Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Sklu_2430.753953925960.0
Kwal_26.766555147815650.0
YKL124W (SSH4)57948414840.0
Scas_721.12657349114040.0
KLLA0B12760g54245413151e-177
ABL026W48043113021e-176
CAGL0M06545g58745312961e-174
Sklu_2101.35683493461e-34
Kwal_23.34885023473307e-33
YMR171C5503513264e-32
ADL279W4933403236e-32
KLLA0D10065g4663263227e-32
CAGL0F07799g5802133034e-29
Scas_669.105852993035e-29
CAGL0D05720g881174750.50
Kwal_47.1917383671721.2
YOR018W (ROD1)83747683.2
KLLA0A01221g87287683.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Sklu_2430.7
         (539 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Sklu_2430.7 YKL124W, Contig c2430 12905-14524                        1004   0.0  
Kwal_26.7665                                                          607   0.0  
YKL124W (SSH4) [3142] chr11 (210239..211978) Protein that confer...   576   0.0  
Scas_721.126                                                          545   0.0  
KLLA0B12760g 1114942..1116570 some similarities with sp|P32343 S...   511   e-177
ABL026W [566] [Homologous to ScYKL124W (SSH4) - SH] complement(3...   506   e-176
CAGL0M06545g 677238..679001 similar to sp|P32343 Saccharomyces c...   503   e-174
Sklu_2101.3 YMR171C, Contig c2101 5004-6710                           137   1e-34
Kwal_23.3488                                                          131   7e-33
YMR171C (YMR171C) [4126] chr13 complement(603867..605519) Protei...   130   4e-32
ADL279W [1462] [Homologous to ScYMR171C - SH] complement(212401....   129   6e-32
KLLA0D10065g complement(851283..852683) similar to sp|Q03212 Sac...   128   7e-32
CAGL0F07799g complement(760681..762423) similar to sp|Q03212 Sac...   121   4e-29
Scas_669.10                                                           121   5e-29
CAGL0D05720g complement(542407..545052) similar to tr|Q07798 Sac...    33   0.50 
Kwal_47.19173                                                          32   1.2  
YOR018W (ROD1) [4831] chr15 (364368..366881) Protein that mediat...    31   3.2  
KLLA0A01221g 113308..115926 similar to sp|P53076 Saccharomyces c...    31   3.3  

>Sklu_2430.7 YKL124W, Contig c2430 12905-14524
          Length = 539

 Score = 1004 bits (2596), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 496/539 (92%), Positives = 496/539 (92%)

Query: 1   MLINNEEIQTVWSNPQQGYPGDPVFSPPEGNNGDSETLSLAFLISLSVTFGVLMVLLIIM 60
           MLINNEEIQTVWSNPQQGYPGDPVFSPPEGNNGDSETLSLAFLISLSVTFGVLMVLLIIM
Sbjct: 1   MLINNEEIQTVWSNPQQGYPGDPVFSPPEGNNGDSETLSLAFLISLSVTFGVLMVLLIIM 60

Query: 61  AVYVTFCNADESDYDEEMGATHGTGASSFFRRHKNSSLFLDGSFITPGKFXXXXXXXXXX 120
           AVYVTFCNADESDYDEEMGATHGTGASSFFRRHKNSSLFLDGSFITPGKF          
Sbjct: 61  AVYVTFCNADESDYDEEMGATHGTGASSFFRRHKNSSLFLDGSFITPGKFDDEQAVQEQE 120

Query: 121 XXCFKDKFSKFEIELYQRAKEFQKVNPPIVKSFGTYTPLKDKQLIKDRGIQSYYFLPSIN 180
             CFKDKFSKFEIELYQRAKEFQKVNPPIVKSFGTYTPLKDKQLIKDRGIQSYYFLPSIN
Sbjct: 121 DECFKDKFSKFEIELYQRAKEFQKVNPPIVKSFGTYTPLKDKQLIKDRGIQSYYFLPSIN 180

Query: 181 DNLDKAGNFLPSFLIQDKLDIEFTKYNKSSSAIMNFPLPYNRKDAVYFEVKVFKYPSKSN 240
           DNLDKAGNFLPSFLIQDKLDIEFTKYNKSSSAIMNFPLPYNRKDAVYFEVKVFKYPSKSN
Sbjct: 181 DNLDKAGNFLPSFLIQDKLDIEFTKYNKSSSAIMNFPLPYNRKDAVYFEVKVFKYPSKSN 240

Query: 241 SIFTIGLITPPYPYFRMPGYNKHSIAYESTGKLRISNPFYANTLLPKLEEGDVVGFGYRF 300
           SIFTIGLITPPYPYFRMPGYNKHSIAYESTGKLRISNPFYANTLLPKLEEGDVVGFGYRF
Sbjct: 241 SIFTIGLITPPYPYFRMPGYNKHSIAYESTGKLRISNPFYANTLLPKLEEGDVVGFGYRF 300

Query: 301 RSGTIFITHNGKKLLDLTENIGVDLFIGLGAMNACYTKSYTLEGLLADPDNPGLHEQLVA 360
           RSGTIFITHNGKKLLDLTENIGVDLFIGLGAMNACYTKSYTLEGLLADPDNPGLHEQLVA
Sbjct: 301 RSGTIFITHNGKKLLDLTENIGVDLFIGLGAMNACYTKSYTLEGLLADPDNPGLHEQLVA 360

Query: 361 AQLTPESDTTAAINPQLERVHDYTTEDIPSDEIELQVNLGQLGFVFIEANVKKYVFGSVY 420
           AQLTPESDTTAAINPQLERVHDYTTEDIPSDEIELQVNLGQLGFVFIEANVKKYVFGSVY
Sbjct: 361 AQLTPESDTTAAINPQLERVHDYTTEDIPSDEIELQVNLGQLGFVFIEANVKKYVFGSVY 420

Query: 421 GEIGIPPSYNGDEIKQDTVLQKGEELPPEYPAEDVGFFGNIKVREGPSKEQHAMDVEHYE 480
           GEIGIPPSYNGDEIKQDTVLQKGEELPPEYPAEDVGFFGNIKVREGPSKEQHAMDVEHYE
Sbjct: 421 GEIGIPPSYNGDEIKQDTVLQKGEELPPEYPAEDVGFFGNIKVREGPSKEQHAMDVEHYE 480

Query: 481 RASSAFDRENNVYXXXXXXXXXXXXXXXXPLDASKAASGPXXXXXXXXXXXXXXXHIRS 539
           RASSAFDRENNVY                PLDASKAASGP               HIRS
Sbjct: 481 RASSAFDRENNVYEEEGTEEMESRESSTSPLDASKAASGPKKKNKKRRKRRKGKKHIRS 539

>Kwal_26.7665
          Length = 551

 Score =  607 bits (1565), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 300/478 (62%), Positives = 372/478 (77%), Gaps = 22/478 (4%)

Query: 22  DPVFSPPEGNNGDSETLSLAFLISLSVTFGVLMVLLIIMAVYVTFCNADESDYDEEMGAT 81
           +P+F PP G + D E +SL FLISLSVTF +LMV+LI++AVYVTFC ADES+YDEE+   
Sbjct: 58  EPIFEPPIGESQDGEAISLVFLISLSVTFAILMVMLIVIAVYVTFCGADESEYDEEVA-- 115

Query: 82  HGTGASSFFRRHKNSSLFLDGSFITPGKFXXXXXXXXXXXXCFKDKFSKFEIELYQRAKE 141
             +   + FR+ K S + LDGSF+TPG+F                + S+FE+ELYQR +E
Sbjct: 116 --SAIPNMFRK-KRSGVLLDGSFLTPGQFDDEHALLEQEAVELP-RMSRFEVELYQRCRE 171

Query: 142 FQKVNPPIVKSFGTYTPLKDKQLIKDRGIQSYYFLPSINDNLDKAGNFLPSFLIQDKLDI 201
           FQK+ PP V  FGTYT   DKQ IKDRG+QSYYFLPSINDN+D  GNFLPSF++QDKLD+
Sbjct: 172 FQKMCPPNVTEFGTYTSASDKQFIKDRGVQSYYFLPSINDNVDHYGNFLPSFIVQDKLDV 231

Query: 202 EFTKYNKSSSAIMNFPLPYNRKDAVYFEVKVFKYPSKSNSIFTIGLITPPYPYFRMPGYN 261
            FTK+N+S+S IMN+PLP N+K+AVYFEVKVFK+P+KSNSIF+ GL+T PYPYFR+PG  
Sbjct: 232 LFTKFNRSASTIMNYPLPQNKKEAVYFEVKVFKFPAKSNSIFSCGLVTCPYPYFRIPGMA 291

Query: 262 KHSIAYESTGKLRISNPFYANTLLPKLEEGDVVGFGYRFRSGTIFITHNGKKLLDLTENI 321
           + SIAYESTGKLR++NPFYANTLLPKL+EGDV+GFGYR+++GTI ITHNGKKL+DLT N+
Sbjct: 292 QFSIAYESTGKLRMNNPFYANTLLPKLQEGDVIGFGYRYKTGTILITHNGKKLMDLTHNV 351

Query: 322 GVDLFIGLGAMNACYTKSYTLEGLLADPDNPGLHEQLVAAQLTPESDTTA--AINPQLER 379
           G+DLF+G+GAMNA YT++YT EGLL D DN  L E+++A+    ++D  A  AIN QLE 
Sbjct: 352 GIDLFVGIGAMNAAYTRTYTREGLLEDCDNVSLRERILAS----DADQKAPRAINDQLET 407

Query: 380 VHDYTTEDIPSDEIELQVNLGQLGFVFIEANVKKYVFGSVYGEIGIPPSYNGDEIKQDTV 439
           +HD   +DI SDEIEL VNLGQLGFV++EANVKKY FGSVYG+IG+PP+YNGDEIK+D V
Sbjct: 408 IHDPHNDDITSDEIELHVNLGQLGFVYVEANVKKYAFGSVYGDIGVPPAYNGDEIKKDVV 467

Query: 440 LQKGEELPPEYPAEDVGFF-----GNIKVRE-GPSKEQHAMDVEHYERASSAFDRENN 491
           LQKGEELPP YP E++        G I VRE GPS +    ++E YE  SSAFDRE +
Sbjct: 468 LQKGEELPPMYPTEELAPLAPPAAGTITVREGGPSSK----NIEEYEHESSAFDREED 521

>YKL124W (SSH4) [3142] chr11 (210239..211978) Protein that confers
           resistance to immunosuppressive drug leflunomide upon
           overproduction [1740 bp, 579 aa]
          Length = 579

 Score =  576 bits (1484), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 294/484 (60%), Positives = 361/484 (74%), Gaps = 22/484 (4%)

Query: 21  GDPVFSPPEGNNGDSETLSLAFLISLSVTFGVLMVLLIIMAVYVTFCNADESDYDEE--M 78
           GDP   P    + DS  +SLAFLISLS+TF +LM++L+++A YVTFC  DES+YDEE  +
Sbjct: 26  GDPNMVPTPPMDSDSAAISLAFLISLSITFAILMLILVVIAAYVTFCGDDESEYDEENAL 85

Query: 79  GA-THGTGASSFFRRHKNSSLFLDGSFITPGKFXXXXXXXXXXXXCFKDKFSKFEIELYQ 137
           G  T GT  S F ++H  S + LD SF +PG F                K S +E+ELY 
Sbjct: 86  GTRTSGTLHSLFGKKH--SGILLDSSFASPGGFDDEIVLQERELEELP-KMSAYEVELYI 142

Query: 138 RAKEFQKVNPPIVKSFGTYTPLKDKQLIKDRGIQSYYFLPSINDNLDKAGNFLPSFLIQD 197
           RAKEFQ ++PP+VK FGTY    D+Q IKDRGIQSY+ LPSINDN+D+ GNFLPSF++QD
Sbjct: 143 RAKEFQMMSPPMVKDFGTYLDSDDQQFIKDRGIQSYFLLPSINDNIDEYGNFLPSFIVQD 202

Query: 198 KLDIEFTKYNKSSSAIMNFPLPYNRKDAVYFEVKVFKYPSKSNSIFTIGLITPPYPYFRM 257
           KLDI+F+K+NKSSS +MN+PLP+NRKDAVYFEVK+F++  KSNSIF+IGL T PYPYFR+
Sbjct: 203 KLDIQFSKFNKSSSTVMNYPLPHNRKDAVYFEVKIFRHIQKSNSIFSIGLTTVPYPYFRV 262

Query: 258 PGYNKHSIAYESTGKLRISNPFYANTLLPKLEEGDVVGFGYRFRSGTIFITHNGKKLLDL 317
           PG  K+SIAYESTGKLRI+NPF A+TLLPKLEEGD VGFGYR+++GTIFITHNGKKL+D+
Sbjct: 263 PGMAKYSIAYESTGKLRINNPFTASTLLPKLEEGDTVGFGYRYKTGTIFITHNGKKLMDV 322

Query: 318 TENIGVDLFIGLGAMNACYTKSYTLEGLLADPDNPGLHEQLVAAQLTPESDTTAAINPQL 377
           T+NIG+DLFIG+GA NA YT++YT +GLL DPDN    E L   +          +   L
Sbjct: 323 TQNIGIDLFIGIGAFNAAYTRTYTRDGLLEDPDNVSFREALSEGK-------DIEVAKDL 375

Query: 378 ERVHD--YTTEDIPSDEIELQVNLGQLGFVFIEANVKKYVFGSVYGEIGIPPSYNGDEIK 435
           +RVHD    ++++ SDE+EL VNLGQ+GFVFIEANVKKY FGSVYG+IGIPP+YNG EIK
Sbjct: 376 QRVHDPHDESDEMTSDEVELHVNLGQVGFVFIEANVKKYAFGSVYGQIGIPPAYNGTEIK 435

Query: 436 QDTVLQKGEELPPEYPAEDVGFFGNIKVREGPSKEQHAM------DVEHYERASSAFDRE 489
           +DT+LQKGEELPP Y   D  FFG++KV+EG S    A        V  YER SS FDRE
Sbjct: 436 KDTILQKGEELPPRYADTD-NFFGSMKVKEGSSSRITAQTSKPLWSVGTYERISSNFDRE 494

Query: 490 NNVY 493
           NNVY
Sbjct: 495 NNVY 498

>Scas_721.126
          Length = 573

 Score =  545 bits (1404), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 282/491 (57%), Positives = 347/491 (70%), Gaps = 37/491 (7%)

Query: 32  NGDSETLSLAFLISLSVTFGVLMVLLIIMAVYVTFCNADESDYDEEMGAT-HGTGASSFF 90
           + D ET+SLAFLISLSVTF +LM+LL++MA Y+TFC ADE++YDEE G    G    +  
Sbjct: 36  DSDPETVSLAFLISLSVTFAILMLLLMVMAAYITFCGADEAEYDEESGQRPRGPPRFNIL 95

Query: 91  RRHKNSSLFLDGSFITPGKFXXXXXXXXXXXXCFKDKFSKFEIELYQRAKEFQKVNPPIV 150
              ++  + LD SF +PG+F               ++ S FE+ELY+R+ EFQ+V PP +
Sbjct: 96  FSKRHDGILLDSSFTSPGQFDDECEHQEREHTEL-NRMSPFELELYKRSNEFQEVAPPHI 154

Query: 151 KSFGTYTPLKDKQLIKDRGIQSYYFLPSINDNLDKAGNFLPSFLIQDKLDIEFTKYNKSS 210
             FGTY    D Q+IKDRGIQSY+ LPSINDN++K GNFLPSFLIQDKLD+ FTKYNKSS
Sbjct: 155 DEFGTYLKATDLQVIKDRGIQSYFLLPSINDNVNKQGNFLPSFLIQDKLDMVFTKYNKSS 214

Query: 211 SAIMNFPLPYNRKDAVYFEVKVFKYPSKSNSIFTIGLITPPYPYFRMPGYNKHSIAYEST 270
           S +MN+PLPY ++DAVYFEVKVFK+   SN+IF+IGL+T PYPYFR+PG  K SIAYEST
Sbjct: 215 STVMNYPLPYTKRDAVYFEVKVFKHQPVSNTIFSIGLVTVPYPYFRIPGMAKFSIAYEST 274

Query: 271 GKLRISNPFYANTLLPKLEEGDVVGFGYRFRSGTIFITHNGKKLLDLTENIGVDLFIGLG 330
           GKLRI+NPF A+TLLPKL EGDVVGFGYR+ SGTIFITHNGKKL+D+T+N+GVDLF+GLG
Sbjct: 275 GKLRINNPFMASTLLPKLVEGDVVGFGYRYSSGTIFITHNGKKLMDVTQNVGVDLFVGLG 334

Query: 331 AMNACYTKSYTLEGLLADPDNPGLHEQLVAAQLTPESDTTAAINPQLERVHDYTTED--I 388
           A NA YT+SYT +GLL DPDN  L E L   +          +  +L+RV D   E+  I
Sbjct: 335 AFNASYTRSYTKDGLLEDPDNIELREALSEGR-------EIVLPDELQRVRDPHNENDQI 387

Query: 389 PSDEIELQVNLGQLGFVFIEANVKKYVFGSVYGEIGIPPSYNGDEIKQDTVLQKGEELPP 448
            S+E+EL VNLGQ+GFVFIEANVKKY FG+VYG IGIPPSYNG+EIK D +LQKG+ELPP
Sbjct: 388 DSEEVELHVNLGQVGFVFIEANVKKYAFGTVYGNIGIPPSYNGEEIKNDKLLQKGDELPP 447

Query: 449 EYPA--EDVGFFGNIKVREGPSKEQHAMDV------------------------EHYERA 482
            Y    +  GFFG+I + EG    +   ++                        E YER 
Sbjct: 448 NYGTLLDSNGFFGDIHINEGHRNNEENANIIIGSSDTTLRQGAHNVLMRKTPETETYERI 507

Query: 483 SSAFDRENNVY 493
           SS FDRENN+Y
Sbjct: 508 SSRFDRENNLY 518

>KLLA0B12760g 1114942..1116570 some similarities with sp|P32343
           Saccharomyces cerevisiae YKL124w SSH4 suppressor of
           SHR3, hypothetical start
          Length = 542

 Score =  511 bits (1315), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 264/454 (58%), Positives = 339/454 (74%), Gaps = 10/454 (2%)

Query: 15  PQQGYPGDPVFSPPEGNNGDSETLSLAFLISLSVTFGVLMVLLIIMAVYVTFCNADESDY 74
           P QG+P DPV   P+      +  SL FLISLS+TFG+L+++LI++++Y+TFC  ++ D 
Sbjct: 15  PIQGFPSDPVVRVPDDTIPADDAFSLMFLISLSITFGLLLLVLILISIYLTFCGGNDGDD 74

Query: 75  DEEMGATHGTGASSFFRRHKNSSLFLDGSFITPGKFXXXXXXXXXXXXCFKDKFSKFEIE 134
            ++      + +  FFR  K +SL LD SF+TPGKF                K S FE+E
Sbjct: 75  SDDEDEDGTSVSFKFFR--KRNSLLLDSSFMTPGKFDDDESLKVREAKELP-KMSSFEVE 131

Query: 135 LYQRAKEFQKVNPPIVKSFGTYTPLKDKQLIKDRGIQSYYFLPSINDNLDKAGNFLPSFL 194
           LY+R KEFQK++PP+VK  G++   +DKQ+IKDRGIQSY+FLPSINDN+D  G FLPSF 
Sbjct: 132 LYERTKEFQKMSPPMVKPLGSFLNSQDKQVIKDRGIQSYFFLPSINDNVDINGAFLPSFF 191

Query: 195 IQDKLDIEFTKYNKSSSAIMNFPLPYNRKDAVYFEVKVFKYPSKSNSIFTIGLITPPYPY 254
           ++DKL++ FTK+N SSSAIMN+PLP N+KDAVYFEVKV+K+ + SNSIF+IGL+T PYPY
Sbjct: 192 VEDKLNVSFTKFNISSSAIMNYPLPMNKKDAVYFEVKVYKFKTCSNSIFSIGLMTCPYPY 251

Query: 255 FRMPGYNKHSIAYESTGKLRISNPFYANTLLPKLEEGDVVGFGYRFRSGTIFITHNGKKL 314
           FR+PG   +SIAYESTGKLRI+N F A+TLLPKLEEGDVVGFGYR+ SGTIFITHNGKK+
Sbjct: 252 FRIPGTAAYSIAYESTGKLRINNAFGADTLLPKLEEGDVVGFGYRYSSGTIFITHNGKKM 311

Query: 315 LDLTENIGVDLFIGLGAMNACYTKSYTLEGLLADPDNPGLHEQLVAAQLTPESDTTA--- 371
           +D+T  +G+DLF+GLGAMNA YT++YT +GL  DPDN    ++    Q     ++++   
Sbjct: 312 MDVTHKVGIDLFVGLGAMNAAYTRTYTKDGLFEDPDNVSFRQKWSELQAFNNGESSSDYI 371

Query: 372 ----AINPQLERVHDYTTEDIPSDEIELQVNLGQLGFVFIEANVKKYVFGSVYGEIGIPP 427
                I+  L +VHD   + + SD IEL VNLGQLGFVFIEANVKKY FGSVYG+IGIPP
Sbjct: 372 DARNVISKDLLQVHDPKEDTVSSDNIELHVNLGQLGFVFIEANVKKYAFGSVYGDIGIPP 431

Query: 428 SYNGDEIKQDTVLQKGEELPPEYPAEDVGFFGNI 461
           +YNGD+IKQD +LQKG+ELPPEYP + V FFG+I
Sbjct: 432 AYNGDDIKQDMLLQKGDELPPEYPDDAVDFFGDI 465

>ABL026W [566] [Homologous to ScYKL124W (SSH4) - SH]
           complement(350985..352427) [1443 bp, 480 aa]
          Length = 480

 Score =  506 bits (1302), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 254/431 (58%), Positives = 319/431 (74%), Gaps = 17/431 (3%)

Query: 60  MAVYVTFCN-ADESDYDEEMGATHGTGASSFFRRHKNSSLFLDGSFITPGKFXXXXXXXX 118
           MA Y+TFC+  DE +Y E++G  HG        R K  S      F+  G+         
Sbjct: 1   MARYLTFCHIQDEREYIEKVGGAHGLA------RSKRHSDLYRSPFLNLGQ--ANVKELA 52

Query: 119 XXXXCFKDKFSKFEIELYQRAKEFQKVNPPIVKSFGTYTPLKDKQLIKDRGIQSYYFLPS 178
                   + S+FE+ELY RAKEFQ +NPP+VK+FGTY   +D+Q ++DRGIQ+YY LPS
Sbjct: 53  ELELLELPRMSRFEVELYLRAKEFQAMNPPLVKAFGTYMCPEDRQCVRDRGIQAYYLLPS 112

Query: 179 INDNLDKAGNFLPSFLIQDKLDIEFTKYNKSSSAIMNFPLPYNRKDAVYFEVKVFKYPS- 237
           INDN+D+ GNFLPSFL+QDKL++ FTKYNKSSS IMN+PLP+N++DAVYFEVKV+K+ + 
Sbjct: 113 INDNVDRRGNFLPSFLVQDKLNVTFTKYNKSSSTIMNYPLPHNKRDAVYFEVKVYKFRNY 172

Query: 238 -KSNSIFTIGLITPPYPYFRMPGYNKHSIAYESTGKLRISNPFYANTLLPKLEEGDVVGF 296
             SNSIF+IGL+T PYPYF MPG  ++SIAYESTGKLRI+N FYA+TLLPKL+EGDVVG 
Sbjct: 173 LASNSIFSIGLVTCPYPYFVMPGMCQYSIAYESTGKLRINNSFYASTLLPKLQEGDVVGL 232

Query: 297 GYRFRSGTIFITHNGKKLLDLTENIGVDLFIGLGAMNACYTKSYTLEGLLADPDNPGLHE 356
           GYR+R+GT+FITHNGKK++DLT NIG+DLF+G+GAMNA YT++YT EGLL D DN  L +
Sbjct: 233 GYRYRTGTVFITHNGKKMMDLTHNIGIDLFVGIGAMNAAYTRTYTKEGLLDDIDNVELRK 292

Query: 357 QLVAAQLTPESDTTAAINPQLERVHDYTTEDIPSDEIELQVNLGQLGFVFIEANVKKYVF 416
           Q+   +   + D T  +N QL R HD  T  I SDEIELQVNLG +GFVF+EANVKKY F
Sbjct: 293 QIQDLEADQKRDITEVMNEQLLRPHDPRTRHINSDEIELQVNLGGVGFVFVEANVKKYAF 352

Query: 417 GSVYGEIGIPPSYNGDEIKQDTVLQKGEELPPEYPAEDVGFFGNIKVR--EGPSKEQHAM 474
           GS+YGEIGIPP+YNGDE K D +LQKG++LPP+YP +++ FFGNIKV    G S E  +M
Sbjct: 353 GSLYGEIGIPPAYNGDETKTDVILQKGDDLPPKYPEDELNFFGNIKVNLGNGSSTESTSM 412

Query: 475 DVEHYERASSA 485
               Y R  S+
Sbjct: 413 ----YNRQGSS 419

>CAGL0M06545g 677238..679001 similar to sp|P32343 Saccharomyces
           cerevisiae YKL124w SSH4, hypothetical start
          Length = 587

 Score =  503 bits (1296), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 256/453 (56%), Positives = 329/453 (72%), Gaps = 16/453 (3%)

Query: 22  DPVFSPPEGNNGDSETLSLAFLISLSVTFGVLMVLLIIMAVYVTFCNADESDYDEEMGAT 81
           DP    P+  + D ET++ AF I ++V F +L++ L+  A Y+   ++ E +YDEE+ A 
Sbjct: 18  DPFNPMPDPGDADPETVAFAFFIGIAVVFSLLLITLVCTAAYLVCTSSYEGEYDEEL-AN 76

Query: 82  HGTGASS-------FFRRHKNSSLFLDGSFITPGKFXXXXXXXXXXXXCFKDKFSKFEIE 134
           +G G+          F +  ++ L LD +F  PG+F                K S FE++
Sbjct: 77  NGDGSRRGILNFRPLFGKKNSNGLLLDSNFTNPGEFDDNEEFIEREREALI-KMSPFEVD 135

Query: 135 LYQRAKEFQKVNPPIVKSFGTYTPLKDKQLIKDRGIQSYYFLPSINDNLDKAGNFLPSFL 194
            Y RAKEFQ V+PP V+ FGTY   KD Q+IKDRGIQSYYF+PSINDN+DK+G+FLPSFL
Sbjct: 136 SYMRAKEFQIVSPPAVQEFGTYLDSKDLQMIKDRGIQSYYFIPSINDNVDKSGHFLPSFL 195

Query: 195 IQDKLDIEFTKYNKSSSAIMNFPLPYNRKDAVYFEVKVFKYPSKSNSIFTIGLITPPYPY 254
           +QDKL++EFT++NKSSSA++N+PLPYN+KDAVYFEVKV+ +   SNSIF+IGL+T PYPY
Sbjct: 196 VQDKLEVEFTRWNKSSSAVLNYPLPYNKKDAVYFEVKVYNHKPNSNSIFSIGLVTVPYPY 255

Query: 255 FRMPGYNKHSIAYESTGKLRISNPFYANTLLPKLEEGDVVGFGYRFRSGTIFITHNGKKL 314
           FR+PG  K SIAYESTGKLRI++PF+ +TLLPKL EGDVVGFGYRF++GTIFITHNGKKL
Sbjct: 256 FRIPGMCKFSIAYESTGKLRINDPFFPSTLLPKLVEGDVVGFGYRFKTGTIFITHNGKKL 315

Query: 315 LDLTENIGVDLFIGLGAMNACYTKSYTLEGLLADPDNPGLHEQLVAA-QLTPESDTTAAI 373
           +D+T+N+ V+LFI LGAMNA YT++YT +GLL DPDN  L   L    +L    D     
Sbjct: 316 MDVTQNVSVELFIALGAMNASYTRTYTKDGLLEDPDNIELRNALAEGRELKLSKDIQNPH 375

Query: 374 NPQLERVHDYTTEDIPSDEIELQVNLGQLGFVFIEANVKKYVFGSVYGEIGIPPSYNGDE 433
           NP  E   D     I SDEIEL VNLGQ GFVFIEANVKKY FGSV+GEIGIPP+YN ++
Sbjct: 376 NPMDETKWDI----IDSDEIELHVNLGQTGFVFIEANVKKYGFGSVFGEIGIPPAYNPND 431

Query: 434 IKQDTVLQKGEELPPEYP--AEDVGFFGNIKVR 464
           I++D ++QKGEELPP+YP   E+ G FGN+K++
Sbjct: 432 IQKDKLIQKGEELPPQYPEDTENFGLFGNLKIK 464

>Sklu_2101.3 YMR171C, Contig c2101 5004-6710
          Length = 568

 Score =  137 bits (346), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 104/349 (29%), Positives = 162/349 (46%), Gaps = 90/349 (25%)

Query: 123 CFKDKFSKFEIE---LYQRAKEFQKVNPPIV------KSFGTYTPLKDKQLIK---DRGI 170
             KDK  K   E    Y++ +E+ K NPP++       S G   P+ + Q I+   + G+
Sbjct: 165 AVKDKLVKLSPEEQFYYKQGEEYIKQNPPLLIPHRSEDSQGMLDPIINDQTIRFIEEEGV 224

Query: 171 QSYYFLPSINDNLDKAGNFLP--SFLIQDKLDIEFTKYNKSSSAIMNFPLPYNRKDAVYF 228
            ++ F P  N         LP  + LI++K +I F  YN  +S + N P+P   +   YF
Sbjct: 225 HAWEFQPDPN---------LPNDTILIENKTEITFLNYNYDASVMTNLPVPRVNR-VYYF 274

Query: 229 EVKVFKYPSK--------SNSIFTIGLITPPYPYFRMPGYNKHSIAYESTGKLRISNPFY 280
           E K+F+  +          N + + GL + PYPYFR+PG + HSIAY+STG  R ++ F 
Sbjct: 275 ECKIFELNTSRSDNNYLSDNEMISFGLSSSPYPYFRLPGRHHHSIAYDSTGGRRFNDSFE 334

Query: 281 AN----TLLPKLEEGDVVGFGYRFRSGTIFITHNGKKLLDLTENIGVDLFIGLGAMNACY 336
            +    ++ P+ ++GD++G GYR  SGT+F T NGKK                       
Sbjct: 335 LSAELASIFPRYQKGDIIGIGYRTNSGTVFFTRNGKK----------------------- 371

Query: 337 TKSYTLEGLLADPDNPGLHEQLVAAQLTPESDTTAAINPQLERVHDYTTEDIPSDEIELQ 396
                            L+E+ +   +            +L+ ++     ++P    ++ 
Sbjct: 372 -----------------LNEKPIGGHIK---------GWKLKYLYPIVGANVPC---KVH 402

Query: 397 VNLGQLGFVFIEANVKKYVFGSVYGEIGIPPSYNGDEIKQDTVLQKGEE 445
           VN G  GFVFIEANVKK+ +   +G    PPSY  DE  QD +L+   E
Sbjct: 403 VNFGSYGFVFIEANVKKWGYAKSHGVKLPPPSY--DEYGQDVLLESSYE 449

>Kwal_23.3488
          Length = 502

 Score =  131 bits (330), Expect = 7e-33,   Method: Compositional matrix adjust.
 Identities = 105/347 (30%), Positives = 159/347 (45%), Gaps = 91/347 (26%)

Query: 125 KDKFSKFEIE---LYQRAKEFQKVNPPIV------KSFGTYTPLKDKQ---LIKDRGIQS 172
           +DK ++   E    Y++ +EF K NPP++          T  P+ ++Q    I + G  +
Sbjct: 119 RDKLARMSAEEQFYYKQGEEFIKQNPPLLLPDRSPVGAETVDPIINEQTLQFIDEEGAHA 178

Query: 173 YYFLPSINDNLDKAGNFLP--SFLIQDKLDIEFTKYNKSSSAIMNFPLPYNRKDAVYF-E 229
           + F P            LP  S L+++K +I F  YN   S + N P+P  R + VY+ E
Sbjct: 179 WEFQPDPK---------LPNDSVLVENKSEITFLNYNYDVSVMTNLPIP--RLNRVYYCE 227

Query: 230 VKVFKYP-------SKSNSIFTIGLITPPYPYFRMPGYNKHSIAYESTGKLRISNPFYAN 282
            K+F+         S  N + + GL T PYPYFR+PG + HSIAY+STG  R ++ F  +
Sbjct: 228 FKIFELNTAGSNNNSSQNEMLSFGLSTSPYPYFRLPGRHHHSIAYDSTGGRRFNDSFELS 287

Query: 283 ----TLLPKLEEGDVVGFGYRFRSGTIFITHNGKKLLDLTENIGVDLFIGLGAMNACYTK 338
               ++ P+ E+GDV+G GYR  SGT+F T NGKK                         
Sbjct: 288 PELASIFPRCEKGDVIGIGYRTNSGTVFFTRNGKK------------------------- 322

Query: 339 SYTLEGLLADPDNPGLHEQLVAAQLTPESDTTAAINPQLERVHDYTTEDIPSDEIELQVN 398
                          L+E+ +   +            + + V+     +IP    ++ VN
Sbjct: 323 ---------------LNEKSIGGHIK---------GWKFKYVYPIVGSNIP---CKVHVN 355

Query: 399 LGQLGFVFIEANVKKYVFGSVYGEIGIPPSYNGDEIKQDTVLQKGEE 445
            G  GFVFIEANVKK+ +    G    PPSY  ++  QD +L+   E
Sbjct: 356 FGTYGFVFIEANVKKWGYAKSNGMKLPPPSY--EDYSQDVLLESSYE 400

>YMR171C (YMR171C) [4126] chr13 complement(603867..605519) Protein
           containing a SPRY (SPla and RYanodine Receptor) domain,
           has moderate similarity to uncharacterized C. albicans
           Orf6.5491p [1653 bp, 550 aa]
          Length = 550

 Score =  130 bits (326), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 102/351 (29%), Positives = 159/351 (45%), Gaps = 92/351 (26%)

Query: 125 KDKFSKFEIE---LYQRAKEFQKVNPPIVKSFGTYTPLKD----------------KQLI 165
           +DK ++   E    Y++ +E+ K NPP + + G     +D                +Q I
Sbjct: 126 RDKLAQLSPEEQFYYKQGEEYIKQNPPFLLNQGLLQQSEDSNPDTTREDPIMNEQTRQYI 185

Query: 166 KDRGIQSYYFLPSINDNLDKAGNFLPSFLIQDKLDIEFTKYNKSSSAIMNFPLPYNRKDA 225
           ++ G  ++ F P    N D   +   + ++++K ++ F  YN  +S   N P+P   K  
Sbjct: 186 QEEGAYAWEFSP----NPDMPNH---TVIVENKTEVSFLNYNYDASISTNLPIPCINK-V 237

Query: 226 VYFEVKVFKYPSKSNS-------IFTIGLITPPYPYFRMPGYNKHSIAYESTGKLRISNP 278
            Y E K+F+     NS       + + GL T PYPYFR+PG + HSIAY+S G  R ++ 
Sbjct: 238 YYCEFKIFETDGPLNSDENVSKGVISFGLSTQPYPYFRLPGRHHHSIAYDSNGARRFNDS 297

Query: 279 FYAN----TLLPKLEEGDVVGFGYRFRSGTIFITHNGKKLLDLTENIGVDLFIGLGAMNA 334
           F  N    TL P+ E+GD+VG GYR RSGT+F T NGKK                     
Sbjct: 298 FKLNEQLRTLFPQCEKGDIVGIGYRSRSGTVFFTRNGKK--------------------- 336

Query: 335 CYTKSYTLEGLLADPDNPGLHEQLVAAQLTPESDTTAAINPQLERVHDYTTEDIPSDEIE 394
                              L+E+ V   +            + + ++     ++P    +
Sbjct: 337 -------------------LNEKSVGGHIR---------GWKFQYLYPIIGSNVP---CQ 365

Query: 395 LQVNLGQLGFVFIEANVKKYVFGSVYGEIGIPPSYNGDEIKQDTVLQKGEE 445
           + VN G  GFV+IEANVKK+ +    G    PPSY  ++  +DT+L+ G E
Sbjct: 366 IHVNFGTYGFVYIEANVKKWGYAKSNGIKLPPPSY--EDYGKDTLLESGGE 414

>ADL279W [1462] [Homologous to ScYMR171C - SH]
           complement(212401..213882) [1482 bp, 493 aa]
          Length = 493

 Score =  129 bits (323), Expect = 6e-32,   Method: Compositional matrix adjust.
 Identities = 95/340 (27%), Positives = 155/340 (45%), Gaps = 93/340 (27%)

Query: 136 YQRAKEFQKVNPPIVKSFGT-------------YTPLKDKQL---IKDRGIQSYYFLPSI 179
           Y++ +EF K NPP +  + T             + P+ + Q    I++ G Q++ F PS 
Sbjct: 117 YKQGEEFIKQNPPALMPYQTVAGGGSHGEPADVFDPVINDQTLRYIEEEGAQAWEFQPS- 175

Query: 180 NDNLDKAGNFLPSFL-IQDKLDIEFTKYNKSSSAIMNFPLPYNRKDAVYFEVKVFKYPSK 238
                   +  P F+ ++++ ++ F   N   S   N P+P   K   YFE K+F+   +
Sbjct: 176 -------PSLPPDFVKVENRTELTFMNSNSDVSVATNLPIPLANK-VYYFECKIFELCDR 227

Query: 239 ---------SNSIFTIGLITPPYPYFRMPGYNKHSIAYESTGKLRISNPFYA----NTLL 285
                     N I + GL T PYPYFR+PG + HS+AY+S G  R++N F      ++L 
Sbjct: 228 LGRPVSHLSENQIVSFGLATSPYPYFRLPGRHHHSVAYDSNGARRLNNSFKLPQELSSLF 287

Query: 286 PKLEEGDVVGFGYRFRSGTIFITHNGKKLLDLTENIGVDLFIGLGAMNACYTKSYTLEGL 345
           P+ E+GDV+G GYR RSGT+F T NGKK                                
Sbjct: 288 PRCEKGDVIGIGYRTRSGTVFFTRNGKK-------------------------------- 315

Query: 346 LADPDNPGLHEQLVAAQLTPESDTTAAINPQLERVHDYTTEDIPSDEIELQVNLGQLGFV 405
                   L+E+ +   +            +++ ++     ++P    ++ VN G  GFV
Sbjct: 316 --------LNEKRIGGHIK---------GWKIKYLYPIVGANVPC---KIHVNFGTYGFV 355

Query: 406 FIEANVKKYVFGSVYGEIGIPPSYNGDEIKQDTVLQKGEE 445
           +IEANVKK+ +  + G    PP+Y  ++  +D +L+   E
Sbjct: 356 YIEANVKKWGYAKLNGMKLPPPAY--EDYDRDVLLESSYE 393

>KLLA0D10065g complement(851283..852683) similar to sp|Q03212
           Saccharomyces cerevisiae YMR171c, start by similarity
          Length = 466

 Score =  128 bits (322), Expect = 7e-32,   Method: Compositional matrix adjust.
 Identities = 100/326 (30%), Positives = 154/326 (47%), Gaps = 72/326 (22%)

Query: 136 YQRAKEFQKVNPPIVKSFGTYTPLKDKQLIKDRGIQSYYFLPSINDNLDKAGNF-----L 190
           Y++ +E+ K NPP++  +    P   +++I D  I +   L  I +    A  F     L
Sbjct: 115 YKQGEEYVKQNPPLLVPYLPNDPENREEVIPD-PIVNEQTLQFIEEEGAAAWEFQADPNL 173

Query: 191 P--SFLIQDKLDIEFTKYNKSSSAIMNFPLPYNRKDAVYFEVKVF-----KYPSKSNSIF 243
           P  + +IQ++ ++ F  ++  +S +   P+P   K   Y+E K+F     K     N + 
Sbjct: 174 PNDTVMIQERTELTFLNFSYDASVMTTLPIPRLNK-VYYYECKIFELNQGKNHLSDNEMI 232

Query: 244 TIGLITPPYPYFRMPGYNKHSIAYESTGKLRISNPF----YANTLLPKLEEGDVVGFGYR 299
           +IGL T PYPYFR+PG + HSI+Y+S G  R+++ F       TL P+ E+GDV+G GYR
Sbjct: 233 SIGLSTSPYPYFRLPGRHHHSISYDSDGCRRMNSSFPMSAELQTLFPRFEKGDVIGIGYR 292

Query: 300 FRSGTIFITHNGKKLLDLTENIGVDLFIGLGAMNACYTKSYTLEGLLADPDNPGLHEQLV 359
            RSGTIF THNGKK                                        L+E+ V
Sbjct: 293 TRSGTIFFTHNGKK----------------------------------------LNEKKV 312

Query: 360 AAQLTPESDTTAAINPQLERVHDYTTEDIPSDEIELQVNLGQLGFVFIEANVKKYVFGSV 419
              +            +L+ ++     +IP    ++ VN G  GFV+IEANVKK+ +   
Sbjct: 313 GGHIK---------GWKLKYLYPIVGSNIP---CKIHVNFGTYGFVYIEANVKKWGYSKN 360

Query: 420 YGEIGIPPSYNGDEIKQDTVLQKGEE 445
            G    PPSY  ++  QD +L+   E
Sbjct: 361 AGIKLPPPSY--EDYDQDVLLESAFE 384

>CAGL0F07799g complement(760681..762423) similar to sp|Q03212
           Saccharomyces cerevisiae YMR171c, hypothetical start
          Length = 580

 Score =  121 bits (303), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 77/213 (36%), Positives = 115/213 (53%), Gaps = 36/213 (16%)

Query: 127 KFSKFEIELYQRAKEFQKVNPPIVKSFGTYT--------PL---KDKQLIKDRGIQSYYF 175
           K S  E   Y++ +E+ K NPP++ S G+ +        P+   + +Q I++ G  ++ F
Sbjct: 149 KLSPEEQFYYKQGEEYIKQNPPLIISTGSRSGDQNTVNDPIINDQTRQFIEEEGALAWEF 208

Query: 176 LPSINDNLDKAGNFLP--SFLIQDKLDIEFTKYNKSSSAIMNFPLPY-NRKDAVYFEVKV 232
            P+ N         LP  + ++++K +I F  YN  +S   N P+P  NR    Y E K+
Sbjct: 209 QPNPN---------LPNDTIIVENKTEISFLNYNYDASVTTNLPIPCINR--VYYCEFKI 257

Query: 233 FKYPS-------KSNSIFTIGLITPPYPYFRMPGYNKHSIAYESTGKLRISNPFYAN--- 282
           F+          K N I + GL T PYPYFR+PG + HSIAY+S G  R ++ F      
Sbjct: 258 FELSITDDQTTLKDNEIISFGLSTSPYPYFRLPGRHHHSIAYDSNGARRFNDSFKLEPEL 317

Query: 283 -TLLPKLEEGDVVGFGYRFRSGTIFITHNGKKL 314
             L PK ++GD++G GYR RSGT+F T NGKK+
Sbjct: 318 ADLFPKCQKGDIIGIGYRTRSGTVFFTRNGKKI 350

>Scas_669.10
          Length = 585

 Score =  121 bits (303), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 92/299 (30%), Positives = 142/299 (47%), Gaps = 79/299 (26%)

Query: 162 KQLIKDRGIQSYYFLPSINDNLDKAGNFLP--SFLIQDKLDIEFTKYNKSSSAIMNFPLP 219
           KQ I++ G  ++ F    N         LP  + LI++K +I F  YN  +S + N P+P
Sbjct: 194 KQFIEEEGASAWEFQADPN---------LPNDTILIENKTEITFLNYNYDASVMTNLPIP 244

Query: 220 Y-NRKDAVYFEVKVFKY---PSKSN----SIFTIGLITPPYPYFRMPGYNKHSIAYESTG 271
             NR    Y E K+F+    P ++N     + ++GL T PYPYFR+PG + HSIAY+S G
Sbjct: 245 CINR--VYYCEFKIFELNNSPEQTNLSPNEVISMGLATSPYPYFRLPGRHHHSIAYDSNG 302

Query: 272 KLRISNPFYAN----TLLPKLEEGDVVGFGYRFRSGTIFITHNGKKLLDLTENIGVDLFI 327
             R ++ F  +     L P  E GD++G GYR RSGT F T NGKK+ +  ++IG     
Sbjct: 303 ARRFNDSFPLDPELANLFPVCERGDIIGVGYRTRSGTFFFTRNGKKVSE--KSIG----- 355

Query: 328 GLGAMNACYTKSYTLEGLLADPDNPGLHEQLVAAQLTPESDTTAAINPQLERVHDYTTED 387
             G +  C                                        +++ ++     +
Sbjct: 356 --GHIKGC----------------------------------------KIKYLYPIVGTN 373

Query: 388 IPSDEIELQVNLGQLGFVFIEANVKKYVFGSVYGEIGIPPSYNGDEIKQDTVLQKGEEL 446
           +P    ++ VN G  GFV+IEANVKK+ +   +G    PPSY  +E  +D ++   ++L
Sbjct: 374 VP---CKVHVNFGTYGFVYIEANVKKWGYAKSHGLKVPPPSY--EEYGKDALVGSYQDL 427

>CAGL0D05720g complement(542407..545052) similar to tr|Q07798
           Saccharomyces cerevisiae YLL005c, hypothetical start
          Length = 881

 Score = 33.5 bits (75), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 40/174 (22%), Positives = 68/174 (39%), Gaps = 30/174 (17%)

Query: 296 FGYRFRSGTIFITHNGKKLLDLTENIGVDLF------IGLGAMNACYTKSYTLEGLLADP 349
           F Y+F S  I  TH GK   +    +   ++      IGL A+  CY  S ++  +    
Sbjct: 726 FIYQFNSENISETH-GKLYPEALSQLYAGIYCMELSLIGLFALFNCYKLSTSMAFM---- 780

Query: 350 DNPGLHEQLVAAQLTPESDTTAAINPQLERVHDYTTEDIPSDEIELQVNLGQLGFVFIEA 409
               +   L+ A+++ +       N  L  +HDYT+ D  S   E               
Sbjct: 781 ---SILTVLIHAEISKKFIRRLH-NLHLNSLHDYTSSDSISPRAE--------------- 821

Query: 410 NVKKYVFGSVYGEIGIPPSYNGDEIKQDTVLQKGEELPPEYPAEDVGFFGNIKV 463
           +++ Y+F  +  EI +P    G    +   LQ    L  ++    +  FGNI +
Sbjct: 822 SLESYIFPPITNEIWVPTDQMGIAENERPYLQASLSLKCDFEKAYITKFGNICI 875

>Kwal_47.19173
          Length = 836

 Score = 32.3 bits (72), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 31/71 (43%), Gaps = 16/71 (22%)

Query: 292 DVVGFGYRFRSGTIFITHNGKKL-LDLTENIGVDL--FIGLGAMNACYTKSYTLEGLLAD 348
           DV+G G  +  GTIF T NG  L    T+   VDL  FI L   N   T           
Sbjct: 443 DVIGCGVNYVDGTIFFTKNGLHLGTAFTDVYDVDLAPFIALKPGNMVRT----------- 491

Query: 349 PDNPGLHEQLV 359
             N GLHE+ V
Sbjct: 492 --NFGLHEEFV 500

>YOR018W (ROD1) [4831] chr15 (364368..366881) Protein that mediates
           resistance to o-dinitrobenzene (O-DNB) [2514 bp, 837 aa]
          Length = 837

 Score = 30.8 bits (68), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 26/47 (55%), Gaps = 5/47 (10%)

Query: 427 PSYNGDEIKQDTVLQKGEELPPEYPAEDVGFFGNIKVR-EGPSKEQH 472
           PSY+   +K D +   GE+LPP YP E++G   N K+  E P    H
Sbjct: 640 PSYDK-AMKSDMI---GEDLPPAYPEEELGVQENKKIELERPQILHH 682

>KLLA0A01221g 113308..115926 similar to sp|P53076 Saccharomyces
           cerevisiae YGL227w VID30 singleton, start by similarity
          Length = 872

 Score = 30.8 bits (68), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 26/87 (29%), Positives = 41/87 (47%), Gaps = 12/87 (13%)

Query: 267 YESTGKLRISNPFYANTLLPKLEEGDVVGFGYRFRSGTIFITHNGKKLLDLTENI-GVDL 325
           ++++G  + S PF  +         D+VG G  F  G+IF T NG  L +  E+   +DL
Sbjct: 445 FDASGSQKYSRPFGND---------DIVGCGVNFIEGSIFFTKNGIFLGNAFEDCFDIDL 495

Query: 326 --FIGLGAMNACYTKSYTLEGLLADPD 350
             F+ + + N+  T     E  L D D
Sbjct: 496 VPFVSIKSGNSLRTNFGLTEEFLFDID 522

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.317    0.137    0.403 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 17,876,171
Number of extensions: 825254
Number of successful extensions: 1942
Number of sequences better than 10.0: 22
Number of HSP's gapped: 1944
Number of HSP's successfully gapped: 29
Length of query: 539
Length of database: 16,596,109
Length adjustment: 106
Effective length of query: 433
Effective length of database: 12,926,601
Effective search space: 5597218233
Effective search space used: 5597218233
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 64 (29.3 bits)