [1368 bp, 455 aa]
          Length = 455

 Score = 37.0 bits (84), Expect = 0.078,   Method: Compositional matrix adjust.
 Identities = 15/44 (34%), Positives = 25/44 (56%), Gaps = 1/44 (2%)

Query: 427 KQLLKNFP-HPDFVTCVKFHPNDDRFFISGCLDHKARLWSILDD 469
           K++++N+P HP+  T +KF P      +SG  DH  ++W    D
Sbjct: 152 KKVIRNYPGHPEGTTALKFLPKTGHLILSGGNDHTIKIWDFYHD 195

 Score = 34.3 bits (77), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 31/140 (22%), Positives = 58/140 (41%), Gaps = 10/140 (7%)

Query: 390 RSFLGHNQDILDIDW--SKNNFVLTGSMDKTVKLW-HCDRKQLLKNFP-HPDFVTCVKFH 445
           R++ GH +    + +     + +L+G  D T+K+W      + L++F  H   +  ++F 
Sbjct: 156 RNYPGHPEGTTALKFLPKTGHLILSGGNDHTIKIWDFYHDYECLRDFQGHNKPIKALRF- 214

Query: 446 PNDDRFFISGCLDHKARLWSILDDEVSFEFDCGDLITSLEVSPGDSKYTILGTFNGYVI- 504
             D + F+S   D   ++W     +V            +E  P +    I+G  N  ++ 
Sbjct: 215 TEDCQSFLSSSFDRSVKIWDTETGKVKTRLHLNSTPADVESRPTNPHEFIVGLSNSKILH 274

Query: 505 ----VLLTRGLEHVYSFHLS 520
               V   +GL   Y  HLS
Sbjct: 275 YDDRVSENQGLVQTYDHHLS 294

>Kwal_55.21450
          Length = 503

 Score = 37.0 bits (84), Expect = 0.078,   Method: Compositional matrix adjust.
 Identities = 41/160 (25%), Positives = 65/160 (40%), Gaps = 19/160 (11%)

Query: 373 PDESLNLYAP--VFHPLPYRSFLGH---NQDILDIDWSKNNFVLTGSMDKTVKLWHCDR- 426
           P+ S   Y P  + H  P     GH      IL +  S  +  L+   D  VK+W   R 
Sbjct: 190 PERSFRCYLPKKLIHTYP-----GHKNGTNSILLLPKS-GHLCLSAGNDNQVKIWDLYRD 243

Query: 427 KQLLKNF-PHPDFVTCVKFHPNDDRFFISGCLDHKARLWSILDDEVSFEFDCGDLITSLE 485
           ++LL+++  H   V  + F+     F +S   D + ++W     +V  ++    +    E
Sbjct: 244 RELLRDYRGHSKAVRGISFNSEGSEF-LSVSFDQQIKIWDTETGKVRHQYSYSCIPNCAE 302

Query: 486 VSPGDSKYTILGTFNGYVIVLLTR-----GLEHVYSFHLS 520
             P +S   I+G  N  +     R     GL  VY  HLS
Sbjct: 303 FRPSNSNEFIVGLSNSEIRHYDLRTSHKNGLVQVYDHHLS 342

>YPR137W (RRP9) [5555] chr16 (802353..804074) Protein component of
           U3 snoRNP (also called small subunit processome) which
           is required for 18S rRNA biogenesis, required for
           pre-rRNA processing [1722 bp, 573 aa]
          Length = 573

 Score = 37.0 bits (84), Expect = 0.089,   Method: Compositional matrix adjust.
 Identities = 24/77 (31%), Positives = 38/77 (49%), Gaps = 5/77 (6%)

Query: 394 GHNQDILDIDWSKNN-FVLTGSMDKTVKLWHCDRKQLLKNFPHPDF---VTCVKFHPNDD 449
           GH  +IL +  S +  +V+TG  D+ + +W  +    +K  P  D    V  + F  N D
Sbjct: 234 GHYDEILTVAASPDGKYVVTGGRDRKLIVWSTESLSPVKVIPTKDRRGEVLSLAFRKNSD 293

Query: 450 RFFISGCLDHKARLWSI 466
           + + S C D K R +SI
Sbjct: 294 QLYAS-CADFKIRTYSI 309

>CAGL0J03476g 331933..333486 highly similar to sp|P25382
           Saccharomyces cerevisiae YCR072c, start by similarity
          Length = 517

 Score = 36.6 bits (83), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 33/62 (53%), Gaps = 3/62 (4%)

Query: 388 PYRSFLGHNQDILDIDWSKNNFVL-TGSMDKTVKLWHCDRKQLLKNF--PHPDFVTCVKF 444
           P  +  GH   +L + WS +  V+ TGSMD T++LW  +  + L +    H  ++T + +
Sbjct: 180 PKVTLNGHRNWVLCVSWSADGEVIATGSMDNTIRLWDAESGKPLGDALRGHSKWITSLTW 239

Query: 445 HP 446
            P
Sbjct: 240 EP 241

 Score = 35.8 bits (81), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 28/56 (50%), Gaps = 2/56 (3%)

Query: 410 VLTGSMDKTVKLWHCDRKQLLKNF-PHPDFVTCVKFHPNDDRFFISGCLDHKARLW 464
           V+TG  D T ++W CD +        H ++V CV +   D     +G +D+  RLW
Sbjct: 161 VVTGGGDNTARIWDCDTQTPKVTLNGHRNWVLCVSWSA-DGEVIATGSMDNTIRLW 215

 Score = 35.4 bits (80), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 38/155 (24%), Positives = 57/155 (36%), Gaps = 33/155 (21%)

Query: 289 MKFSKDGRFLATGGKDRILRIWKVIASPTERLELDSSTMKPSKTVCMLNGKLISYSRDVP 348
           + +S DG  +ATG  D  +R+W            D+ + KP       + K I+     P
Sbjct: 194 VSWSADGEVIATGSMDNTIRLW------------DAESGKPLGDALRGHSKWITSLTWEP 241

Query: 349 QSGFARTENGDNPEDDSLDTNGMF--PDESLNLYAPVFHPLPYRSFLGHNQDILDIDWSK 406
                  E G  P   S   +G     D S  +           +  GH   +  + W  
Sbjct: 242 ---IHLVEPGSKPRLASASKDGTIRIWDSSRRVC--------LMTLGGHTNSVSCVKWGG 290

Query: 407 NNFVLTGSMDKTVKLWHCDRKQ------LLKNFPH 435
              + +GS DKTV+ W  D KQ      +LK+  H
Sbjct: 291 EGILYSGSHDKTVRAW--DMKQNGKCINILKSHAH 323

>Kwal_26.7736
          Length = 507

 Score = 36.6 bits (83), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 37/166 (22%), Positives = 60/166 (36%), Gaps = 21/166 (12%)

Query: 435 HPDFVTCVKFHPNDDRFFISGCLDHKARLWSILD-DEVSFEF-DCGDLITSLEVSPGDSK 492
           HP  V   KFHP D R  ++   D   R+W I    E   E     D + S+ + P    
Sbjct: 125 HPTHVA--KFHPADSRTLVTASDDRVVRVWDITQAQEPQVELTGASDYVRSVCMVPQAPH 182

Query: 493 YTILGTFNGYVIVLLTRG------------LEHVYSFHLSDKQDKKGKDVTTRDLPTSRT 540
             + G+++G V +  TR             +E V +   +      G      DL   R 
Sbjct: 183 LVVTGSYDGQVRLFDTRTNERATTLAQGMPVEDVIAVSATQLVSCGGPKFKVWDLTAQRP 242

Query: 541 NTHHGPKVTGIECFRAVN-----DMTLKLLVTSNDSKIRVFNLKDN 581
                     + C   V+      M+  L+ +S D  +++F+  D 
Sbjct: 243 LLERANFAKTVTCLNHVDLVEDSPMSSTLVASSLDGHVKIFDPLDG 288

>Kwal_56.23920
          Length = 937

 Score = 36.6 bits (83), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 36/127 (28%), Positives = 55/127 (43%), Gaps = 14/127 (11%)

Query: 389 YRSFLGHNQDILDIDW--SKNNFVLTGSMDKTVKLWHCDRKQLLKNFP-HPDFVTCVKFH 445
           +RS   HN  I+ + +    +NF  + S D  VK W  D+ + ++    H   V  +   
Sbjct: 602 HRSLFAHNDSIMKVVFVPESHNF-FSCSKDALVKYWDGDKFECIQKLAAHQKEVWTLAI- 659

Query: 446 PNDDRFFISGCLDHKARLWSILDDEV---------SFEFDCGDLITSLEVSPGDSKYTIL 496
            +D RF +S   D   R+WS  DD+V         S E     L+ SLE   GD  +   
Sbjct: 660 SSDGRFVVSASHDQSIRVWSETDDQVFLEEERERESDEQYEKTLLNSLENGAGDDMFEKD 719

Query: 497 GTFNGYV 503
           G  +G +
Sbjct: 720 GNGDGEI 726

 Score = 35.8 bits (81), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 36/78 (46%), Gaps = 3/78 (3%)

Query: 389 YRSFLGHNQDILDIDWS-KNNFVLTGSMDKTVKLWHCDRKQLLKN-FPHPDFVTCVKFHP 446
           + S  GH   +L ID S  +  ++T S DK +K+W  D     ++ F H D +  V F P
Sbjct: 560 FLSLYGHKLPVLSIDISFDSKLLITSSADKNIKIWGLDFGDCHRSLFAHNDSIMKVVFVP 619

Query: 447 NDDRFFISGCLDHKARLW 464
               FF S   D   + W
Sbjct: 620 ESHNFF-SCSKDALVKYW 636

 Score = 31.2 bits (69), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 19/65 (29%), Positives = 31/65 (47%), Gaps = 4/65 (6%)

Query: 382 PVFHPLPYRSFLGHNQDILDIDWSKNNFVLTGSMDKTVKLWHCDRKQLLKNFPHPDFVTC 441
           P  H +  R   GH  D+  ID S +N +L  + + T+K+W+      ++ F     + C
Sbjct: 374 PKLHSIDIR---GHRSDVRAIDISGDNKLLATASNGTLKIWNIKTNSCIRTFECGYALAC 430

Query: 442 VKFHP 446
            KF P
Sbjct: 431 -KFLP 434

>YBR103W (SIF2) [292] chr2 (447666..449273) Protein involved in
           telomere silencing, interacts with Sir4p and targets
           Sir4p from telomeres to other sites, component of Set3p
           complex, has WD (WD-40) repeats [1608 bp, 535 aa]
          Length = 535

 Score = 36.2 bits (82), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 15/39 (38%), Positives = 24/39 (61%)

Query: 392 FLGHNQDILDIDWSKNNFVLTGSMDKTVKLWHCDRKQLL 430
           F GH+Q I+   W  ++ V++ SMD +V+LW   +  LL
Sbjct: 397 FYGHSQSIVSASWVGDDKVISCSMDGSVRLWSLKQNTLL 435

>KLLA0E24508g complement(2175775..2176758) similar to sp|P38123
           Saccharomyces cerevisiae YBR175w, start by similarity
          Length = 327

 Score = 36.2 bits (82), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 22/76 (28%), Positives = 34/76 (44%), Gaps = 2/76 (2%)

Query: 390 RSFLGHNQDILDIDWS-KNNFVLTGSMDKTVKLWHCDRKQLLKNF-PHPDFVTCVKFHPN 447
           R  +GH   ++ I ++ K N + + SMD+++K WH      LK    H D V  +     
Sbjct: 104 RRLMGHTAPVISICYNNKGNILCSSSMDESIKEWHVLSGTALKTMSAHSDAVVSIDIPKF 163

Query: 448 DDRFFISGCLDHKARL 463
           D     SG  D   R+
Sbjct: 164 DSSILSSGSYDGLIRI 179

>Scas_581.3
          Length = 626

 Score = 36.2 bits (82), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 19/75 (25%), Positives = 36/75 (48%), Gaps = 3/75 (4%)

Query: 432 NFPHPDFVTCVKFHPNDDRFFISGCLDHKARLWSILDDEVSFEFDCGDLITSLEVSPGDS 491
           NF H   VT ++FHP +D    SG +D    LW   ++++    D  + + +++  P   
Sbjct: 488 NF-HSSDVTSLRFHPQNDDLLCSGSMDWNCHLWDTFNNDLIDSIDLKEDVIAVQWLPDRD 546

Query: 492 KY--TILGTFNGYVI 504
            Y   +L  +N  ++
Sbjct: 547 TYRCCVLTMYNFCIV 561

>Kwal_33.15475
          Length = 783

 Score = 36.6 bits (83), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 40/86 (46%), Gaps = 9/86 (10%)

Query: 387 LPYRSFLGHNQDILDIDWSKNNFVLTGSMDKTVKLW------HCDRKQLLKNFPHPDFVT 440
           LP   F+G N+     D++ +  +L  +  KT+ LW      H    + LK   H   VT
Sbjct: 3   LPEAVFIGANRQTQAGDYNCDREILAFAGGKTIALWKPLDPAHHGVYRTLKG--HNAEVT 60

Query: 441 CVKFHPNDDRFFISGCLDHKARLWSI 466
           CVKF P  +   +S   D + RLW+ 
Sbjct: 61  CVKFVPGTN-LMVSSSEDSQVRLWAF 85

>YPL126W (NAN1) [5319] chr16 (310209..312899) Nucleolar protein
           associated with Net1p, component of U3 snoRNP (also
           called small subunit processome), which is required for
           18S biogenesis [2691 bp, 896 aa]
          Length = 896

 Score = 36.2 bits (82), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 47/174 (27%), Positives = 75/174 (43%), Gaps = 35/174 (20%)

Query: 289 MKFSKDGRFLATGGKDRILRIWKVIASPTERLELDSSTMKPSKTVCMLNGKLISYSRDVP 348
           + FS DG +L +GG ++++ +W        +LE +S    P      LNG +I      P
Sbjct: 303 LSFSHDGSYLLSGGWEKVMSLW--------QLETNSQQFLPR-----LNGIIIDCQVLGP 349

Query: 349 QSGF-----ARTENGDNPEDDSLDTNGMFPDESLNLYAPVFHPLP-YRSFLGHNQDILDI 402
           Q  +       TEN  N +   L  N       L++      PLP + S + H Q  +  
Sbjct: 350 QGNYYSLILQMTENNSNSDYQFLLLNASDLTSKLSING----PLPVFNSTIKHIQQPISA 405

Query: 403 DWSKNNFVLTGSMDKTVKLWHCDRKQ---LLKNFPHPDFVTCVKFHP-NDDRFF 452
             +KN+  +T        L H  +KQ   L+K+    DF T V+ +P N + +F
Sbjct: 406 MNTKNSNSITS-------LNHSKKKQSRKLIKS-RRQDFTTNVEINPINKNLYF 451

>AAR102C [288] [Homologous to ScYPR137W (RRP9) - SH]
           (526057..527832) [1776 bp, 591 aa]
          Length = 591

 Score = 36.2 bits (82), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 23/77 (29%), Positives = 39/77 (50%), Gaps = 5/77 (6%)

Query: 394 GHNQDILDIDWSKNN-FVLTGSMDKTVKLWHCDRKQLLKNFPHPDF---VTCVKFHPNDD 449
           GH  +IL +  S +  +V+TG  DK + +W  +    +K  P  D    V  + F  N D
Sbjct: 253 GHYDEILTVAASPDGKYVVTGGRDKKLIVWSTESLAPVKVIPTKDRRGEVLGLAFRRNTD 312

Query: 450 RFFISGCLDHKARLWSI 466
           + + + C D+K R ++I
Sbjct: 313 QLY-AACADYKIRTFAI 328

>CAGL0J08998g 882655..886500 highly similar to sp|P38968
           Saccharomyces cerevisiae YDL195w SEC31 component of the
           COPII coat of ER-golgi vesicles, start by similarity
          Length = 1281

 Score = 36.2 bits (82), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 25/89 (28%), Positives = 40/89 (44%), Gaps = 10/89 (11%)

Query: 394 GHNQDILDIDWSKN--NFVLTGSMDKTVKLWHCDRKQLLKNF-PHPDFVTCVKFHPNDDR 450
           GH++ IL +DW +   N +L+ + D +V LW+    + L  +    ++    KF P    
Sbjct: 261 GHSKGILSLDWCQQDENLLLSSARDSSVMLWNPQSGEALTEYNTTGNWCFKSKFAPQAPD 320

Query: 451 FFISGCLDHK-------ARLWSILDDEVS 472
            F    LD K           + LD+EVS
Sbjct: 321 LFAFATLDGKKIEVQTLQNYETTLDEEVS 349

 Score = 33.9 bits (76), Expect = 0.78,   Method: Compositional matrix adjust.
 Identities = 28/104 (26%), Positives = 52/104 (50%), Gaps = 13/104 (12%)

Query: 401 DIDWSKNNFVLTGSMDK-TVKLWHCD-RKQLLK---NFP-HPDFVTCVKFHPNDDRFFIS 454
           D+DWS +N  + G+MD   V+++  +  KQ LK   +F  H   V  VKF+   +   +S
Sbjct: 67  DLDWSADNKYIAGAMDNGAVEIYEFNSSKQELKKQGSFKNHSTVVRTVKFNSKQNNVLLS 126

Query: 455 GCLDHKARLW---SILDDEVSFEFDCGDLITSLEVSPGDSKYTI 495
           G    +  +W    +LD + +++     L   + +SP D  +++
Sbjct: 127 GGNSQEIFIWDLNKLLDSKANYQ----PLTPGVSMSPIDEIHSL 166

>CAGL0M08646g 861488..862501 similar to tr|Q05583 Saccharomyces
           cerevisiae YDR267c, start by similarity
          Length = 337

 Score = 35.4 bits (80), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 42/194 (21%), Positives = 87/194 (44%), Gaps = 20/194 (10%)

Query: 395 HNQDILDIDW-SKNNFVLTGSMDKTVKLW--HCDRKQLLKNFP-HPDFVTCVKFHPNDDR 450
           H+QD+  + W +K+N + + S D TV++W  + D  +       H   + C  F   +D 
Sbjct: 156 HSQDVKHVVWHTKHNLLASSSYDDTVRIWKDYDDDWECAAVLTGHEGTIWCSDFSKEEDP 215

Query: 451 F-FISGCLDHKARLWSIL--DDEVSFEFDCGDLITSLEVSPGDSKYTILGTFNGYVIVLL 507
               SG  D   R+W  +  D++   E+ C    ++L  +     Y +  + +G +  + 
Sbjct: 216 IRLCSGSDDSTVRVWKYIGDDEDDQQEWVCE---STLPNAHRSQIYGVAWSPSGRIASVG 272

Query: 508 TRGLEHVYSFHLSDKQDKKGKDVTTRDLPTSRTNTHHGPKVTGIECFRAVNDMTLKLLVT 567
             G+  VY      K+ +   +V+  ++  +    H    V  I   + VN    ++L+T
Sbjct: 273 ADGVLAVY------KEKQNDSEVSEWEISATYKAAH---TVYEINTVKWVNIDGKEMLIT 323

Query: 568 S-NDSKIRVFNLKD 580
           + +D ++ ++N +D
Sbjct: 324 AGDDGRVNLWNYQD 337

 Score = 32.7 bits (73), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 45/195 (23%), Positives = 76/195 (38%), Gaps = 25/195 (12%)

Query: 308 RIWKVIASPTERLELDSSTMKPSKTVCMLNGK--LISYSRDVPQSGFARTENGDNPEDDS 365
           ++W +   P   L    ST +  K + + NGK  L+    D       R+     P  D 
Sbjct: 15  KVWSIDFEPVRGLLATGSTDRAIKVLQLKNGKENLLDVLDDTVHKKAVRSVAW-RPHSDL 73

Query: 366 L------DTNGMFPDESLNLYAPVFHPLPYRSFL-GHNQDILDIDWSKNNFVL-TGSMDK 417
           L       T  ++    L+L       +   + + GH  ++  I WS++  +L T S DK
Sbjct: 74  LAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGISWSQDGCLLATCSRDK 133

Query: 418 TVKLWHCDRK-------QLLKNFPHPDFVTCVKFHPNDDRFFISGCLDHKARLWSILDDE 470
           +V +W  D          +L+   H   V  V +H   +    S   D   R+W   DD 
Sbjct: 134 SVWIWETDEAGEEYECISVLQE--HSQDVKHVVWHTKHN-LLASSSYDDTVRIWKDYDD- 189

Query: 471 VSFEFDCGDLITSLE 485
              +++C  ++T  E
Sbjct: 190 ---DWECAAVLTGHE 201

>CAGL0K09284g 914937..917672 highly similar to sp|P25635
           Saccharomyces cerevisiae YCR057c PWP2 periodic
           tryptophan protein, start by similarity
          Length = 911

 Score = 35.8 bits (81), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 38/75 (50%), Gaps = 6/75 (8%)

Query: 384 FHPLP-YRSFLGHNQDILDIDWSKNN-FVLTGSMDKTVKLW--HCDRKQLLKN--FPHPD 437
           F P   YR   GH QDI    WS ++ F+LT S D T ++W  + + K+L+      H D
Sbjct: 133 FAPFVRYRVHAGHFQDITSFTWSHDSRFLLTTSKDLTSRVWSINSEDKELVATTLAGHRD 192

Query: 438 FVTCVKFHPNDDRFF 452
           +V    F+   ++ +
Sbjct: 193 YVLGAYFNSTQEKIY 207

>YNL035C (YNL035C) [4552] chr14 complement(568520..569689) Protein
           containing three WD domains (WD-40 repeats), which may
           mediate protein-protein interactions, has moderate
           similarity to uncharacterized C. albicans Orf6.3370p
           [1170 bp, 389 aa]
          Length = 389

 Score = 35.4 bits (80), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 28/52 (53%), Gaps = 2/52 (3%)

Query: 419 VKLWHCDRKQLLKNFPHPDFVTCVKFHPNDDRFFISGCLDHKARLWSILDDE 470
           ++ W    + L+ +  H D VTC+KFHP+D    +SG  D    ++ +  DE
Sbjct: 133 IRKWDTPLRSLIDS--HHDDVTCIKFHPSDVNILLSGSTDGYTNIYDLKQDE 182

>YKL213C (DOA1) [3062] chr11 complement(31961..34108) Protein
           required in ubiquitin proteolysis and found complexed
           with Cdc48p, has WD (WD-40) repeats [2148 bp, 715 aa]
          Length = 715

 Score = 35.8 bits (81), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 31/118 (26%), Positives = 42/118 (35%), Gaps = 51/118 (43%)

Query: 394 GHNQDILD---IDWSKNNFVLTGSMDKTVKLWHCDRKQLLKNFP---------------- 434
            HN  + D   + +S+N F LT S DKT+KLW  D+  ++K F                 
Sbjct: 135 AHNASVWDAKVVSFSENKF-LTASADKTIKLWQNDK--VIKTFSGIHNDVVRHLAVVDDG 191

Query: 435 ---------------------------HPDFVTCVKFHPNDDRFFISGCLDHKARLWS 465
                                      H  FV C+K  PN D   +S   D   R+WS
Sbjct: 192 HFISCSNDGLIKLVDMHTGDVLRTYEGHESFVYCIKLLPNGD--IVSCGEDRTVRIWS 247

 Score = 32.0 bits (71), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 20/78 (25%), Positives = 36/78 (46%), Gaps = 4/78 (5%)

Query: 388 PYRSFLGHNQDILDIDWSKNNFVLTGSMDKTVKLWHCDRKQLLKNF-PHPDFVTCVKFHP 446
           P  + +GH  ++  + + ++  V++GS DKT K+W      L+ N   H   V   K   
Sbjct: 91  PLYTLIGHQGNVCSLSF-QDGVVISGSWDKTAKVWK--EGSLVYNLQAHNASVWDAKVVS 147

Query: 447 NDDRFFISGCLDHKARLW 464
             +  F++   D   +LW
Sbjct: 148 FSENKFLTASADKTIKLW 165

>YPL151C (PRP46) [5296] chr16 complement(266179..267534) Putative
           spliceosomal protein with similarity to S. pombe prp5p,
           has four WD (WD-40) repeats [1356 bp, 451 aa]
          Length = 451

 Score = 35.4 bits (80), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 22/78 (28%), Positives = 40/78 (51%), Gaps = 3/78 (3%)

Query: 391 SFLGHNQDILDIDWS-KNNFVLTGSMDKTVKLWHCDRKQLLKN-FPHPDFVTCVKFHPND 448
           +  GH   + D+  S ++ ++ + S DKTVK W  ++ Q++++ + H   V  V  HP  
Sbjct: 177 TLAGHVMTVRDVAVSDRHPYLFSVSEDKTVKCWDLEKNQIIRDYYGHLSGVRTVSIHPTL 236

Query: 449 DRFFISGCLDHKARLWSI 466
           D    +G  D   +LW +
Sbjct: 237 DLIATAG-RDSVIKLWDM 253

 Score = 33.1 bits (74), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 37/177 (20%), Positives = 67/177 (37%), Gaps = 30/177 (16%)

Query: 422 WHCDRKQLLKNFPHPDFVTCVKFHPNDDRFFISGCLDHKARLWSILDDEVSFEFDCGDLI 481
           WH   K       H  +V CV   P D+ +FI+G  D   ++W +   ++      G ++
Sbjct: 125 WHAPWKLSRVINGHLGWVRCVAIDPVDNEWFITGSNDTTMKVWDLATGKLKTTL-AGHVM 183

Query: 482 TSLEVSPGDSKYTILGTFNGYVIVLLTRGLEHVYSFHLSDKQDKKGKDVTTRDLPTSRTN 541
           T  +V+  D                      H Y F +S+ +  K  D+    +      
Sbjct: 184 TVRDVAVSD---------------------RHPYLFSVSEDKTVKCWDLEKNQIIRDYYG 222

Query: 542 THHGPKVTGIECFRAVNDMTLKLLVTSN-DSKIRVFNLKDNILQEVLKGFENESSQI 597
              G +   I         TL L+ T+  DS I++++++  I    L G +   +Q+
Sbjct: 223 HLSGVRTVSIHP-------TLDLIATAGRDSVIKLWDMRTRIPVITLVGHKGPINQV 272

>Kwal_47.17465
          Length = 800

 Score = 35.4 bits (80), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 14/23 (60%), Positives = 18/23 (78%)

Query: 289 MKFSKDGRFLATGGKDRILRIWK 311
           ++FS DG FLA+G  DRIL IW+
Sbjct: 28  VRFSPDGNFLASGSDDRILLIWE 50

>Kwal_56.23035
          Length = 424

 Score = 35.4 bits (80), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 16/52 (30%), Positives = 27/52 (51%)

Query: 435 HPDFVTCVKFHPNDDRFFISGCLDHKARLWSILDDEVSFEFDCGDLITSLEV 486
           H   +T V+++  D+  F +G  DHK ++W     EV+   D G  +  L+V
Sbjct: 141 HAFSITSVQWYGADNGLFFTGSNDHKVKVWDTNAFEVASTIDVGHRVVQLDV 192

>YDR142C (PEX7) [987] chr4 complement(740467..741594) Peroxisomal
           biogenesis protein (peroxin) that serves as import
           receptor for proteins containing peroxisomal targeting
           signal 2 (PTS2), member of WD (WD-40) repeat family
           [1128 bp, 375 aa]
          Length = 375

 Score = 35.0 bits (79), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 35/71 (49%), Gaps = 5/71 (7%)

Query: 374 DESLNLYAPVFHPLPYRSFLGHNQDILDIDWS---KNNFVLTGSMDKTVKLWHCDRKQLL 430
           D +L L+   F   P   F  H +++   +W+   + NF L+ S D ++K+W   RKQ L
Sbjct: 82  DGTLRLFDTTFKEFPIAIFKEHEREVFSCNWNLVNRQNF-LSSSWDGSIKIWSPLRKQSL 140

Query: 431 KNF-PHPDFVT 440
               P P  +T
Sbjct: 141 MTLTPRPLEIT 151

>Scas_631.17
          Length = 474

 Score = 35.0 bits (79), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 58/239 (24%), Positives = 99/239 (41%), Gaps = 40/239 (16%)

Query: 391 SFLGHNQDILDIDWS-KNNFVLTGSMDKTVKLWHCDRKQLLK-NFPHPDFVTCVKFHPND 448
           +  GH   ++++D+     FV + S D T +LW  + +  L+    H   V  + F  ND
Sbjct: 270 ALQGHTGRVVNVDFHPSGRFVASASFDMTWRLWDIESETELQFQEGHGKEVYSLSFQ-ND 328

Query: 449 DRFFISGCLDHKARLWSILDDEVSFEFDCGDLITSLEVSPGDSK--YTILGTFNGYVIVL 506
                SG LD+ A +W +           G  I +L+   G +K  Y++  + +GY I  
Sbjct: 329 GALLCSGGLDNAAIVWDV---------RTGKSIMNLQ---GHAKPIYSVDWSPDGYHIA- 375

Query: 507 LTRGLEHVYSFHLSDKQDKKGKDVTTRDLPTSRTNTHHGPKVTGIECFRAVNDMTLKLLV 566
            T G + V +       D +    TTR L        H   VTG+   ++       L+ 
Sbjct: 376 -TGGGDGVINI-----WDIRKTTETTRLLA-------HNNIVTGVRFQKSTGHC---LVS 419

Query: 567 TSNDSKIRVFNLKDNILQEVLKGFENESSQISAHLITGSKNKQQFVIAPSEDHWIYCWK 625
              D +IR+++  DN +Q  +K  E  + +I   L        Q +++   D  +  WK
Sbjct: 420 CGYDKQIRIYS-SDNWIQ--VKTLEGHTDKI---LDVDISEDAQLIVSSGWDRSLKLWK 472

>YGL004C (RPN14) [1968] chr7 complement(490705..491958) Protein
           containing three WD domains (WD-40 repeat), which may
           mediate protein-protein interactions, has a region of
           weak similarity to a region of S. pombe Cwf1p, which is
           a putative spliceosomal subunit and component of a 40S
           snRNP-containing complex [1254 bp, 417 aa]
          Length = 417

 Score = 35.0 bits (79), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 23/69 (33%), Positives = 32/69 (46%), Gaps = 11/69 (15%)

Query: 390 RSFLGHNQ---DILDIDWSKNNFVLTGSMDKTVKLWHCDRKQLLKNF-----PHPDFVTC 441
           R+ +GH     DI  ID  +N  VL+ S+D T++LW C     +  F     PH D V  
Sbjct: 172 RTLIGHRATVTDIAIIDRGRN--VLSASLDGTIRLWECGTGTTIHTFNRKENPH-DGVNS 228

Query: 442 VKFHPNDDR 450
           +      DR
Sbjct: 229 IALFVGTDR 237

>YOR269W (PAC1) [5055] chr15 (826382..827866) Protein required in
           the absence of Cin8p, contains WD (WD-40) repeats [1485
           bp, 494 aa]
          Length = 494

 Score = 34.7 bits (78), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 27/78 (34%), Positives = 37/78 (47%), Gaps = 7/78 (8%)

Query: 390 RSFLGHNQDILDID-WSKNN--FVLTGSMDKTVKLWHCDRKQLLKNF-PHPDFVTCVKFH 445
           RS LGH   +  +  W KNN   + + S D+TVK+W       LK F PH  +V  +   
Sbjct: 247 RSLLGHEHIVSAVKIWQKNNDVHIASCSRDQTVKIWDFHNGWSLKTFQPHSQWVRSIDVL 306

Query: 446 PNDDRFFISGCLDHKARL 463
            +   + ISG  D   RL
Sbjct: 307 GD---YIISGSHDTTLRL 321

>YER107C (GLE2) [1539] chr5 complement(373444..374541) Nuclear pore
           protein required for poly(A)+ RNA export, has WD (WD-40)
           repeats, functions in the nuclear export of the small
           ribosomal subunit [1098 bp, 365 aa]
          Length = 365

 Score = 34.7 bits (78), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 19/65 (29%), Positives = 36/65 (55%), Gaps = 11/65 (16%)

Query: 290 KFSKDGRFLATGGKDRILRIWKVIASPTERLELDSSTMK--------PSKTVCMLNG--- 338
           ++S DG  +A+GG D  L+++ + +  T+++ + S+ +K        PS T C++ G   
Sbjct: 87  RWSNDGTKVASGGCDNALKLYDIASGQTQQIGMHSAPIKVLRFVQCGPSNTECIVTGSWD 146

Query: 339 KLISY 343
           K I Y
Sbjct: 147 KTIKY 151

>YGR200C (ELP2) [2150] chr7 complement(899907..902273) 90 kDa
           subunit of elongator and elongating RNA polymerase II
           holoenzyme, has WD (WD-40) repeats [2367 bp, 788 aa]
          Length = 788

 Score = 34.7 bits (78), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 25/85 (29%), Positives = 37/85 (43%), Gaps = 5/85 (5%)

Query: 388 PYRSFLGHNQDILDIDWSKNNFVLTGSMDKTVKLW---HCDRKQLLKNFP-HPDFVTCVK 443
           P   F+G N+     D  K   ++     KT+ LW     + K +      H   VTCV+
Sbjct: 7   PEAIFIGANKQTQVSDIHKVKKIVAFGAGKTIALWDPIEPNNKGVYATLKGHEAEVTCVR 66

Query: 444 FHPNDDRFFISGCLDHKARLWSILD 468
           F P+ D F +S   DH  ++W   D
Sbjct: 67  FVPDSD-FMVSASEDHHVKIWKFTD 90

 Score = 31.2 bits (69), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 26/59 (44%), Gaps = 8/59 (13%)

Query: 395 HNQDILDIDWSK---NNFVLTGSMDKTVKLWH-----CDRKQLLKNFPHPDFVTCVKFH 445
           H + I D DW+     N  +T S DKTVK+W       D   L  +  H   VT +  H
Sbjct: 652 HTRIIWDADWAPLEFGNVFVTASRDKTVKVWRHQKEPADDYVLEASIKHTKAVTAISIH 710

>Kwal_33.15136
          Length = 473

 Score = 34.7 bits (78), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 24/79 (30%), Positives = 42/79 (53%), Gaps = 10/79 (12%)

Query: 392 FLGHNQDILDIDWS-KNNFVLTGSMDKTVKLW---HCDRKQLL--KNFPHPDFVTCVKFH 445
           F  H   ++D+D+S   + ++TGS DKT++++   H   +++   K   H   V  VK+ 
Sbjct: 296 FKDHVSAVMDVDFSPTGDEIVTGSYDKTIRIYQVKHGHSREIYHTKRMQH---VFQVKY- 351

Query: 446 PNDDRFFISGCLDHKARLW 464
             D R+ +SG  D   R+W
Sbjct: 352 TMDSRYIVSGSDDGNVRMW 370

>CAGL0M02277g complement(271836..273119) highly similar to sp|Q12417
           Saccharomyces cerevisiae YPL151c PRP46 Pre-mRNA splicing
           factor PRP46, hypothetical start
          Length = 427

 Score = 34.3 bits (77), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 62/266 (23%), Positives = 100/266 (37%), Gaps = 49/266 (18%)

Query: 353 ARTENGDNPEDDSLDTNGMFPDES-----------LNLYAPVFHPLPY---RSFLGHNQD 398
           A   +  NP D  L  N  F DE            L    P +H  P+   R   GH+  
Sbjct: 59  ALVRHQQNPGDVGLVLNKKFADEQGHESVIERHDKLLNQTPRWHA-PWHLTRVIHGHHGW 117

Query: 399 I--LDIDWSKNNFVLTGSMDKTVKLWHCDRKQLLKNFPHPDFVTCVKFHPNDDRFFISGC 456
           +  + +D   N +  TGS DKT+K+W+    +L       D         N   +  S  
Sbjct: 118 VRCIAMDKVDNEWFATGSNDKTIKIWNLASGKLKVTLKAHDMTVRDLAISNRHPYMFSVS 177

Query: 457 LDHKARLWSILDDEVSFEFDCGDL--ITSLEVSPGDSKYTILGTFNGYVIVLLTRGLEHV 514
            D   + W  L+   +     G L  + ++++ P              V V++T G + V
Sbjct: 178 EDKTVKCWD-LEKNTAIRNYHGHLSGVHTVDIHP-------------TVDVVVTAGRDSV 223

Query: 515 YSFHLSDKQDKKGKDVTTRDLPTSRTNTHHGPKVTGIECFRAVNDMTLKLLVTSNDSKIR 574
                      K  D+ TR LP      H GP +T + C      +  +++ +S D+ IR
Sbjct: 224 V----------KVWDIRTR-LPVMTLPGHKGP-ITKVRCL----PVDPQVISSSVDASIR 267

Query: 575 VFNLKDNILQEVLKGFENESSQISAH 600
           +++L      +VL   +     IS H
Sbjct: 268 LWDLVAGKSMKVLTHHQRTVRDISVH 293

 Score = 30.8 bits (68), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 22/86 (25%), Positives = 40/86 (46%), Gaps = 12/86 (13%)

Query: 543 HHGPKVTGIECFRAVNDMTLKLLVT-SNDSKIRVFNLKDNILQEVLKGFENESSQISAHL 601
           HHG     + C  A++ +  +   T SND  I+++NL    L+  LK  +     ++   
Sbjct: 114 HHG----WVRCI-AMDKVDNEWFATGSNDKTIKIWNLASGKLKVTLKAHDMTVRDLAI-- 166

Query: 602 ITGSKNKQQFVIAPSEDHWIYCWKLQ 627
                N+  ++ + SED  + CW L+
Sbjct: 167 ----SNRHPYMFSVSEDKTVKCWDLE 188

>Sklu_1880.3 YDR364C, Contig c1880 4293-5708
          Length = 471

 Score = 34.3 bits (77), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 20/90 (22%), Positives = 41/90 (45%), Gaps = 1/90 (1%)

Query: 374 DESLNLYAPVFHPLPYRSFLGHNQDILDIDW-SKNNFVLTGSMDKTVKLWHCDRKQLLKN 432
           D  +N++         R + GH + + DI++ S     L+ S D+T+K+W  +  ++   
Sbjct: 200 DNVINIWDMYHERTLLRDYRGHRKAVRDINFNSDGTEFLSVSFDQTLKVWDTETGKVKSR 259

Query: 433 FPHPDFVTCVKFHPNDDRFFISGCLDHKAR 462
                   C  +HP ++  +I G  + + R
Sbjct: 260 LKWHSVPNCATYHPTNNNEYIVGLSNSEIR 289

>Sklu_1963.2 YBR175W, Contig c1963 4075-5019 reverse complement
          Length = 314

 Score = 33.9 bits (76), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 21/74 (28%), Positives = 34/74 (45%), Gaps = 2/74 (2%)

Query: 392 FLGHNQDILDIDW-SKNNFVLTGSMDKTVKLWHCDRKQLLKNF-PHPDFVTCVKFHPNDD 449
            +GH   +L + + SK N + + SMD+++K+W      LLK    H + V  +     D 
Sbjct: 93  LVGHTAPVLSLVYTSKGNLLCSASMDESIKIWDVLTGTLLKTISAHSEPVVSIDMPVCDP 152

Query: 450 RFFISGCLDHKARL 463
               SG  D   R+
Sbjct: 153 SILSSGSYDGLIRI 166

>CAGL0M09845g 975007..977817 highly similar to sp|Q06078
           Saccharomyces cerevisiae YLR409c, start by similarity
          Length = 936

 Score = 34.3 bits (77), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 17/77 (22%), Positives = 33/77 (42%), Gaps = 1/77 (1%)

Query: 390 RSFLGHNQDILDIDWSKNN-FVLTGSMDKTVKLWHCDRKQLLKNFPHPDFVTCVKFHPND 448
           R   GH   I   D+S +  ++++ S+D T++ W       +         T +KF PN 
Sbjct: 577 RQLWGHGNRITAFDFSPDGRWLVSASLDSTIRTWDLPTGSCIDGVKIESVATNLKFSPNG 636

Query: 449 DRFFISGCLDHKARLWS 465
           D    +  + +   +W+
Sbjct: 637 DMLATTHVIGNGIFIWT 653

>CAGL0C01441g complement(156930..159947) similar to tr|Q08924
           Saccharomyces cerevisiae YPL183c, start by similarity
          Length = 1005

 Score = 34.3 bits (77), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 25/83 (30%), Positives = 45/83 (54%), Gaps = 7/83 (8%)

Query: 394 GHNQDILDIDWSKNN-FVLTGSMDKTVKLWHCDR---KQLLKNFPHPDFVTCVKFHPNDD 449
           GH   I  I  S++N  + + S D++++LW  DR   K+L   + H   +  +KF  ND+
Sbjct: 177 GHEGSIFYIQSSEHNKLIASCSDDRSIRLW--DRETGKELSIGWSHTARIWNLKFFNNDE 234

Query: 450 RFFISGCLDHKARLWSILDDEVS 472
              +S   D   R+W+I+ +++S
Sbjct: 235 NL-VSVSEDCTCRVWNIIPNDIS 256

>KLLA0F15598g 1439610..1441046 highly similar to sp|P33750
           Saccharomyces cerevisiae YLL011w SOF1 involved in 18S
           pre-rRNA production singleton, start by similarity
          Length = 478

 Score = 33.9 bits (76), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 24/79 (30%), Positives = 42/79 (53%), Gaps = 10/79 (12%)

Query: 392 FLGHNQDILDIDWS-KNNFVLTGSMDKTVKLW---HCDRKQLL--KNFPHPDFVTCVKFH 445
           F  H   ++D+D+S   + V+TGS DKT++++   H   +++   K   H   +  VK+ 
Sbjct: 294 FKDHVSAVMDVDFSPTGDEVVTGSYDKTIRIYQVKHGHSREIYHTKRMQH---IFQVKY- 349

Query: 446 PNDDRFFISGCLDHKARLW 464
             D ++ +SG  D   RLW
Sbjct: 350 TMDSKYIVSGSDDGNVRLW 368

>YKL021C (MAK11) [3234] chr11 complement(396987..398393) Protein
           essential for replication of M double-stranded RNA
           (dsRNA) virus, member of the WD (WD-40) repeat family
           [1407 bp, 468 aa]
          Length = 468

 Score = 33.9 bits (76), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 27/114 (23%), Positives = 52/114 (45%), Gaps = 16/114 (14%)

Query: 372 FPDESLNLYAPVFHPLPYRSFLGHNQDILDIDWSKNNFVLTGSMDKTVKLWHCD-RKQLL 430
            P++  N  A   H +P   F  H+  I  +  S+  ++++GS D+ ++++    RK+L 
Sbjct: 82  IPNQKENDAAKTPHFMPIFHFQAHSLSIKCLAVSRR-YLVSGSNDEHIRIYDLQKRKELG 140

Query: 431 KNFPHPDFVTCVKF-HP-------------NDDRFFISGCLDHKARLWSILDDE 470
               H   +T ++F HP              + ++ +S   DHK  +W + D E
Sbjct: 141 TLLSHQGSITALQFSHPASSSEDAAVSKGSKNSKWLLSASEDHKIMVWRVKDWE 194

>Scas_601.2
          Length = 389

 Score = 33.9 bits (76), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 14/36 (38%), Positives = 21/36 (58%)

Query: 435 HPDFVTCVKFHPNDDRFFISGCLDHKARLWSILDDE 470
           H D VTC+K+HPND    +SG  D    ++ + + E
Sbjct: 150 HHDDVTCLKWHPNDPNILLSGSTDGYTNVYDLSEAE 185

>YLR409C (UTP21) [3786] chr12 complement(934411..937230) Member of
           the Utp21-specific WD40 associated domain containing
           family, contains seven WD domains (WD-40 repeat), which
           may mediate protein-protein interactions, has high
           similarity to uncharacterized C. albicans Orf6.6423p
           [2820 bp, 939 aa]
          Length = 939

 Score = 33.9 bits (76), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 18/77 (23%), Positives = 34/77 (44%), Gaps = 1/77 (1%)

Query: 390 RSFLGHNQDILDIDWS-KNNFVLTGSMDKTVKLWHCDRKQLLKNFPHPDFVTCVKFHPND 448
           R   GH+  I   D+S +  ++++ S+D T++ W       +      +  T VKF PN 
Sbjct: 579 RQLWGHSNRITAFDFSPEGRWIVSASLDSTIRTWDLPTGGCIDGIIVDNVATNVKFSPNG 638

Query: 449 DRFFISGCLDHKARLWS 465
           D    +    +   +W+
Sbjct: 639 DLLATTHVTGNGICIWT 655

>Scas_659.9
          Length = 475

 Score = 33.9 bits (76), Expect = 0.71,   Method: Compositional matrix adjust.
 Identities = 25/79 (31%), Positives = 42/79 (53%), Gaps = 10/79 (12%)

Query: 392 FLGHNQDILDIDWS-KNNFVLTGSMDKTVKLW---HCDRKQLL--KNFPHPDFVTCVKFH 445
           F  H   ++D+D+S   + ++TGS DKT++++   H   +++   K   H   V  VKF 
Sbjct: 295 FKDHVSAVMDVDFSPTGDEIVTGSYDKTIRIFNTTHGHSREIYHTKRMQH---VFQVKF- 350

Query: 446 PNDDRFFISGCLDHKARLW 464
             D ++ +SG  D   RLW
Sbjct: 351 SMDAKYIVSGSDDGNVRLW 369

 Score = 30.4 bits (67), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 22/82 (26%), Positives = 37/82 (45%), Gaps = 9/82 (10%)

Query: 394 GHNQDILDI--DWSKNNFVLTGSMDKTVKLWHCDRKQLLKNF-PHPDFVTCVKFHP---- 446
           GH   +  I  ++   N + TGS D  VK W+   ++ L +F  H   +T +   P    
Sbjct: 65  GHRDGVYVIAKNYKNLNKLATGSADGVVKYWNMSTREELCSFKAHYGLITGLCVTPEHLS 124

Query: 447 --NDDRFFISGCLDHKARLWSI 466
              ++ F +S   D   +LWS+
Sbjct: 125 KQKNENFMLSCSDDKTVKLWSV 146

>YJL112W (MDV1) [2803] chr10 (205222..207366) Protein involved in
           mitochondrial division and mitochondrial fission,
           contains WD (WD-40) repeats [2145 bp, 714 aa]
          Length = 714

 Score = 33.9 bits (76), Expect = 0.72,   Method: Compositional matrix adjust.
 Identities = 58/263 (22%), Positives = 102/263 (38%), Gaps = 55/263 (20%)

Query: 400 LDIDWSKNNFVLTGSMDKTVKLWHCDRKQLLKNFP-HPDFVTCVKFHPNDDRFFISGCLD 458
           LD D         G +D TVK+W   ++  +     H   + C++ +  D    ++G  D
Sbjct: 404 LDFDAPFGTLCTAGYLDHTVKIWDLSKQNKIGELAGHLATINCMQIN-RDYGTLVTGGRD 462

Query: 459 HKARLWSI-LDDEVSFEFDCGDLITSLEVSPGDSKYTILGTFNGYVIVLLTRGLEHVYSF 517
              +LW++ L  ++  E       T+   SP       + TF  +   +    L+   SF
Sbjct: 463 AALKLWNLNLAQQLYQETQNLTSPTNHIDSP------CVHTFEAHTDEVTALSLDP--SF 514

Query: 518 HLSDKQD--------KKGKDVTTRDLP-----TSRTNT-----------HHGPKVTGIEC 553
            +S  QD        + GK + T DL      T+ TN            +  P +  ++ 
Sbjct: 515 LVSGSQDRTIRQWDLRSGKCLQTIDLSFANVLTTSTNVDLSKSTLLTQRNERPSIGALQS 574

Query: 554 FRAVNDMTLKLLVTSNDSKIRVFNLKDNILQEVLKGFENESSQI---SAHLITGSKNKQQ 610
           F A       L   + D  +R+++L+   +   LKG  +  + +   SA L+TGS     
Sbjct: 575 FDAA------LATGTKDGVVRLWDLRSGKVIRTLKGHTDAITSLKFDSACLVTGSY---- 624

Query: 611 FVIAPSEDHWIYCWKLQSSLMTK 633
                  D  +  W L++ L+ K
Sbjct: 625 -------DRTVRIWDLRTGLLNK 640

 Score = 31.6 bits (70), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 11/32 (34%), Positives = 17/32 (53%)

Query: 435 HPDFVTCVKFHPNDDRFFISGCLDHKARLWSI 466
           H DF+TC+ F         +G LDH  ++W +
Sbjct: 397 HDDFLTCLDFDAPFGTLCTAGYLDHTVKIWDL 428

>Kwal_56.24163
          Length = 729

 Score = 33.9 bits (76), Expect = 0.79,   Method: Compositional matrix adjust.
 Identities = 12/25 (48%), Positives = 16/25 (64%)

Query: 442 VKFHPNDDRFFISGCLDHKARLWSI 466
           V F+P D   F S CLDH  ++WS+
Sbjct: 3   VAFNPKDPSTFASACLDHTVKIWSL 27

 Score = 33.5 bits (75), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 21/74 (28%), Positives = 37/74 (50%), Gaps = 2/74 (2%)

Query: 410 VLTGSMDKTVKLWHCDRKQLLKNF-PHPDFVTCVKFHPNDDRFFISGCLDHKARLWSILD 468
           +L+GS D T+K+W+ +  +L K      +   C+  HP   R +I+   D+   + S+ +
Sbjct: 100 ILSGSEDGTLKVWNSNTYKLEKTLNLGLERSWCIATHPTGKRNYIASGFDNGFTVLSLGN 159

Query: 469 DEVSFEFD-CGDLI 481
           DE     D  G L+
Sbjct: 160 DEPKLSLDPVGKLV 173

>YMR146C (TIF34) [4102] chr13 complement(557480..558523) Translation
           initiation factor eIF3, p39 subunit, contains two WD
           (WD-40) repeats [1044 bp, 347 aa]
          Length = 347

 Score = 33.5 bits (75), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 27/60 (45%), Gaps = 1/60 (1%)

Query: 394 GHNQDILDIDW-SKNNFVLTGSMDKTVKLWHCDRKQLLKNFPHPDFVTCVKFHPNDDRFF 452
           GH   I  ID      + +TGS D ++KLW     Q +  +  P  V  V+F P  + F 
Sbjct: 50  GHTGTIWSIDVDCFTKYCVTGSADYSIKLWDVSNGQCVATWKSPVPVKRVEFSPCGNYFL 109

>YLL011W (SOF1) [3408] chr12 (127522..128991) Protein component of
           U3 snoRNP (also called small subunit processome), which
           is required for 18S rRNA biogenesis, contains seven WD
           (WD-40) repeats [1470 bp, 489 aa]
          Length = 489

 Score = 33.5 bits (75), Expect = 0.86,   Method: Compositional matrix adjust.
 Identities = 24/79 (30%), Positives = 42/79 (53%), Gaps = 10/79 (12%)

Query: 392 FLGHNQDILDIDWS-KNNFVLTGSMDKTVKLW---HCDRKQLL--KNFPHPDFVTCVKFH 445
           F  H   ++D+D+S   + ++TGS DK+++++   H   +++   K   H   V  VK+ 
Sbjct: 301 FKDHVSAVMDVDFSPTGDEIVTGSYDKSIRIYKTNHGHSREIYHTKRMQH---VFQVKY- 356

Query: 446 PNDDRFFISGCLDHKARLW 464
             D ++ ISG  D   RLW
Sbjct: 357 SMDSKYIISGSDDGNVRLW 375

 Score = 30.8 bits (68), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 27/92 (29%), Positives = 40/92 (43%), Gaps = 13/92 (14%)

Query: 394 GHNQDILDI--DWSKNNFVLTGSMDKTVKLWHCDRKQLLKNF-PHPDFVT--CV---KFH 445
           GH   +  I  ++   N + TGS D  +K W+   ++   +F  H   VT  CV   +FH
Sbjct: 65  GHRDGVYAIAKNYGSLNKLATGSADGVIKYWNMSTREEFVSFKAHYGLVTGLCVTQPRFH 124

Query: 446 P-----NDDRFFISGCLDHKARLWSILDDEVS 472
                     F +S   D   +LWSI  D+ S
Sbjct: 125 DKKPDLKSQNFMLSCSDDKTVKLWSINVDDYS 156

>ACR137W [1184] [Homologous to ScYPL151C (PRP46) - SH]
           complement(590077..591354) [1278 bp, 425 aa]
          Length = 425

 Score = 33.5 bits (75), Expect = 0.87,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 38/76 (50%), Gaps = 5/76 (6%)

Query: 394 GHNQDILDIDWS-KNNFVLTGSMDKTVKLWHCDRKQLLKNFPHPDF--VTCVKFHPNDDR 450
           GH   + DI  S ++ ++ + S DK VK W  +R  ++++F H     V  V  HP+ D 
Sbjct: 154 GHIMTVRDICISARHPYMFSASQDKLVKCWDLERNTVVRDF-HGTLSGVHSVDLHPSLD- 211

Query: 451 FFISGCLDHKARLWSI 466
             +S   D   R+W I
Sbjct: 212 LIVSAGRDSVVRVWDI 227

 Score = 31.6 bits (70), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 18/67 (26%), Positives = 32/67 (47%), Gaps = 6/67 (8%)

Query: 568 SNDSKIRVFNLKDNILQEVLKGFENESSQISAHLITGSKNKQQFVIAPSEDHWIYCWKLQ 627
           SNDS IRV++L    L+  L+G       I          +  ++ + S+D  + CW L+
Sbjct: 133 SNDSTIRVWDLATGKLKVTLQGHIMTVRDICI------SARHPYMFSASQDKLVKCWDLE 186

Query: 628 SSLMTKD 634
            + + +D
Sbjct: 187 RNTVVRD 193

>CAGL0M06193g 643917..644867 similar to sp|P38123 Saccharomyces
           cerevisiae YBR175w, start by similarity
          Length = 316

 Score = 33.1 bits (74), Expect = 0.92,   Method: Compositional matrix adjust.
 Identities = 19/74 (25%), Positives = 35/74 (47%), Gaps = 2/74 (2%)

Query: 392 FLGHNQDILDIDWS-KNNFVLTGSMDKTVKLWHCDRKQLLKNF-PHPDFVTCVKFHPNDD 449
            +GH   ++ + ++ K N + T SMD+++K+W      ++K    H + V  +    ND 
Sbjct: 92  LVGHTAPVISLCYNNKGNLLFTSSMDESIKVWDVLTGTVMKTMSAHSEPVVSIDLSDNDG 151

Query: 450 RFFISGCLDHKARL 463
               SG  D   R+
Sbjct: 152 SILSSGSHDGLIRI 165

>ADL322C [1419] [Homologous to ScYBR103W (SIF2) - SH]
           (128830..130335) [1506 bp, 501 aa]
          Length = 501

 Score = 33.5 bits (75), Expect = 0.93,   Method: Compositional matrix adjust.
 Identities = 19/82 (23%), Positives = 39/82 (47%), Gaps = 6/82 (7%)

Query: 388 PYRSFLGHNQDILDIDWSKNNFVLTGSMDKTVKLWHCDRKQLLKNFP---HPDFVTCVKF 444
           P   F GH+Q I    W  ++ +++ SMD ++++W       + +      P+F   +  
Sbjct: 357 PSHVFYGHSQSITSAHWVDDDTIISTSMDGSIRVWSLASNSTVASATVDGVPNFTGALS- 415

Query: 445 HPNDDRFFISGCLDHKARLWSI 466
            P+  + F +G LD +  ++ I
Sbjct: 416 -PDQGK-FATGTLDGEVMVYDI 435

>Kwal_27.12239
          Length = 316

 Score = 33.1 bits (74), Expect = 0.94,   Method: Compositional matrix adjust.
 Identities = 19/74 (25%), Positives = 34/74 (45%), Gaps = 2/74 (2%)

Query: 392 FLGHNQDILDIDWS-KNNFVLTGSMDKTVKLWHCDRKQLLKNF-PHPDFVTCVKFHPNDD 449
            +GH   +  + ++ K N + + SMD+++K+W      LL+    H + V  +   P D 
Sbjct: 95  LVGHTAPVTSVKYTMKGNLLCSCSMDESIKIWDILSGTLLRTLSAHSEPVVSIDLPPFDP 154

Query: 450 RFFISGCLDHKARL 463
               SG  D   R+
Sbjct: 155 SILSSGSYDGLIRI 168

>Scas_442.2*
          Length = 795

 Score = 33.5 bits (75), Expect = 0.95,   Method: Compositional matrix adjust.
 Identities = 17/45 (37%), Positives = 25/45 (55%), Gaps = 3/45 (6%)

Query: 387 LPYRSFLGHNQDILDIDWSK---NNFVLTGSMDKTVKLWHCDRKQ 428
           L Y++   H + I D DW+     N  +TGS D+T+KLW  D  +
Sbjct: 654 LKYKTAKPHTRIIWDGDWAPLEFGNVFVTGSRDRTIKLWKFDENK 698

>Scas_652.16
          Length = 345

 Score = 33.1 bits (74), Expect = 1.00,   Method: Compositional matrix adjust.
 Identities = 15/41 (36%), Positives = 24/41 (58%), Gaps = 3/41 (7%)

Query: 391 SFLGHNQDILDIDWSKNNF---VLTGSMDKTVKLWHCDRKQ 428
           S+  H+  I+ +DW+   +   +++ S DKTVKLW  D  Q
Sbjct: 53  SWKAHDSSIVSVDWASPEYGRIIVSASYDKTVKLWEEDPDQ 93

>KLLA0C08976g 784536..787271 highly similar to sgd|S0000653
           Saccharomyces cerevisiae YCR057c PWP2 periodic
           tryptophan protein, start by similarity
          Length = 911

 Score = 33.5 bits (75), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 32/60 (53%), Gaps = 6/60 (10%)

Query: 380 YAPVFHPLPYRSFLGHNQDILDIDWSKNN-FVLTGSMDKTVKLWHCDRKQLLKNFPHPDF 438
           +AP    + YR   GH  DI  + WSK++ F+++ S D T ++W  + ++  KN     F
Sbjct: 133 FAPF---VRYRIHAGHFSDITSLTWSKDSRFIISTSKDLTARIWSVNSEE--KNLASTTF 187

>KLLA0E03982g 371642..372760 similar to sp|P39108 Saccharomyces
           cerevisiae YDR142c PAS7 peroxisomal import protein -
           peroxin singleton, start by similarity
          Length = 372

 Score = 33.1 bits (74), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 29/99 (29%), Positives = 44/99 (44%), Gaps = 16/99 (16%)

Query: 387 LPYRSFLGHNQ-DILDIDWSKN--NFVLTGSMDKTVKLW---HCDRKQLLKNFP------ 434
           LP   FLGH   + L  D++K   + + TG +DK +K+W    C RK L +         
Sbjct: 217 LPQHQFLGHGGFEALTCDFNKYRPHIIATGGVDKMIKVWDLRMC-RKMLSQGHQPININE 275

Query: 435 ---HPDFVTCVKFHPNDDRFFISGCLDHKARLWSILDDE 470
              H   V  V + P+     +S   D   R+W+ L D+
Sbjct: 276 IQGHELAVRKVTWSPHHSNMLLSTSYDMTCRVWTDLSDD 314

>AAL157C [30] [Homologous to ScYLL011W (SOF1) - SH] (70077..71516)
           [1440 bp, 479 aa]
          Length = 479

 Score = 33.1 bits (74), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 25/79 (31%), Positives = 38/79 (48%), Gaps = 10/79 (12%)

Query: 392 FLGHNQDILDIDWS-KNNFVLTGSMDKTVKLW-----HCDRKQLLKNFPHPDFVTCVKFH 445
           F  H   ++D+D+S     ++TGS DKT++++     H       K   H   V  VKF 
Sbjct: 298 FKDHVSAVMDVDFSPTGEEIVTGSYDKTIRIFNLKHGHSREVYHTKRMQH---VFQVKF- 353

Query: 446 PNDDRFFISGCLDHKARLW 464
             D ++ +SG  D   RLW
Sbjct: 354 TMDSKYIVSGSDDGNVRLW 372

>Scas_721.7
          Length = 325

 Score = 32.7 bits (73), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 20/75 (26%), Positives = 35/75 (46%), Gaps = 3/75 (4%)

Query: 392 FLGHNQDILDIDWS-KNNFVLTGSMDKTVKLWHCDRKQLLKNF-PHPDFVTCVKFHPN-D 448
            +GH   ++ + ++   N + T SMD+++K+W      +LK    H + V  +   P+ D
Sbjct: 94  LMGHTAPVISLTYNDSGNLLFTSSMDESIKIWDTFHGAILKTISAHSESVVSLSICPDRD 153

Query: 449 DRFFISGCLDHKARL 463
                SG  D   RL
Sbjct: 154 SSVLASGSFDGLIRL 168

>Sklu_1926.5 YBR103W, Contig c1926 4197-5726 reverse complement
          Length = 509

 Score = 33.1 bits (74), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 13/39 (33%), Positives = 23/39 (58%)

Query: 392 FLGHNQDILDIDWSKNNFVLTGSMDKTVKLWHCDRKQLL 430
           F GH Q I   DW  ++ +++ SMD +V++W   +  L+
Sbjct: 374 FYGHTQSITYADWLDDDRLISTSMDGSVRVWSVKQNALV 412

>Kwal_23.6240
          Length = 913

 Score = 33.1 bits (74), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 19/78 (24%), Positives = 40/78 (51%), Gaps = 8/78 (10%)

Query: 380 YAPVFHPLPYRSFLGHNQDILDIDWSKNN-FVLTGSMDKTVKLWHCDRKQ----LLKNFP 434
           +AP    + +R   GH  +I+ + WS+++ F+++ S D T ++W  D ++     +    
Sbjct: 133 FAPF---VRHRVHAGHFSNIISLTWSRDSRFLISTSKDLTARIWSLDSQEKGLASVTFAG 189

Query: 435 HPDFVTCVKFHPNDDRFF 452
           H D+V    F  + +R +
Sbjct: 190 HRDYVMGAFFSADQERIY 207

>CAGL0K11836g complement(1142213..1143781) similar to tr|Q12021
           Saccharomyces cerevisiae YDR030c RAD28, hypothetical
           start
          Length = 522

 Score = 33.1 bits (74), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 14/40 (35%), Positives = 22/40 (55%), Gaps = 4/40 (10%)

Query: 435 HPDFVTCVKFHPNDDRFFISGCLDHKARLWSILDDEVSFE 474
           H   +TC+ ++  D+  F++G  DH  +LW    D  SFE
Sbjct: 191 HTYGITCLAWYGPDNGIFLTGSNDHAVKLW----DTASFE 226

 Score = 32.7 bits (73), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 16/45 (35%), Positives = 22/45 (48%)

Query: 383 VFHPLPYRSFLGHNQDILDIDWSKNNFVLTGSMDKTVKLWHCDRK 427
           V+   P R+ L      L  D +  N +L+GS D +V LW  D K
Sbjct: 29  VYSHCPQRAHLSPGVSTLATDSTSGNLLLSGSYDGSVSLWSLDGK 73

>CAGL0L10890g 1163084..1164457 highly similar to sp|Q12024
           Saccharomyces cerevisiae YOR272w YTM1
           microtubule-interacting protein, start by similarity
          Length = 457

 Score = 32.7 bits (73), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 31/145 (21%), Positives = 60/145 (41%), Gaps = 19/145 (13%)

Query: 289 MKFSKDGRFLATGGKDRILRIWKVIASPTERLELDSSTMKPSKTVCMLNGKLISYSRDVP 348
           +  S D R + +G  D ++R W +     ++    +  +K  K +   N +++S   D  
Sbjct: 109 LDVSDDFRHIYSGSYDGVVRTWNMSGKVEKQYSGHTGAVKAVKYIS--NTRIVSAGNDRS 166

Query: 349 QSGFARTENGD----NPEDDSLDTNGMFPDESLNLYAPVFHPLPYRSFLGHNQDILDIDW 404
                +T+N D    N   D  D   +   ++L +              GH   ++ +D 
Sbjct: 167 LR-LWKTKNDDGSVSNNTGDENDEENIEDGKTLAILE------------GHKAPVVSLDV 213

Query: 405 SKNNFVLTGSMDKTVKLWHCDRKQL 429
           + N+ +L+ S D TV LW    K++
Sbjct: 214 ASNSRILSASYDNTVALWSTIYKEM 238

 Score = 30.8 bits (68), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 20/70 (28%), Positives = 30/70 (42%), Gaps = 2/70 (2%)

Query: 410 VLTGSMDKTVKLWHCDRKQLLKNFPHPDFVTCVKFHPNDDRFFISGCLDHKARLWSILDD 469
           + +GS D  V+ W+   K   +   H   V  VK+  N     +S   D   RLW   +D
Sbjct: 118 IYSGSYDGVVRTWNMSGKVEKQYSGHTGAVKAVKYISNTR--IVSAGNDRSLRLWKTKND 175

Query: 470 EVSFEFDCGD 479
           + S   + GD
Sbjct: 176 DGSVSNNTGD 185

>ADR264C [2005] [Homologous to ScYMR146C (TIF34) - SH]
           (1158218..1159258) [1041 bp, 346 aa]
          Length = 346

 Score = 32.7 bits (73), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 29/58 (50%), Gaps = 1/58 (1%)

Query: 394 GHNQDILDIDWSKNN-FVLTGSMDKTVKLWHCDRKQLLKNFPHPDFVTCVKFHPNDDR 450
           GHN  I  ID  ++  + +TGS D +VK+W      +  ++     V  V+F P  DR
Sbjct: 50  GHNGSIWSIDVDQHTEYAVTGSADFSVKVWRVRDGSIAHSWDTRTPVRRVEFSPTGDR 107

>Kwal_26.8975
          Length = 445

 Score = 32.7 bits (73), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 32/111 (28%), Positives = 50/111 (45%), Gaps = 12/111 (10%)

Query: 366 LDTNGMFPDESLNL-YAPVFHPLPY-RSFLGHNQD---ILDIDWSKNNFVLTGSMDKTVK 420
           L   G+  +  LN+ Y     P  Y +SF  +N+D    LD+   K   +++GS D  V+
Sbjct: 71  LTKKGLSSETCLNVEYTRAVLPPSYLKSF--NNEDWVSALDVGGDK---IVSGSYDGIVR 125

Query: 421 LWHCDRKQLLKNFPHPDFVTCVKFHPNDDRFFISGCLDHKARLWSILDDEV 471
            W+   K   +   H   V  VK+  +     +SG  D   RLW   +DE+
Sbjct: 126 TWNLSGKVEKQYAGHSGAVRAVKYISSTR--LVSGANDRTLRLWKTKNDEL 174

>Scas_705.2
          Length = 571

 Score = 32.7 bits (73), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 48/194 (24%), Positives = 80/194 (41%), Gaps = 30/194 (15%)

Query: 292 SKDGRFLATGGKDRILRIW--------KVIASPTERLELDSSTMKPSK---TVCMLNGKL 340
           S DG+++ TGG+DR L +W        KVI +   R E+ S   + +         + K+
Sbjct: 243 SPDGKYVVTGGRDRKLIVWSTESLAPIKVIPTKDRRGEVLSLVFRKNSDELYASCADYKI 302

Query: 341 ISYSRDVPQSGFARTENGDNPEDDSLDTNGMFPDESLNLYA----PVFHPLPYRSFL--- 393
            +YS  + Q  F++ E      D  +D + +  +  + + A     +   +P  + L   
Sbjct: 303 RTYS--IKQ--FSQLETLYGHHDIVVDISALSMERCVTVGARDRTAMLWKIPDETRLTFR 358

Query: 394 -GHNQDILDIDWSKNNFVLTGSMDKTVKLWHCDRKQLLKNFPHPDFVTCVKFHPNDDRFF 452
            G + + L   W KNN V  G  D  +K        L       D V+ +     DD  F
Sbjct: 359 GGDDPEKLLKRWLKNNAV--GQEDGELKYPDKSEAPLFFTEGSIDVVSMI-----DDSHF 411

Query: 453 ISGCLDHKARLWSI 466
           I+G  +    LWS+
Sbjct: 412 ITGSDNGNLSLWSL 425

>CAGL0J01265g complement(118375..119928) highly similar to sp|Q04305
           Saccharomyces cerevisiae YMR093w, start by similarity
          Length = 517

 Score = 32.7 bits (73), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 48/203 (23%), Positives = 78/203 (38%), Gaps = 37/203 (18%)

Query: 435 HPDFVTCVKFHPNDDRFFISGCLDHKARLWSILDD-EVSFEF-DCGDLITSLEVSPGDSK 492
           HP  VT  KFH +D +  +S   D   R+W I    E   E     D + +L   P    
Sbjct: 125 HPTHVT--KFHDHDLKTLVSASDDRVTRVWDISHAYEPQLELTGAADYVRTLCFVPAAPH 182

Query: 493 YTILGTFNGYVIVLLTRG-------------LEHVYSFHLSDKQDKKGKDVTTRDLPTSR 539
             + G+++G + +  TR              +E+V +   +      G +    DL +++
Sbjct: 183 LVVTGSYDGALRLYDTRAGSKPQHTLVHDQPVENVVAISPTQLVSCGGPNFKVWDLTSNK 242

Query: 540 TNTHHGPKVTGIECFRAVN---DMTL----KLLVTSNDSKIRVFNLKDNILQEVLKGFEN 592
                      + C   VN   D  L     LL +S D  ++VF+  DN   +V  G++ 
Sbjct: 243 KIFERANFNKTVTCLDYVNLPSDSGLASNSALLASSLDGHVKVFDPLDNF--QVKFGWKF 300

Query: 593 ES-----------SQISAHLITG 604
            S           +Q S HL+ G
Sbjct: 301 SSAVLSCAVSPSDAQGSRHLVAG 323

>Scas_558.3
          Length = 725

 Score = 32.7 bits (73), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 34/146 (23%), Positives = 61/146 (41%), Gaps = 9/146 (6%)

Query: 388 PYRSFLGHNQDILDIDWSKNNFVLTGSMDKTVKLWHCDRKQLLKNFPHPDFVTCVKFHPN 447
           P  + +GH+ ++  + +   + +++GS D T K+W     Q      H   V   K    
Sbjct: 94  PLYTLIGHHSNVCALSYKHMSAIISGSWDTTAKVWINGALQWSLE-GHQASVWDAKIISV 152

Query: 448 DDRFFISGCLDHKARLWSILDDEVSFEFDCGDLITSLEV-SPGDSKYTI-------LGTF 499
           ++  FI+   D   +LW       +F     D+I ++EV S G    T        +   
Sbjct: 153 EENTFITASADRTVKLWKENKLLKTFSGIHSDVIRNIEVLSSGKEIATCSNDGTIKISDL 212

Query: 500 NGYVIVLLTRGLEHVYSFHLSDKQDK 525
           +G +  +L+     VY+  LS + DK
Sbjct: 213 DGNIKQVLSGHESFVYNVKLSKQGDK 238

>YGL100W (SEH1) [1883] chr7 (313235..314284) Protein found in
           complex with nuclear pore proteins, member of WD (WD-40)
           repeat family [1050 bp, 349 aa]
          Length = 349

 Score = 32.3 bits (72), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 16/41 (39%), Positives = 23/41 (56%), Gaps = 3/41 (7%)

Query: 391 SFLGHNQDILDIDWSKNNF---VLTGSMDKTVKLWHCDRKQ 428
           S+  H+  I+ IDW+   +   + + S DKTVKLW  D  Q
Sbjct: 50  SWRAHDSSIVAIDWASPEYGRIIASASYDKTVKLWEEDPDQ 90

>Scas_510.5
          Length = 362

 Score = 32.3 bits (72), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 15/57 (26%), Positives = 33/57 (57%), Gaps = 8/57 (14%)

Query: 290 KFSKDGRFLATGGKDRILRIWKVIASPTERLELDSSTMK--------PSKTVCMLNG 338
           ++S DG  +A+GG D I++++ V +  ++++ +  + +K        PS T C++ G
Sbjct: 85  RWSNDGSKVASGGCDNIVKLFDVASGQSQQIGMHDAPVKAVRFVNCGPSNTECLVTG 141

>AGR168W [4479] [Homologous to ScYBL008W (HIR1) - SH]
           complement(1061522..1063999) [2478 bp, 825 aa]
          Length = 825

 Score = 32.7 bits (73), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 12/23 (52%), Positives = 18/23 (78%)

Query: 289 MKFSKDGRFLATGGKDRILRIWK 311
           +KFS D ++LA+G  D+IL IW+
Sbjct: 83  LKFSPDNKYLASGSDDKILLIWE 105

>AER448W [2948] [Homologous to ScYKL213C (DOA1) - SH]
           complement(1497416..1499560) [2145 bp, 714 aa]
          Length = 714

 Score = 32.7 bits (73), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 38/158 (24%), Positives = 55/158 (34%), Gaps = 46/158 (29%)

Query: 390 RSFLGHNQDILDIDWSKNNFVLTGSMDKTVKLW-----------HCDRKQLLKNFP---- 434
           R+  GHN  +        +  LT S DKT+KLW           H D  + L   P    
Sbjct: 140 RALSGHNATVWHALALGYDRFLTASADKTIKLWDGARDLATYNVHTDVVRHLALAPDGHH 199

Query: 435 -------------------------HPDFVTCVKFHPNDDRFFISGCLDHKARLWSILDD 469
                                    H  FV CVK+ P  D   +S   D   R+W +   
Sbjct: 200 FASCSNDGSVKVHTLDGKTVRTFDGHESFVYCVKYLP--DGGLVSCGEDKTVRVWDMSGH 257

Query: 470 EVSFEFDCGDLITSLEVSP-GDSKYTILGTFNGYVIVL 506
                  C   + SL+V P GD    ++G  +G +++ 
Sbjct: 258 VRQVIRLCATSLWSLDVLPNGD---IVVGGSDGKILIF 292

>Kwal_27.11550
          Length = 407

 Score = 32.3 bits (72), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 16/52 (30%), Positives = 26/52 (50%), Gaps = 2/52 (3%)

Query: 419 VKLWHCDRKQLLKNFPHPDFVTCVKFHPNDDRFFISGCLDHKARLWSILDDE 470
           +K WH   + L+ +  H D +T +KFHP D    +SG  D    ++ +   E
Sbjct: 132 MKAWHQPLRSLVDS--HHDDITNIKFHPTDPNVLLSGSTDGYVNIYDLTQPE 181

>Scas_692.25
          Length = 488

 Score = 32.3 bits (72), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 16/56 (28%), Positives = 31/56 (55%), Gaps = 3/56 (5%)

Query: 394 GHNQDILDIDWSKNNFVLTGSMDKTVKLWHCDRKQLLKNFP--HPDFVTCVKFHPN 447
           GH   + D+   + N++ + S DKT++ W+ +  + +K +   H  FVTC+   P+
Sbjct: 404 GHASWVKDLR-IRGNYLFSCSDDKTIRCWNLENGECVKQWTDLHSGFVTCLDMDPD 458

>Scas_680.11
          Length = 347

 Score = 32.0 bits (71), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 19/66 (28%), Positives = 33/66 (50%), Gaps = 3/66 (4%)

Query: 394 GHNQDILDIDWSK-NNFVLTGSMDKTVKLWHCDRKQLLKNFPHPDFVTCVKFHPNDDRFF 452
           GH   I  ID  K   + +TGS D ++K+W  +  + + ++  P  V  V F P  +  +
Sbjct: 50  GHAGTIWSIDVDKFTEYCVTGSADYSIKMWKVETGENVYSWDSPVPVKNVSFSPCGN--Y 107

Query: 453 ISGCLD 458
           ++  LD
Sbjct: 108 VAAVLD 113

>KLLA0E22814g 2023109..2027200 similar to sp|P47104 Saccharomyces
           cerevisiae YJR033c RAV1 singleton, start by similarity
          Length = 1363

 Score = 32.3 bits (72), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 26/85 (30%), Positives = 36/85 (42%), Gaps = 27/85 (31%)

Query: 411 LTGSM---DKTVKLWHCDRKQL--------LKNFPHPDFVTCVKFHPNDDR--------F 451
           L  SM   D+TVK+W   R  +        L   PHPD VT  ++  ND +         
Sbjct: 158 LISSMNYNDRTVKIWR--RVSITSDSDFFDLVILPHPDVVTTFRWKTNDHQCNKEHITHV 215

Query: 452 FISGCLDHKARLWSILDDEVSFEFD 476
             + C D K R+W      +SF+ D
Sbjct: 216 IYTLCADRKLRVW------ISFDID 234

>Sklu_2406.11 YOR212W, Contig c2406 16632-17912 reverse complement
          Length = 426

 Score = 32.0 bits (71), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 22/78 (28%), Positives = 32/78 (41%), Gaps = 5/78 (6%)

Query: 392 FLGHNQDILDIDWSKNNFVLTGSMDKTVKLWHCDRKQLLKNFP-HPDFVTCVKFHPND-- 448
           F GH   + D+++  N  +LT S D T  LW   + + +  +  H   V  +   P    
Sbjct: 173 FKGHTCYVSDLEFINNESILTASGDMTCALWDIPKSKRVSEYSDHLGDVLTLSVPPAGTT 232

Query: 449 --DRFFISGCLDHKARLW 464
             D  F SG  D    LW
Sbjct: 233 SYDSMFASGGSDGYVYLW 250

>AGR238C [4549] [Homologous to ScYIL017C (VID28) - SH]
           (1196780..1199293) [2514 bp, 837 aa]
          Length = 837

 Score = 32.3 bits (72), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 26/91 (28%), Positives = 42/91 (46%), Gaps = 14/91 (15%)

Query: 539 RTNTHHGPKVTGIECFRAVNDMT---------LKLL--VTSNDSKIRVFNLKDN-ILQEV 586
           RTN  HG     ++C       T         LKL   VT+ND K R+  L+DN ++Q V
Sbjct: 309 RTNLLHGLITVFVKCLSLEYQTTSSLGIITSYLKLFAQVTANDEKCRLLLLEDNQLMQHV 368

Query: 587 LKGFENESSQISAHLITGSKNKQQFVIAPSE 617
               +     +S  +++  K K+  +I P++
Sbjct: 369 EHALQTHLDLLSVFILSSDKMKE--MIGPND 397

>Scas_646.14
          Length = 755

 Score = 32.3 bits (72), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 28/50 (56%), Gaps = 4/50 (8%)

Query: 447 NDDRFFISGCLDHKARLWSILDDEVSFEFDCGDLITSLEVSPGDSKYTIL 496
           N D F I GC D + R+WS+  D+V    + G L+ +++V     + T++
Sbjct: 173 NGDSFVIGGCSDGRIRVWSVQKDDV----NRGRLLHTMKVDKAKRESTLV 218

>KLLA0D06787g 586289..587599 gi|4809177|gb|AAD30127.1|AF136180_1
           Kluyveromyces lactis heterotrimeric G protein beta
           subunit, start by similarity
          Length = 436

 Score = 31.6 bits (70), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 14/36 (38%), Positives = 22/36 (61%), Gaps = 1/36 (2%)

Query: 388 PYRSFLGHNQDILDIDWSKNNF-VLTGSMDKTVKLW 422
           P R+  GHN  I D+ WS+++  VL+ S D  + +W
Sbjct: 78  PVRTLKGHNNKISDVKWSQDSASVLSSSQDGFIIIW 113

>AER337W [2838] [Homologous to ScYOR272W (YTM1) - SH]
           complement(1256750..1258087) [1338 bp, 445 aa]
          Length = 445

 Score = 31.6 bits (70), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 33/113 (29%), Positives = 50/113 (44%), Gaps = 12/113 (10%)

Query: 364 DSLDTNGMFPDESLNL-YAPVFHPLPY-RSFLGHNQD---ILDIDWSKNNFVLTGSMDKT 418
           D L   G+  +  LN+ Y     P  Y +SF   N+D    LD+   +   +++GS D  
Sbjct: 70  DYLTRKGLSSEAVLNVEYTRAVLPPSYLKSF--SNEDWVSALDVGAER---IVSGSYDGV 124

Query: 419 VKLWHCDRKQLLKNFPHPDFVTCVKFHPNDDRFFISGCLDHKARLWSILDDEV 471
           V+ W+   K   +   H   V  VKF  +     +SG  D   RLW   +D+V
Sbjct: 125 VRTWNLSGKIEKQYSGHTGAVRAVKFISSTR--LVSGGNDRTLRLWKTKNDDV 175

>CAGL0C00737g complement(75028..77478) similar to tr|Q05946
           Saccharomyces cerevisiae YLR222c, hypothetical start
          Length = 816

 Score = 32.0 bits (71), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 21/81 (25%), Positives = 38/81 (46%), Gaps = 3/81 (3%)

Query: 388 PYRSFLGHNQDILDIDWSKNN-FVLTGSMDKTVKLWHCDRKQLLKNFP-HPDFVTCVKFH 445
           P  +   H + + D+ + ++  ++ T S DKTVK+W  +   +LK    H + V    F 
Sbjct: 529 PVATLANHKRGLWDVSFCESEKWIATCSGDKTVKIWSLESFTVLKTLEGHTNAVQRCSFM 588

Query: 446 PNDDRFFISGCLDHKARLWSI 466
            N  +  +S   D   ++W I
Sbjct: 589 -NKQKQLVSAGADGLIKVWDI 608

>CAGL0G03399g complement(325879..326988) highly similar to sp|P40066
           Saccharomyces cerevisiae YER107c GLE2, start by
           similarity
          Length = 369

 Score = 31.2 bits (69), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 20/74 (27%), Positives = 32/74 (43%), Gaps = 4/74 (5%)

Query: 395 HNQDILDIDWSKNNF-VLTGSMDKTVKLWHCDRKQLLKNFPHPDFVTCVKF---HPNDDR 450
           HN  +L   WS +   + +G  D TVKL+     Q  +   H D V  ++F    P +  
Sbjct: 78  HNGPVLCTRWSLDGARIASGGCDNTVKLYDVASGQSQQIGSHNDAVKSLRFVQCGPTNTE 137

Query: 451 FFISGCLDHKARLW 464
             ++G  D   + W
Sbjct: 138 CLVTGSWDKTIKFW 151

>CAGL0B00748g 65727..68165 similar to sp|P25569 Saccharomyces
           cerevisiae YCL039w, hypothetical start
          Length = 812

 Score = 31.6 bits (70), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 21/61 (34%), Positives = 32/61 (52%), Gaps = 4/61 (6%)

Query: 564 LLVTSNDSKIRVFNLKDNILQEVLKGFENESSQISAHLITGSKNKQQFVIAPSEDHWIYC 623
           LLV    S+I+++N ++NIL  + K F  +  Q       G +NK   V + SED  +Y 
Sbjct: 688 LLVNLQSSEIQLWNYRENIL--IQKYFGQKQEQFIIRSCFGFENK--LVASGSEDGKVYI 743

Query: 624 W 624
           W
Sbjct: 744 W 744

>KLLA0D17028g complement(1443150..1445255) similar to sp|P30619
           Saccharomyces cerevisiae YDR164c SEC1 protein transport
           protein, start by similarity
          Length = 701

 Score = 31.6 bits (70), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 33/136 (24%), Positives = 53/136 (38%), Gaps = 21/136 (15%)

Query: 314 ASPT-ERLELDSSTMKPSKTVCMLNGKLISYSRDVPQSGFARTENGDNPEDDSLDTNGMF 372
           + PT E   L+ +T+ P +       +L  Y+RD          N   PE+       + 
Sbjct: 191 SEPTAEEYALNEATLLPKRVAMAFQQELDDYARD---------HNDFPPENSRPRAIMVI 241

Query: 373 PDESLNLYAPVFHPLPYRSF---LGHNQDILDIDWSKNNFVLTGSMDKTVKLWHCDRKQL 429
            D  L+L++PV H   Y++    +  N D     +S      TG M+         +   
Sbjct: 242 TDRVLDLFSPVLHDFSYQALAYDISKNIDRRTDTYSYKVENETGVMEP--------KTSR 293

Query: 430 LKNFPHPDFVTCVKFH 445
           L +   PD+VT   FH
Sbjct: 294 LSDLLDPDWVTMKHFH 309

>Scas_692.29
          Length = 456

 Score = 31.2 bits (69), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 31/113 (27%), Positives = 47/113 (41%), Gaps = 5/113 (4%)

Query: 370 GMFPDESLNL-YAPVFHPLPYRSFLGHNQDILDIDWSKNN-FVLTGSMDKTVKLWHCDRK 427
           G+  + SLN+ Y     P  + S   +   I  ID S++   ++T S D  ++ W+   K
Sbjct: 76  GLSSETSLNVEYTRAILPPSFLSSFNNEDWISSIDVSQDKKAIITASYDGVIRTWNLSGK 135

Query: 428 QLLKNFPHPDFVTCVKFHPNDDRFFISGCLDHKARLWSIL-DDEVSFEFDCGD 479
              +   H   +  VKF    D   +S   D   RLW    +D V   FD  D
Sbjct: 136 VQKQYSGHSGPIRAVKFI--SDTRLVSAGNDRTLRLWKTKNNDSVVQHFDEED 186

>ACL116W [933] [Homologous to ScYGR200C (ELP2) - SH]
           complement(140589..143003) [2415 bp, 804 aa]
          Length = 804

 Score = 31.2 bits (69), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 23/76 (30%), Positives = 35/76 (46%), Gaps = 9/76 (11%)

Query: 395 HNQDILDIDW---SKNNFVLTGSMDKTVKLWHCD----RKQLLKNFPHPDFVTCVKFHPN 447
           H++ I D DW   S     +T S DKTVK+W  D    R ++  N    + +T V   P 
Sbjct: 664 HSRIIWDGDWLPASCGTAFVTASRDKTVKIWRLDGQEGRFEVESNLKLKEAITAVAVTPR 723

Query: 448 --DDRFFISGCLDHKA 461
             + R  ++  L+  A
Sbjct: 724 LIEGRLLLAFGLESGA 739

>AGR180W [4491] [Homologous to ScYLR222C - SH]
           complement(1090647..1093067) [2421 bp, 806 aa]
          Length = 806

 Score = 31.2 bits (69), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 43/186 (23%), Positives = 71/186 (38%), Gaps = 28/186 (15%)

Query: 292 SKDGRFLATGGKDRILRIWKVIASPTERLELDSSTMKPSKTVCMLNGKLISYSRDVPQSG 351
           + DG +LAT  KD  + +W        R    SS+ +P         K + ++  V    
Sbjct: 391 TSDGLWLATASKDHSVILW--------RYNEASSSFEPFT-------KFLGHAGPVTAIA 435

Query: 352 FARTENGDNPEDDSLDTNGMF--------PDESLNLYAPVFHPLPYRSFLGHNQDILDID 403
                N + PE     +N +         P++   +  P        +   H +DI  I 
Sbjct: 436 LPNVMNRNWPEFLLTASNDLTIKRWKVPNPNDRKAIELPHIVKASEYTRRAHEKDINAIS 495

Query: 404 WSKNNFVL-TGSMDKTVKLWHCDRKQLLKNFP-HPDFVTCVKFHPNDDRFFISGCL-DHK 460
            S N+ +  T S DKT K+W+ D  ++      H   +  V F   D  + ++ C  D  
Sbjct: 496 MSPNDSIFATASYDKTCKIWNVDTGEVEATLANHKRGLWGVAFCEYD--WLLATCSGDRS 553

Query: 461 ARLWSI 466
             LWS+
Sbjct: 554 INLWSL 559

>YCL039W (GID7) [504] chr3 (52645..54882) Protein of unknown
           function, member of the WD (WD-40) repeat family [2238
           bp, 745 aa]
          Length = 745

 Score = 31.2 bits (69), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 26/98 (26%), Positives = 50/98 (51%), Gaps = 12/98 (12%)

Query: 527 GKDVTTRDLPTSRTNTHHGPKVTGIECFRAVNDMTLKLLVTSNDSKIRVFNLKDNILQEV 586
           GK++T   LP +   TH G         + +++    +LV+  D+++++++ K+NIL + 
Sbjct: 601 GKNMTCISLPLN--TTHQGFHR------QQISESQHLVLVSLQDNELQMWDYKENILIQK 652

Query: 587 LKGFENESSQISAHLITGSKNKQQFVIAPSEDHWIYCW 624
             G + +   I +    G+K     V++ SED  IY W
Sbjct: 653 YFGQKQQHFIIRSCFAYGNK----LVMSGSEDGKIYIW 686

>YOR212W (STE4) [5005] chr15 (742910..744181) Beta subunit of the
           trimeric G protein that mediates signal transduction by
           pheromones, member of the WD (WD-40) repeat family [1272
           bp, 423 aa]
          Length = 423

 Score = 30.8 bits (68), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 14/42 (33%), Positives = 23/42 (54%)

Query: 392 FLGHNQDILDIDWSKNNFVLTGSMDKTVKLWHCDRKQLLKNF 433
           F GH   I DI+++ N  +LT S D T  LW   + + ++ +
Sbjct: 177 FKGHTCYISDIEFTDNAHILTASGDMTCALWDIPKAKRVREY 218

>KLLA0F07205g 686532..688172 some similarities with sgd|S0002247
           Saccharomyces cerevisiae YDL089w, hypothetical start
          Length = 546

 Score = 30.8 bits (68), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 23/54 (42%), Positives = 27/54 (50%), Gaps = 3/54 (5%)

Query: 360 NPEDDSLDTNGMFPDESLNLYAPVF--HPLPYRSFLGHNQDILDIDW-SKNNFV 410
           N ED   D N    DE L  +A       LPY  +L  N+DI  IDW SK+N V
Sbjct: 26  NSEDIREDNNNYNEDEKLGWFASFMGMFSLPYDWYLSINEDIAVIDWDSKSNSV 79

>Scas_685.11
          Length = 384

 Score = 30.8 bits (68), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 21/67 (31%), Positives = 34/67 (50%), Gaps = 8/67 (11%)

Query: 405 SKNNFVLTGSMDKTVKLWHCDRKQLLKNFP----HPDFVTCVKFHPNDDRFFISGCLDHK 460
           S N ++L+ S D  + +W   R +  +NF     H   +  V  HP++ R  IS   DH 
Sbjct: 102 SNNKWLLSASEDNKIIIW---RVKDWENFGTLKGHIARINDVDIHPSN-RVAISVSEDHS 157

Query: 461 ARLWSIL 467
            RLW+++
Sbjct: 158 IRLWNLM 164

>CAGL0J10340g complement(1008637..1009653) highly similar to
           sp|P53011 Saccharomyces cerevisiae YGL100w SEH1 nuclear
           pore protein, start by similarity
          Length = 338

 Score = 30.8 bits (68), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 13/41 (31%), Positives = 23/41 (56%), Gaps = 3/41 (7%)

Query: 391 SFLGHNQDILDIDWSKNNF---VLTGSMDKTVKLWHCDRKQ 428
           S+  H+  I+ +DW+   +   + + S DKT+K+W  D  Q
Sbjct: 50  SWRAHDSSIVSLDWASPEYGRIIASASYDKTIKIWEEDPNQ 90

>Kwal_26.8628
          Length = 422

 Score = 30.8 bits (68), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 20/78 (25%), Positives = 32/78 (41%), Gaps = 5/78 (6%)

Query: 392 FLGHNQDILDIDWSKNNFVLTGSMDKTVKLWHCDRKQLLKNFP-HPDFVTCVKFHP---- 446
           F GH   +  +++ +NN ++T S D T  LW   + + +  F  H   V  +   P    
Sbjct: 171 FKGHTCYVSQVEFFENNSIITASGDMTCALWDIPKAKRIAEFSDHLGDVLALALPPPHAQ 230

Query: 447 NDDRFFISGCLDHKARLW 464
                F SG  D    +W
Sbjct: 231 TSSPIFASGGSDGYVYIW 248

>ADL184W [1557] [Homologous to ScYNL317W (PFS2) - SH]
           complement(375532..376881) [1350 bp, 449 aa]
          Length = 449

 Score = 30.8 bits (68), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 13/34 (38%), Positives = 19/34 (55%), Gaps = 1/34 (2%)

Query: 390 RSFLGHNQDILDIDW-SKNNFVLTGSMDKTVKLW 422
           R   GH+ D+   DW  K   +++GS D  +KLW
Sbjct: 199 RVLSGHHWDVKSCDWHPKMGLIVSGSKDNLIKLW 232

>Kwal_47.17572
          Length = 434

 Score = 30.8 bits (68), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 15/30 (50%), Positives = 19/30 (63%), Gaps = 1/30 (3%)

Query: 394 GHNQDILDIDWSKNN-FVLTGSMDKTVKLW 422
            H + I  I WSKN  ++LT S D TVK+W
Sbjct: 71  AHVRSIQSIAWSKNGRYLLTSSRDWTVKVW 100

>Sklu_2420.2 YPL151C, Contig c2420 3924-5249
          Length = 441

 Score = 30.4 bits (67), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 54/238 (22%), Positives = 94/238 (39%), Gaps = 43/238 (18%)

Query: 294 DGRFLATGGKDRILRIWKVIASPTERLELDSSTMKPSKTVCMLNGKLISYS--------- 344
           D  + ATG  D  ++IW  +A+   +L L    M   K +C+       +S         
Sbjct: 141 DNEWFATGSNDTTIKIWD-LATGKLKLTLSGHIMT-VKDICISKRHPYMFSASEDKLVKC 198

Query: 345 RDVPQSGFARTENGDNPEDDSLDTNGMFPDESLNLYAP-----------VFHPLPYRSFL 393
            D+ ++   R  +G      ++D +      +LNL A            +   LP  +  
Sbjct: 199 WDLEKNRVIRDYHGHLSGVHTVDIH-----PTLNLIATAGRDSVVRLWDIRTKLPVMTMA 253

Query: 394 GHNQDI-----LDIDWSKNNFVLTGSMDKTVKLWHCDRKQLLKNFP-HPDFVTCVKFHPN 447
           GH   I     L +D      V++ S D TV+LW     + LK    H   V  +  HP 
Sbjct: 254 GHKSPINRVKCLPVD----PQVVSCSADATVRLWDITAGKTLKVLTHHKRSVRDIGIHPG 309

Query: 448 DDRFFISGCLDHKARLWSILDDEV--SFEFDCGDLITSLEVSPGDSKYTILGTFNGYV 503
           +  F IS       R W + + ++  +F+ +   +I +L ++  D  +   G+ NG +
Sbjct: 310 E--FSISSACTDDIRSWKLPEGQLLTNFQSEKTGIINTLSINQDDVLFA--GSDNGVL 363

>KLLA0F06754g complement(650475..651509) similar to sp|P53011
           Saccharomyces cerevisiae YGL100w SEH1 nuclear pore
           protein, start by similarity
          Length = 344

 Score = 30.4 bits (67), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 15/42 (35%), Positives = 23/42 (54%), Gaps = 3/42 (7%)

Query: 391 SFLGHNQDILDIDWSKNNF---VLTGSMDKTVKLWHCDRKQL 429
           S+  H+  I+ +DW+   F   + + S DKT+KLW  D   L
Sbjct: 50  SWKAHDSSIVSLDWAAPEFGRIIASVSYDKTIKLWEEDPDAL 91

>KLLA0C07425g complement(647673..649007) highly similar to sp|Q12024
           Saccharomyces cerevisiae YOR272w YTM1
           microtubule-interacting protein singleton, start by
           similarity
          Length = 444

 Score = 30.4 bits (67), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 16/45 (35%), Positives = 24/45 (53%), Gaps = 1/45 (2%)

Query: 394 GHNQDILDIDWSKNNFVLTGSMDKTVKLWHCDRKQLLKNFPHPDF 438
           GH   ++ ID SK+  +L+ S D TV LW  + K++    P  D 
Sbjct: 194 GHKAPVVSIDVSKDR-ILSASCDNTVSLWSTNYKEMTVIDPMEDL 237

>KLLA0A08866g 776960..778231 weakly similar to sp|P53196
           Saccharomyces cerevisiae YGL004c singleton, hypothetical
           start
          Length = 423

 Score = 30.4 bits (67), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 15/58 (25%), Positives = 28/58 (48%), Gaps = 5/58 (8%)

Query: 390 RSFLGHNQDILD---IDWSKNNFVLTGSMDKTVKLWHCDRKQLLKNFPHPDFVTCVKF 444
           R+F+GH + + D   +D  +N   ++ S D ++KLW C     +      D + C+  
Sbjct: 194 RTFIGHTRSVNDFAMVDRGRN--FVSASSDGSLKLWECSTSACVFTLNSNDGINCISL 249

>AGL301C [4011] [Homologous to ScYER107C (GLE2) - SH]
           (137221..138306) [1086 bp, 361 aa]
          Length = 361

 Score = 30.4 bits (67), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 18/65 (27%), Positives = 33/65 (50%), Gaps = 11/65 (16%)

Query: 290 KFSKDGRFLATGGKDRILRIWKVIASPTERLELDSSTMK--------PSKTVCMLNG--- 338
           ++S DG  +A+GG D IL+++ V +   +++    S ++        PS   C++ G   
Sbjct: 84  RWSSDGTKVASGGCDNILKLYDVASGQAQQIGSHDSAVRALRFVQCGPSNQECIVTGSWD 143

Query: 339 KLISY 343
           K I Y
Sbjct: 144 KTIKY 148

>YDR030C (RAD28) [881] chr4 complement(501749..503269) Protein
           involved in the same pathway as Rad26p, has WD (WD-40)
           repeats [1521 bp, 506 aa]
          Length = 506

 Score = 30.4 bits (67), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 15/34 (44%), Positives = 18/34 (52%), Gaps = 2/34 (5%)

Query: 395 HNQDILDIDWSK--NNFVLTGSMDKTVKLWHCDR 426
           H   I  + W K  N    TGS DKTVK+W  +R
Sbjct: 194 HKYGITTLKWYKADNGMFFTGSNDKTVKIWDTNR 227

>ACR097W [1144] [Homologous to ScYOR212W (STE4) - SH]
           complement(529784..531187) [1404 bp, 467 aa]
          Length = 467

 Score = 30.4 bits (67), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 22/78 (28%), Positives = 33/78 (42%), Gaps = 5/78 (6%)

Query: 392 FLGHNQDILDIDWSKNNFVLTGSMDKTVKLWHCDRKQLLKNFP-HPDFVTCVKFHPNDDR 450
           F GH   I +I++  +N +LT S D T  LW   + + +  F  H   V  +   P +  
Sbjct: 212 FKGHTCYISEIEFLDDNSILTASGDMTCALWDITKSKRINEFADHLGDVLSLSAAPTETE 271

Query: 451 ----FFISGCLDHKARLW 464
                F SG  D    +W
Sbjct: 272 GNGNVFASGGSDGYLYIW 289

>CAGL0M04081g complement(450572..451939) highly similar to sp|P42841
           Saccharomyces cerevisiae YNL317w PFS2 polyadenylation
           factor I, hypothetical start
          Length = 455

 Score = 30.4 bits (67), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 31/125 (24%), Positives = 46/125 (36%), Gaps = 23/125 (18%)

Query: 390 RSFLGHNQDILDIDWSKN-NFVLTGSMDKTVKLWHCDRKQL---LKNFPHPDFVTCVKFH 445
           R   GH+ D+   DW      +++GS D  VKLW     Q    L  F H   V   +F 
Sbjct: 202 RVLSGHHWDVRSCDWHPELGLIVSGSKDNLVKLWDPRSGQCVSTLLKFKHT--VLKTRFQ 259

Query: 446 PNDDRFFISGCLDHKARLWSI---------LDDEVSFEFDCGDLITSLEVSPGDSKYTIL 496
           P       +   D   R++ +         + DEV F          LE S  +     +
Sbjct: 260 PTKGNLLAAISKDKSCRVFDLRASMNELMCVRDEVDF--------MELEWSTINESMFTV 311

Query: 497 GTFNG 501
           G ++G
Sbjct: 312 GCYDG 316

>Sklu_1701.1 YOR229W, Contig c1701 334-1536 reverse complement
          Length = 400

 Score = 30.0 bits (66), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 31/117 (26%), Positives = 45/117 (38%), Gaps = 4/117 (3%)

Query: 407 NNFVLTGSMDKTVKLW--HCDRKQLLKNFPHPDFVTCVKFHPNDDRFFISGCLDHKARLW 464
           N+   T S D  ++ W    D+     + P    +TC    P  D  F++G      +LW
Sbjct: 194 NHLFSTCSDDNRLRFWDVRSDKPVWSLSDPKNGSLTCFDVSPVIDTLFVTGTSTGVLKLW 253

Query: 465 SILDDEVS--FEFDCGDLITSLEVSPGDSKYTILGTFNGYVIVLLTRGLEHVYSFHL 519
            +     S   + DC   I SL  S GDS   +   F      L   G  +VY + L
Sbjct: 254 DLRAVAASSGHDDDCTTEIVSLYHSGGDSVADVQFGFTSPTQFLSVGGSGNVYHWDL 310

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.316    0.132    0.388 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 30,019,884
Number of extensions: 1301791
Number of successful extensions: 5641
Number of sequences better than 10.0: 256
Number of HSP's gapped: 5453
Number of HSP's successfully gapped: 444
Length of query: 966
Length of database: 16,596,109
Length adjustment: 111
Effective length of query: 855
Effective length of database: 12,753,511
Effective search space: 10904251905
Effective search space used: 10904251905
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 66 (30.0 bits)