Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Sklu_2430.457157130350.0
Kwal_26.762857057124660.0
Scas_721.12356957124270.0
CAGL0K07480g56756924070.0
KLLA0B12694g56857123870.0
YMR105C (PGM2)56957123750.0
YKL127W (PGM1)57057123470.0
CAGL0K03421g56856823350.0
Scas_717.7056957123250.0
ABL029W56857122840.0
ABL126W6245731328e-08
Kwal_27.102586204541023e-04
CAGL0M02981g617128870.017
Scas_696.42625380810.090
KLLA0D01573g607304780.24
Sklu_1994.2624456770.32
YMR278W622130760.35
Kwal_14.86828271711.1
Sklu_2344.2854132702.2
KLLA0F14861g58947692.3
Scas_608.7521128657.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Sklu_2430.4
         (571 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Sklu_2430.4 YMR105C, Contig c2430 6115-7830                          1173   0.0  
Kwal_26.7628                                                          954   0.0  
Scas_721.123                                                          939   0.0  
CAGL0K07480g complement(739633..741336) highly similar to sp|P37...   931   0.0  
KLLA0B12694g 1107696..1109402 highly similar to sp|P37012 Saccha...   924   0.0  
YMR105C (PGM2) [4062] chr13 complement(475896..477605) Phosphogl...   919   0.0  
YKL127W (PGM1) [3139] chr11 (203187..204899) Phosphoglucomutase,...   908   0.0  
CAGL0K03421g complement(313851..315557) highly similar to sp|P37...   904   0.0  
Scas_717.70                                                           900   0.0  
ABL029W [563] [Homologous to ScYKL127W (PGM1) - SH; ScYMR105C (P...   884   0.0  
ABL126W [466] [Homologous to ScYMR278W - SH] complement(159209.....    55   8e-08
Kwal_27.10258                                                          44   3e-04
CAGL0M02981g 335863..337716 similar to sp|Q03262 Saccharomyces c...    38   0.017
Scas_696.42                                                            36   0.090
KLLA0D01573g complement(139183..141006) similar to sp|Q03262 Sac...    35   0.24 
Sklu_1994.2 YMR278W, Contig c1994 3654-5528                            34   0.32 
YMR278W (YMR278W) [4232] chr13 (822762..824630) Protein containi...    34   0.35 
Kwal_14.868                                                            32   1.1  
Sklu_2344.2 YDR359C, Contig c2344 749-3313 reverse complement          32   2.2  
KLLA0F14861g 1375042..1376811 some similarities with sp|Q00539 S...    31   2.3  
Scas_608.7                                                             30   7.6  

>Sklu_2430.4 YMR105C, Contig c2430 6115-7830
          Length = 571

 Score = 1173 bits (3035), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 571/571 (100%), Positives = 571/571 (100%)

Query: 1   MSFKIETIPTTPYTDQKPGTSGLRKKTKVFMEEPNYTENFIQAVMDAIPEGSQDATLVVG 60
           MSFKIETIPTTPYTDQKPGTSGLRKKTKVFMEEPNYTENFIQAVMDAIPEGSQDATLVVG
Sbjct: 1   MSFKIETIPTTPYTDQKPGTSGLRKKTKVFMEEPNYTENFIQAVMDAIPEGSQDATLVVG 60

Query: 61  GDGRFYNDVVVQKIAAIGAANGVHKLVIGQNGILSTPAASHIIRTYPHAKITGGIILTAS 120
           GDGRFYNDVVVQKIAAIGAANGVHKLVIGQNGILSTPAASHIIRTYPHAKITGGIILTAS
Sbjct: 61  GDGRFYNDVVVQKIAAIGAANGVHKLVIGQNGILSTPAASHIIRTYPHAKITGGIILTAS 120

Query: 121 HNPGGAKNDFGIKYNLSNGGPAPESVTNKIFEKSKQLTSYKIVANFPQLDLSKKGTDQRY 180
           HNPGGAKNDFGIKYNLSNGGPAPESVTNKIFEKSKQLTSYKIVANFPQLDLSKKGTDQRY
Sbjct: 121 HNPGGAKNDFGIKYNLSNGGPAPESVTNKIFEKSKQLTSYKIVANFPQLDLSKKGTDQRY 180

Query: 181 GPLLVDIIDSTEAYVKLMKSIFDFDLIKKFIKTQKETVGFKLLFDSLNGVTGPYGKALFV 240
           GPLLVDIIDSTEAYVKLMKSIFDFDLIKKFIKTQKETVGFKLLFDSLNGVTGPYGKALFV
Sbjct: 181 GPLLVDIIDSTEAYVKLMKSIFDFDLIKKFIKTQKETVGFKLLFDSLNGVTGPYGKALFV 240

Query: 241 DELGLSAEESLQNYVPKPDFGGLHPDPNLTYAHTLVERVDKDKIAFGAASDGDGDRNMIY 300
           DELGLSAEESLQNYVPKPDFGGLHPDPNLTYAHTLVERVDKDKIAFGAASDGDGDRNMIY
Sbjct: 241 DELGLSAEESLQNYVPKPDFGGLHPDPNLTYAHTLVERVDKDKIAFGAASDGDGDRNMIY 300

Query: 301 GYGPAFVSPGDSVAIIAEYASEIPYFAKQGIYGLARSFPTSAAIDRVAKAHGLNCYEVPT 360
           GYGPAFVSPGDSVAIIAEYASEIPYFAKQGIYGLARSFPTSAAIDRVAKAHGLNCYEVPT
Sbjct: 301 GYGPAFVSPGDSVAIIAEYASEIPYFAKQGIYGLARSFPTSAAIDRVAKAHGLNCYEVPT 360

Query: 361 GWKFFCALFDAKKLSICGEESFGTGSNHVREKDGVWAIMAWLNILAIYNRKNPTKEASIK 420
           GWKFFCALFDAKKLSICGEESFGTGSNHVREKDGVWAIMAWLNILAIYNRKNPTKEASIK
Sbjct: 361 GWKFFCALFDAKKLSICGEESFGTGSNHVREKDGVWAIMAWLNILAIYNRKNPTKEASIK 420

Query: 421 TIQEEFWNKYGRTFFTRYDFEQIASENADKVIQLLHNFVSKKDSVVNKAFPAATDLTVVD 480
           TIQEEFWNKYGRTFFTRYDFEQIASENADKVIQLLHNFVSKKDSVVNKAFPAATDLTVVD
Sbjct: 421 TIQEEFWNKYGRTFFTRYDFEQIASENADKVIQLLHNFVSKKDSVVNKAFPAATDLTVVD 480

Query: 481 AGDFSYTDLDGSVSSNQGLFVKLSNGCKFVVRLSGTGSSGATIRLYVERYSDNKSDYSLT 540
           AGDFSYTDLDGSVSSNQGLFVKLSNGCKFVVRLSGTGSSGATIRLYVERYSDNKSDYSLT
Sbjct: 481 AGDFSYTDLDGSVSSNQGLFVKLSNGCKFVVRLSGTGSSGATIRLYVERYSDNKSDYSLT 540

Query: 541 ADQFLGNDIKHVLQFLKFKEFLGTDEPTVRT 571
           ADQFLGNDIKHVLQFLKFKEFLGTDEPTVRT
Sbjct: 541 ADQFLGNDIKHVLQFLKFKEFLGTDEPTVRT 571

>Kwal_26.7628
          Length = 570

 Score =  954 bits (2466), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 455/571 (79%), Positives = 507/571 (88%), Gaps = 1/571 (0%)

Query: 1   MSFKIETIPTTPYTDQKPGTSGLRKKTKVFMEEPNYTENFIQAVMDAIPEGSQDATLVVG 60
           MS  IE++PT P+ DQKPGTSGLRKKTKVF +EP+YTENFIQA+++AIPEGS++ATLVVG
Sbjct: 1   MSLTIESVPTKPFDDQKPGTSGLRKKTKVFKDEPHYTENFIQAILEAIPEGSENATLVVG 60

Query: 61  GDGRFYNDVVVQKIAAIGAANGVHKLVIGQNGILSTPAASHIIRTYPHAKITGGIILTAS 120
           GDGR+YN+ V+Q I AI AANGV K+++GQNGILSTPAASHIIR+YP  K TGGIILTAS
Sbjct: 61  GDGRYYNNEVMQIIGAIAAANGVRKMILGQNGILSTPAASHIIRSYPE-KCTGGIILTAS 119

Query: 121 HNPGGAKNDFGIKYNLSNGGPAPESVTNKIFEKSKQLTSYKIVANFPQLDLSKKGTDQRY 180
           HNPGG +NDFGIKYNLSNGGPAPESVTN IFEKSKQLT YKIV NFP++D SK G DQ+Y
Sbjct: 120 HNPGGPENDFGIKYNLSNGGPAPESVTNAIFEKSKQLTHYKIVKNFPKIDFSKIGKDQKY 179

Query: 181 GPLLVDIIDSTEAYVKLMKSIFDFDLIKKFIKTQKETVGFKLLFDSLNGVTGPYGKALFV 240
           GPLLVD++DST  YV LMK IFDFDLIKKFI  Q+ T GFK+LFDSLNGVTGPYG+A+FV
Sbjct: 180 GPLLVDVVDSTADYVALMKEIFDFDLIKKFIDNQRSTKGFKILFDSLNGVTGPYGEAIFV 239

Query: 241 DELGLSAEESLQNYVPKPDFGGLHPDPNLTYAHTLVERVDKDKIAFGAASDGDGDRNMIY 300
            ELGL AEE LQNYVPKPDFGGLHPDPNLTYAHTLVERVDK++IAFGAASDGDGDRNMIY
Sbjct: 240 KELGLPAEEVLQNYVPKPDFGGLHPDPNLTYAHTLVERVDKEQIAFGAASDGDGDRNMIY 299

Query: 301 GYGPAFVSPGDSVAIIAEYASEIPYFAKQGIYGLARSFPTSAAIDRVAKAHGLNCYEVPT 360
           G GPAFVSPGDSVAIIAEYASEIPYF KQGIYGLARSFPTSAAIDRVAK  GL CYEVPT
Sbjct: 300 GCGPAFVSPGDSVAIIAEYASEIPYFKKQGIYGLARSFPTSAAIDRVAKEQGLACYEVPT 359

Query: 361 GWKFFCALFDAKKLSICGEESFGTGSNHVREKDGVWAIMAWLNILAIYNRKNPTKEASIK 420
           GWKFFCALFDAKKLSICGEESFGTGSNHVREKDGVWAI+AWLNILAIYNR +P  + SIK
Sbjct: 360 GWKFFCALFDAKKLSICGEESFGTGSNHVREKDGVWAIVAWLNILAIYNRDHPDSDVSIK 419

Query: 421 TIQEEFWNKYGRTFFTRYDFEQIASENADKVIQLLHNFVSKKDSVVNKAFPAATDLTVVD 480
            IQE+FW KYGRTFFTRYDFEQ++SE+A +V+Q+L + V+ KDS V K F     LTV D
Sbjct: 420 VIQEKFWAKYGRTFFTRYDFEQVSSESAAQVLQVLEDLVAAKDSSVGKPFAGNPALTVAD 479

Query: 481 AGDFSYTDLDGSVSSNQGLFVKLSNGCKFVVRLSGTGSSGATIRLYVERYSDNKSDYSLT 540
            GDFSYTDLDGSVS +QGL+ KLSNGC+FVVRLSGTGSSGATIRLYVE+Y+D+ S YSL 
Sbjct: 480 CGDFSYTDLDGSVSEHQGLYAKLSNGCRFVVRLSGTGSSGATIRLYVEKYTDDASKYSLD 539

Query: 541 ADQFLGNDIKHVLQFLKFKEFLGTDEPTVRT 571
            +QFLG+DIK +L+FLKF E+LGTDEPTVRT
Sbjct: 540 VEQFLGDDIKSILKFLKFCEYLGTDEPTVRT 570

>Scas_721.123
          Length = 569

 Score =  939 bits (2427), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 451/571 (78%), Positives = 504/571 (88%), Gaps = 2/571 (0%)

Query: 1   MSFKIETIPTTPYTDQKPGTSGLRKKTKVFMEEPNYTENFIQAVMDAIPEGSQDATLVVG 60
           MS +IETI T PY DQKPGTSGLRKKT +FM EPNYTENFIQA++DAIPEGSQDATLVVG
Sbjct: 1   MSLQIETIETKPYQDQKPGTSGLRKKTAIFMNEPNYTENFIQAMLDAIPEGSQDATLVVG 60

Query: 61  GDGRFYNDVVVQKIAAIGAANGVHKLVIGQNGILSTPAASHIIRTYPHAKITGGIILTAS 120
           GDGRFYNDV++ KIAAI AANGV KL+IGQNG+LSTPAASHIIR+Y   K+TGGIILTAS
Sbjct: 61  GDGRFYNDVIMNKIAAISAANGVKKLIIGQNGLLSTPAASHIIRSY-EEKVTGGIILTAS 119

Query: 121 HNPGGAKNDFGIKYNLSNGGPAPESVTNKIFEKSKQLTSYKIVANFPQLDLSKKGTDQRY 180
           HNPGG +ND GIKYNL+NGGPAPESVTN I+E SK+LT YKI+ NFP LDLSK G DQ+Y
Sbjct: 120 HNPGGPENDLGIKYNLANGGPAPESVTNAIWEVSKKLTHYKIIKNFPPLDLSKMGKDQKY 179

Query: 181 GPLLVDIIDSTEAYVKLMKSIFDFDLIKKFIKTQKETVGFKLLFDSLNGVTGPYGKALFV 240
           GPLLVDIID T+ YV  +K IFDF+LIKKFI  Q+ET  +KLLFDSLNG+TGPYGKA+FV
Sbjct: 180 GPLLVDIIDVTKDYVDFLKEIFDFELIKKFIHKQRETKNWKLLFDSLNGITGPYGKAIFV 239

Query: 241 DELGLSAEESLQNYVPKPDFGGLHPDPNLTYAHTLVERVDKDKIAFGAASDGDGDRNMIY 300
           DE  L A E LQN+ PKPDFGGLHPDPNLTYA TLVERVD++KI FGAASDGDGDRNMIY
Sbjct: 240 DEFDLPANEVLQNWHPKPDFGGLHPDPNLTYAKTLVERVDREKIEFGAASDGDGDRNMIY 299

Query: 301 GYGPAFVSPGDSVAIIAEYASEIPYFAKQGIYGLARSFPTSAAIDRVAKAHGLNCYEVPT 360
           G GPAFVSPGDSVAIIAEYASEIPYF KQGIYGLARSFPTSAAIDRVAKAHGL+CYEVPT
Sbjct: 300 GAGPAFVSPGDSVAIIAEYASEIPYFVKQGIYGLARSFPTSAAIDRVAKAHGLSCYEVPT 359

Query: 361 GWKFFCALFDAKKLSICGEESFGTGSNHVREKDGVWAIMAWLNILAIYNRKNPTKEASIK 420
           GWKFFCALFDAKKLSICGEESFGTGSNH+REKDG+WAI+AWLN+LAIYN+ NP K+ASIK
Sbjct: 360 GWKFFCALFDAKKLSICGEESFGTGSNHIREKDGLWAIVAWLNVLAIYNKHNPEKDASIK 419

Query: 421 TIQEEFWNKYGRTFFTRYDFEQIASENADKVIQLLHNFVSKKDSVVNKAFPAATDLTVVD 480
           TIQEEFWNKYGRTFFTRYD+E I++E+A KV+ LL+NFVSK + V+  AFP    LTVVD
Sbjct: 420 TIQEEFWNKYGRTFFTRYDYEHISNEDASKVVDLLNNFVSKPN-VIGSAFPGDESLTVVD 478

Query: 481 AGDFSYTDLDGSVSSNQGLFVKLSNGCKFVVRLSGTGSSGATIRLYVERYSDNKSDYSLT 540
           AGDFSYTDLDGSVS +QGLF KLSNG + V+RLSGTGSSGATIR+YVE Y+D+K+ Y  +
Sbjct: 479 AGDFSYTDLDGSVSDHQGLFFKLSNGARIVLRLSGTGSSGATIRIYVENYTDDKTKYEES 538

Query: 541 ADQFLGNDIKHVLQFLKFKEFLGTDEPTVRT 571
           A  FL   IK V++FLKFKEF+GT+EPTVRT
Sbjct: 539 AQDFLAPTIKTVVKFLKFKEFIGTEEPTVRT 569

>CAGL0K07480g complement(739633..741336) highly similar to sp|P37012
           Saccharomyces cerevisiae YMR105c PGM2
           phosphoglucomutase, hypothetical start
          Length = 567

 Score =  931 bits (2407), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 446/569 (78%), Positives = 495/569 (86%), Gaps = 2/569 (0%)

Query: 3   FKIETIPTTPYTDQKPGTSGLRKKTKVFMEEPNYTENFIQAVMDAIPEGSQDATLVVGGD 62
            ++ET+PT PY DQKPGTSGLRKKTKVFMEEPNYTENFIQA+MDAIPEG++DA LVVGGD
Sbjct: 1   MQVETVPTKPYQDQKPGTSGLRKKTKVFMEEPNYTENFIQAIMDAIPEGAKDAVLVVGGD 60

Query: 63  GRFYNDVVVQKIAAIGAANGVHKLVIGQNGILSTPAASHIIRTYPHAKITGGIILTASHN 122
           GRFYNDV++QKIAAIGAANGV KL+IGQNG+LSTPAASH+IR+Y   K TGGIILTASHN
Sbjct: 61  GRFYNDVIMQKIAAIGAANGVRKLIIGQNGLLSTPAASHVIRSYAE-KCTGGIILTASHN 119

Query: 123 PGGAKNDFGIKYNLSNGGPAPESVTNKIFEKSKQLTSYKIVANFPQLDLSKKGTDQRYGP 182
           PGG +ND GIKYNL+NGGPAPE VTNK++E SKQLT YKI+ +FPQ+D SK G DQ+YGP
Sbjct: 120 PGGPENDLGIKYNLANGGPAPEPVTNKMWEVSKQLTHYKIIKDFPQVDFSKIGKDQQYGP 179

Query: 183 LLVDIIDSTEAYVKLMKSIFDFDLIKKFIKTQKETVGFKLLFDSLNGVTGPYGKALFVDE 242
           LLVDIID+TE YVK MK IFDF LIK+FI  Q+E   +KLLFDSLNG+TGPYGKA+FVDE
Sbjct: 180 LLVDIIDTTEDYVKFMKEIFDFKLIKEFIHKQREAKNWKLLFDSLNGITGPYGKAIFVDE 239

Query: 243 LGLSAEESLQNYVPKPDFGGLHPDPNLTYAHTLVERVDKDKIAFGAASDGDGDRNMIYGY 302
             L A+E LQN+ P+PDFGGLHPDPNLTYAHTLVERVD++KI FGAASDGDGDRNMIYG 
Sbjct: 240 FDLPADEVLQNWHPQPDFGGLHPDPNLTYAHTLVERVDREKIEFGAASDGDGDRNMIYGA 299

Query: 303 GPAFVSPGDSVAIIAEYASEIPYFAKQGIYGLARSFPTSAAIDRVAKAHGLNCYEVPTGW 362
           GPAFVSPGDSVAIIAEYA EIPYF KQGIYGLARSFPTS AIDRVAKA GLNCYEVPTGW
Sbjct: 300 GPAFVSPGDSVAIIAEYAKEIPYFQKQGIYGLARSFPTSGAIDRVAKAQGLNCYEVPTGW 359

Query: 363 KFFCALFDAKKLSICGEESFGTGSNHVREKDGVWAIMAWLNILAIYNRKNPTKEASIKTI 422
           KFFCALFDAKKLSICGEESFGTGSNH+REKDGVWAI AWLNILA+YN+ NP KEASIKTI
Sbjct: 360 KFFCALFDAKKLSICGEESFGTGSNHIREKDGVWAICAWLNILALYNKHNPEKEASIKTI 419

Query: 423 QEEFWNKYGRTFFTRYDFEQIASENADKVIQLLHNFVSKKDSVVNKAFPAATDLTVVDAG 482
           QEEFW KYGRTFFTRYD+E I +E A+KV+ LL  FV+   S  N  FP    LTV D G
Sbjct: 420 QEEFWAKYGRTFFTRYDYEGITTEKANKVVDLLDKFVNDPKS-KNAPFPGDESLTVSDCG 478

Query: 483 DFSYTDLDGSVSSNQGLFVKLSNGCKFVVRLSGTGSSGATIRLYVERYSDNKSDYSLTAD 542
           DFSYTDLDGSVS +QGLFVKLSNG +FV+RLSGTGS+GATIRLY+E YSD+KS Y+ +AD
Sbjct: 479 DFSYTDLDGSVSDHQGLFVKLSNGARFVLRLSGTGSAGATIRLYIEEYSDDKSTYTQSAD 538

Query: 543 QFLGNDIKHVLQFLKFKEFLGTDEPTVRT 571
           Q+L   IK V  FL FKE +GTDEPTVRT
Sbjct: 539 QYLQKMIKSVTSFLNFKELIGTDEPTVRT 567

>KLLA0B12694g 1107696..1109402 highly similar to sp|P37012
           Saccharomyces cerevisiae YMR105c PGM2
           phosphoglucomutase, major isoform, start by similarity
          Length = 568

 Score =  924 bits (2387), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 449/571 (78%), Positives = 499/571 (87%), Gaps = 3/571 (0%)

Query: 1   MSFKIETIPTTPYTDQKPGTSGLRKKTKVFMEEPNYTENFIQAVMDAIPEGSQDATLVVG 60
           MS K  ++ T PY DQKPGTSGLRKKTKVF E PNYTENFIQA+M+AIPEGSQ ATLV+G
Sbjct: 1   MSLKTVSVATNPYPDQKPGTSGLRKKTKVFEETPNYTENFIQAIMEAIPEGSQGATLVIG 60

Query: 61  GDGRFYNDVVVQKIAAIGAANGVHKLVIGQNGILSTPAASHIIRTYPHAKITGGIILTAS 120
           GDGR+YNDVV+QKIAAIG+ANGV K+VIG NGILSTPAASHIIR Y H K TGGIILTAS
Sbjct: 61  GDGRYYNDVVIQKIAAIGSANGVRKIVIGHNGILSTPAASHIIRAY-HEKCTGGIILTAS 119

Query: 121 HNPGGAKNDFGIKYNLSNGGPAPESVTNKIFEKSKQLTSYKIVANFPQLDLSKKGTDQRY 180
           HNPGG  NDFGIKYNL+NGGPAPESVTN I+ KS++LT YKIV +FP +DL+K G DQ+Y
Sbjct: 120 HNPGGPTNDFGIKYNLANGGPAPESVTNSIWHKSRELTHYKIVESFPAIDLTKIGQDQKY 179

Query: 181 GPLLVDIIDSTEAYVKLMKSIFDFDLIKKFIKTQKETVGFKLLFDSLNGVTGPYGKALFV 240
           G LLVDI+DST AYV+LMK IFDF LIK FI TQ +  GFK+LFD++NGVTGPYG+ALFV
Sbjct: 180 GDLLVDIVDSTAAYVELMKEIFDFPLIKSFIDTQAKN-GFKILFDAMNGVTGPYGEALFV 238

Query: 241 DELGLSAEESLQNYVPKPDFGGLHPDPNLTYAHTLVERVDKDKIAFGAASDGDGDRNMIY 300
            ELGL  E SLQNY PKPDFGGLHPDPNLTYAHTLVERVDK  I FGAASDGDGDRNMIY
Sbjct: 239 KELGL-PESSLQNYHPKPDFGGLHPDPNLTYAHTLVERVDKYGIQFGAASDGDGDRNMIY 297

Query: 301 GYGPAFVSPGDSVAIIAEYASEIPYFAKQGIYGLARSFPTSAAIDRVAKAHGLNCYEVPT 360
           G GPAFVSPGDSVAIIAEYAS IPYF KQGIYGLARSFPTS+AIDRVAK  GLNCYEVPT
Sbjct: 298 GAGPAFVSPGDSVAIIAEYASAIPYFKKQGIYGLARSFPTSSAIDRVAKEQGLNCYEVPT 357

Query: 361 GWKFFCALFDAKKLSICGEESFGTGSNHVREKDGVWAIMAWLNILAIYNRKNPTKEASIK 420
           GWKFFCALFDAKKLSICGEESFGTGSNHVREKDGVWAIMAWLNILAIYN++ P KEASIK
Sbjct: 358 GWKFFCALFDAKKLSICGEESFGTGSNHVREKDGVWAIMAWLNILAIYNQRFPNKEASIK 417

Query: 421 TIQEEFWNKYGRTFFTRYDFEQIASENADKVIQLLHNFVSKKDSVVNKAFPAATDLTVVD 480
           +IQ +FW KYGRTFFTRYDFE ++SE+A KVI LL N+V+  +S+    FPA   LTVV+
Sbjct: 418 SIQTDFWQKYGRTFFTRYDFENLSSEDAGKVILLLQNYVADPESIKGTKFPADDSLTVVE 477

Query: 481 AGDFSYTDLDGSVSSNQGLFVKLSNGCKFVVRLSGTGSSGATIRLYVERYSDNKSDYSLT 540
            GDFSYTDLDGSVSS+QGL+V+LSNG +FVVRLSGTGSSGATIRLYVERY+++ S Y  T
Sbjct: 478 GGDFSYTDLDGSVSSHQGLYVRLSNGVRFVVRLSGTGSSGATIRLYVERYTNDGSKYEQT 537

Query: 541 ADQFLGNDIKHVLQFLKFKEFLGTDEPTVRT 571
           A++FLG DIK +L+FLKFKE +GT+EPTVRT
Sbjct: 538 AEEFLGKDIKTILKFLKFKEAIGTEEPTVRT 568

>YMR105C (PGM2) [4062] chr13 complement(475896..477605)
           Phosphoglucomutase, major isozyme, interconverts Glc-1-P
           and Glc-6-P [1710 bp, 569 aa]
          Length = 569

 Score =  919 bits (2375), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 438/571 (76%), Positives = 500/571 (87%), Gaps = 2/571 (0%)

Query: 1   MSFKIETIPTTPYTDQKPGTSGLRKKTKVFMEEPNYTENFIQAVMDAIPEGSQDATLVVG 60
           MSF+IET+PT PY DQKPGTSGLRKKTKVF +EPNYTENFIQ++M+AIPEGS+ ATLVVG
Sbjct: 1   MSFQIETVPTKPYEDQKPGTSGLRKKTKVFKDEPNYTENFIQSIMEAIPEGSKGATLVVG 60

Query: 61  GDGRFYNDVVVQKIAAIGAANGVHKLVIGQNGILSTPAASHIIRTYPHAKITGGIILTAS 120
           GDGR+YNDV++ KIAAIGAANG+ KLVIGQ+G+LSTPAASHI+RTY   K TGGIILTAS
Sbjct: 61  GDGRYYNDVILHKIAAIGAANGIKKLVIGQHGLLSTPAASHIMRTY-EEKCTGGIILTAS 119

Query: 121 HNPGGAKNDFGIKYNLSNGGPAPESVTNKIFEKSKQLTSYKIVANFPQLDLSKKGTDQRY 180
           HNPGG +ND GIKYNLSNGGPAPESVTN I+E SK+LTSYKI+ +FP+LDL   G +++Y
Sbjct: 120 HNPGGPENDMGIKYNLSNGGPAPESVTNAIWEISKKLTSYKIIKDFPELDLGTIGKNKKY 179

Query: 181 GPLLVDIIDSTEAYVKLMKSIFDFDLIKKFIKTQKETVGFKLLFDSLNGVTGPYGKALFV 240
           GPLLVDIID T+ YV  +K IFDFDLIKKFI  Q+ T  +KLLFDS+NGVTGPYGKA+FV
Sbjct: 180 GPLLVDIIDITKDYVNFLKEIFDFDLIKKFIDNQRSTKNWKLLFDSMNGVTGPYGKAIFV 239

Query: 241 DELGLSAEESLQNYVPKPDFGGLHPDPNLTYAHTLVERVDKDKIAFGAASDGDGDRNMIY 300
           DE GL A+E LQN+ P PDFGG+HPDPNLTYA +LV+RVD++KI FGAASDGDGDRNMIY
Sbjct: 240 DEFGLPADEVLQNWHPSPDFGGMHPDPNLTYASSLVKRVDREKIEFGAASDGDGDRNMIY 299

Query: 301 GYGPAFVSPGDSVAIIAEYASEIPYFAKQGIYGLARSFPTSAAIDRVAKAHGLNCYEVPT 360
           GYGP+FVSPGDSVAIIAEYA+EIPYFAKQGIYGLARSFPTS AIDRVAKAHGLNCYEVPT
Sbjct: 300 GYGPSFVSPGDSVAIIAEYAAEIPYFAKQGIYGLARSFPTSGAIDRVAKAHGLNCYEVPT 359

Query: 361 GWKFFCALFDAKKLSICGEESFGTGSNHVREKDGVWAIMAWLNILAIYNRKNPTKEASIK 420
           GWKFFCALFDAKKLSICGEESFGTGSNHVREKDGVWAIMAWLNILAIYN+ +P  EASIK
Sbjct: 360 GWKFFCALFDAKKLSICGEESFGTGSNHVREKDGVWAIMAWLNILAIYNKHHPENEASIK 419

Query: 421 TIQEEFWNKYGRTFFTRYDFEQIASENADKVIQLLHNFVSKKDSVVNKAFPAATDLTVVD 480
           TIQ EFW KYGRTFFTRYDFE++ +E A+K++  L  +V+ K  VVN AFPA   L V D
Sbjct: 420 TIQNEFWAKYGRTFFTRYDFEKVETEKANKIVDQLRAYVT-KSGVVNSAFPADESLKVTD 478

Query: 481 AGDFSYTDLDGSVSSNQGLFVKLSNGCKFVVRLSGTGSSGATIRLYVERYSDNKSDYSLT 540
            GDFSYTDLDGSVS +QGL+VKLSNG +FV+RLSGTGSSGATIRLY+E+Y D+KS Y  T
Sbjct: 479 CGDFSYTDLDGSVSDHQGLYVKLSNGARFVLRLSGTGSSGATIRLYIEKYCDDKSQYQKT 538

Query: 541 ADQFLGNDIKHVLQFLKFKEFLGTDEPTVRT 571
           A+++L   I  V++FL FK+ LGT+EPTVRT
Sbjct: 539 AEEYLKPIINSVIKFLNFKQVLGTEEPTVRT 569

>YKL127W (PGM1) [3139] chr11 (203187..204899) Phosphoglucomutase,
           minor isoform, interconverts Glc-1-P and Glc-6-P [1713
           bp, 570 aa]
          Length = 570

 Score =  908 bits (2347), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 434/571 (76%), Positives = 490/571 (85%), Gaps = 1/571 (0%)

Query: 1   MSFKIETIPTTPYTDQKPGTSGLRKKTKVFMEEPNYTENFIQAVMDAIPEGSQDATLVVG 60
           MS  I+++PT  Y DQKPGTSGLRKKTKVFM+EP+YTENFIQA M +IP GS+  TLVVG
Sbjct: 1   MSLLIDSVPTVAYKDQKPGTSGLRKKTKVFMDEPHYTENFIQATMQSIPNGSEGTTLVVG 60

Query: 61  GDGRFYNDVVVQKIAAIGAANGVHKLVIGQNGILSTPAASHIIRTYPHAKITGGIILTAS 120
           GDGRFYNDV++ KIAA+GAANGV KLVIGQ G+LSTPAASHIIRTY      GGIILTAS
Sbjct: 61  GDGRFYNDVIMNKIAAVGAANGVRKLVIGQGGLLSTPAASHIIRTYEEKCTGGGIILTAS 120

Query: 121 HNPGGAKNDFGIKYNLSNGGPAPESVTNKIFEKSKQLTSYKIVANFPQLDLSKKGTDQRY 180
           HNPGG +ND GIKYNL NGGPAPESVTN I+E SK+LT YKI+ NFP+L+L+K G +Q+Y
Sbjct: 121 HNPGGPENDLGIKYNLPNGGPAPESVTNAIWEASKKLTHYKIIKNFPKLNLNKLGKNQKY 180

Query: 181 GPLLVDIIDSTEAYVKLMKSIFDFDLIKKFIKTQKETVGFKLLFDSLNGVTGPYGKALFV 240
           GPLLVDIID  +AYV+ +K IFDFDLIK F+  Q++  G+KLLFDSLNG+TGPYGKA+FV
Sbjct: 181 GPLLVDIIDPAKAYVQFLKEIFDFDLIKSFLAKQRKDKGWKLLFDSLNGITGPYGKAIFV 240

Query: 241 DELGLSAEESLQNYVPKPDFGGLHPDPNLTYAHTLVERVDKDKIAFGAASDGDGDRNMIY 300
           DE GL AEE LQN+ P PDFGGLHPDPNLTYA TLV+RVD++KIAFGAASDGDGDRNMIY
Sbjct: 241 DEFGLPAEEVLQNWHPLPDFGGLHPDPNLTYARTLVDRVDREKIAFGAASDGDGDRNMIY 300

Query: 301 GYGPAFVSPGDSVAIIAEYASEIPYFAKQGIYGLARSFPTSAAIDRVAKAHGLNCYEVPT 360
           GYGPAFVSPGDSVAIIAEYA EIPYFAKQGIYGLARSFPTS+AIDRVA   GL CYEVPT
Sbjct: 301 GYGPAFVSPGDSVAIIAEYAPEIPYFAKQGIYGLARSFPTSSAIDRVAAKKGLRCYEVPT 360

Query: 361 GWKFFCALFDAKKLSICGEESFGTGSNHVREKDGVWAIMAWLNILAIYNRKNPTKEASIK 420
           GWKFFCALFDAKKLSICGEESFGTGSNH+REKDG+WAI+AWLNILAIY+R+NP KEASIK
Sbjct: 361 GWKFFCALFDAKKLSICGEESFGTGSNHIREKDGLWAIIAWLNILAIYHRRNPEKEASIK 420

Query: 421 TIQEEFWNKYGRTFFTRYDFEQIASENADKVIQLLHNFVSKKDSVVNKAFPAATDLTVVD 480
           TIQ+EFWN+YGRTFFTRYD+E I  E A+KV+ LL  FVS+ + V    FPA   LTV+D
Sbjct: 421 TIQDEFWNEYGRTFFTRYDYEHIECEQAEKVVALLSEFVSRPN-VCGSHFPADESLTVID 479

Query: 481 AGDFSYTDLDGSVSSNQGLFVKLSNGCKFVVRLSGTGSSGATIRLYVERYSDNKSDYSLT 540
            GDFSY DLDGS+S NQGLFVK SNG KFV+RLSGTGSSGATIRLYVE+Y+D K +Y  T
Sbjct: 480 CGDFSYRDLDGSISENQGLFVKFSNGTKFVLRLSGTGSSGATIRLYVEKYTDKKENYGQT 539

Query: 541 ADQFLGNDIKHVLQFLKFKEFLGTDEPTVRT 571
           AD FL   I  +++FL+FKE LGTDEPTVRT
Sbjct: 540 ADVFLKPVINSIVKFLRFKEILGTDEPTVRT 570

>CAGL0K03421g complement(313851..315557) highly similar to sp|P37012
           Saccharomyces cerevisiae YMR105c Phosphoglucomutase 2,
           start by similarity
          Length = 568

 Score =  904 bits (2335), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 428/568 (75%), Positives = 503/568 (88%), Gaps = 2/568 (0%)

Query: 4   KIETIPTTPYTDQKPGTSGLRKKTKVFMEEPNYTENFIQAVMDAIPEGSQDATLVVGGDG 63
           +IE++PT PY DQKPGTSGLRKKTKVF ++PNY ENFIQ+VM+AIPEG++ A LVVGGDG
Sbjct: 3   QIESVPTKPYQDQKPGTSGLRKKTKVFEDQPNYVENFIQSVMEAIPEGAKGAVLVVGGDG 62

Query: 64  RFYNDVVVQKIAAIGAANGVHKLVIGQNGILSTPAASHIIRTYPHAKITGGIILTASHNP 123
           R+YNDV++QKIAAIGAANGV KLVIGQNG+LSTPAASHI+RTY   K TGGIILTASHNP
Sbjct: 63  RYYNDVILQKIAAIGAANGVKKLVIGQNGLLSTPAASHIMRTYKE-KCTGGIILTASHNP 121

Query: 124 GGAKNDFGIKYNLSNGGPAPESVTNKIFEKSKQLTSYKIVANFPQLDLSKKGTDQRYGPL 183
           GG +ND GIKYNLSNGGPAPE VTNKI+E SK+LT YKIV +FP+LDL+K   +++YGPL
Sbjct: 122 GGPENDMGIKYNLSNGGPAPEPVTNKIWEISKKLTHYKIVKDFPELDLTKLVENKKYGPL 181

Query: 184 LVDIIDSTEAYVKLMKSIFDFDLIKKFIKTQKETVGFKLLFDSLNGVTGPYGKALFVDEL 243
           LVD+ID+T+AY++L+K IFDF+LI KFI  Q++  G+KLL DS+NGVTGPY KA+FVDE 
Sbjct: 182 LVDVIDTTDAYIQLLKEIFDFELIHKFIAKQRKEKGWKLLVDSMNGVTGPYAKAIFVDEF 241

Query: 244 GLSAEESLQNYVPKPDFGGLHPDPNLTYAHTLVERVDKDKIAFGAASDGDGDRNMIYGYG 303
           GL ++E LQN+ P+PDFGGLHPDPNLTYAHTLVERV+K+KI FGAASDGDGDRNMIYGYG
Sbjct: 242 GLDSKEVLQNWHPQPDFGGLHPDPNLTYAHTLVERVNKEKIEFGAASDGDGDRNMIYGYG 301

Query: 304 PAFVSPGDSVAIIAEYASEIPYFAKQGIYGLARSFPTSAAIDRVAKAHGLNCYEVPTGWK 363
           PAFVSPGDSVAIIAEYA+EIPYF KQGIYGLARSFPT++AIDRVAK HGLNCYEVPTGWK
Sbjct: 302 PAFVSPGDSVAIIAEYANEIPYFKKQGIYGLARSFPTASAIDRVAKKHGLNCYEVPTGWK 361

Query: 364 FFCALFDAKKLSICGEESFGTGSNHVREKDGVWAIMAWLNILAIYNRKNPTKEASIKTIQ 423
           FFCALFDAKKLSICGEESFGTGSNHVREKDG+WAIMAWLNILAI+N+++P KEASIKTIQ
Sbjct: 362 FFCALFDAKKLSICGEESFGTGSNHVREKDGIWAIMAWLNILAIFNQRHPDKEASIKTIQ 421

Query: 424 EEFWNKYGRTFFTRYDFEQIASENADKVIQLLHNFVSKKDSVVNKAFPAATDLTVVDAGD 483
            EFW+ YGRTFFTRYD+E++ ++ A+KVI+ L  +V+   +  +K FP  + LTVVDAGD
Sbjct: 422 NEFWDTYGRTFFTRYDYEKVETDKANKVIENLRQYVADSGTKGSK-FPTDSALTVVDAGD 480

Query: 484 FSYTDLDGSVSSNQGLFVKLSNGCKFVVRLSGTGSSGATIRLYVERYSDNKSDYSLTADQ 543
           FSYTDLDG++SS+QGL+V LSNG +FVVRLSGTGSSGATIRLY+ERY+D+KS YSL A +
Sbjct: 481 FSYTDLDGTISSHQGLYVILSNGARFVVRLSGTGSSGATIRLYIERYTDDKSKYSLDAQE 540

Query: 544 FLGNDIKHVLQFLKFKEFLGTDEPTVRT 571
           +L   IK ++QFL  K  LGT+EPTVRT
Sbjct: 541 YLKPIIKSIVQFLDLKTILGTEEPTVRT 568

>Scas_717.70
          Length = 569

 Score =  900 bits (2325), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 428/571 (74%), Positives = 498/571 (87%), Gaps = 2/571 (0%)

Query: 1   MSFKIETIPTTPYTDQKPGTSGLRKKTKVFMEEPNYTENFIQAVMDAIPEGSQDATLVVG 60
           MSF+I+T+PT PY DQKPGTSGLRKKTK+F + PNYTENFIQA+MDAIPEGS+ ATLVVG
Sbjct: 1   MSFQIQTVPTKPYQDQKPGTSGLRKKTKIFKDTPNYTENFIQAIMDAIPEGSKGATLVVG 60

Query: 61  GDGRFYNDVVVQKIAAIGAANGVHKLVIGQNGILSTPAASHIIRTYPHAKITGGIILTAS 120
           GDGR+YNDV++ KIAAIGAANGV KLVIGQ G+LSTPAASHI+RTY   K  GGIILTAS
Sbjct: 61  GDGRYYNDVILHKIAAIGAANGVKKLVIGQRGLLSTPAASHIMRTY-EEKTQGGIILTAS 119

Query: 121 HNPGGAKNDFGIKYNLSNGGPAPESVTNKIFEKSKQLTSYKIVANFPQLDLSKKGTDQRY 180
           HNPGG KND GIK+NLSNGGPAPE VTNKI+E SK++TS+KI+ +FP+L+L   G +++Y
Sbjct: 120 HNPGGIKNDMGIKFNLSNGGPAPEPVTNKIWEISKKMTSFKIIKDFPELELETLGKNKKY 179

Query: 181 GPLLVDIIDSTEAYVKLMKSIFDFDLIKKFIKTQKETVGFKLLFDSLNGVTGPYGKALFV 240
           GPLLVD+ID+T+AYV+ +K IFDFDLIKKF+  Q++T  +KLLFD +NGVTGPYGKA+FV
Sbjct: 180 GPLLVDVIDTTKAYVEFVKQIFDFDLIKKFVHKQRDTKHWKLLFDGMNGVTGPYGKAIFV 239

Query: 241 DELGLSAEESLQNYVPKPDFGGLHPDPNLTYAHTLVERVDKDKIAFGAASDGDGDRNMIY 300
           DELGL A+E LQ + P PDFGG+HPDPNLTYA  LV+RVD++ I FGAASDGDGDRNMIY
Sbjct: 240 DELGLPADEVLQQWHPSPDFGGVHPDPNLTYAKALVDRVDRENIEFGAASDGDGDRNMIY 299

Query: 301 GYGPAFVSPGDSVAIIAEYASEIPYFAKQGIYGLARSFPTSAAIDRVAKAHGLNCYEVPT 360
           G GPAFVSPGDSVAIIAEYA+EIPYFAKQGIYGLARSFPTS+AIDRVAKAHGLNCYEVPT
Sbjct: 300 GAGPAFVSPGDSVAIIAEYAAEIPYFAKQGIYGLARSFPTSSAIDRVAKAHGLNCYEVPT 359

Query: 361 GWKFFCALFDAKKLSICGEESFGTGSNHVREKDGVWAIMAWLNILAIYNRKNPTKEASIK 420
           GWKFFCALFDAKKLSICGEESFGTGSNHVREKDG+WAI+AWLN+LAIYN+ +P ++ SIK
Sbjct: 360 GWKFFCALFDAKKLSICGEESFGTGSNHVREKDGIWAILAWLNLLAIYNKHHPDRDVSIK 419

Query: 421 TIQEEFWNKYGRTFFTRYDFEQIASENADKVIQLLHNFVSKKDSVVNKAFPAATDLTVVD 480
            IQ+EFWNKYGRTFFTRYD+E++A+E+A KVI  L   V  K + VN  FP    LTVV+
Sbjct: 420 IIQDEFWNKYGRTFFTRYDYEKVATEDAAKVIDNLRKHVESK-TFVNHKFPTDESLTVVE 478

Query: 481 AGDFSYTDLDGSVSSNQGLFVKLSNGCKFVVRLSGTGSSGATIRLYVERYSDNKSDYSLT 540
           AGDFSYTDLDGSVS++QGLF KLSNG + VVRLSGTGSSGATIRLYVE+Y+D+KS Y   
Sbjct: 479 AGDFSYTDLDGSVSAHQGLFFKLSNGARVVVRLSGTGSSGATIRLYVEKYTDDKSVYGQN 538

Query: 541 ADQFLGNDIKHVLQFLKFKEFLGTDEPTVRT 571
           A  +L   I+ V++FL FKEF+GT+EPTVRT
Sbjct: 539 AQVYLKPVIQSVVKFLNFKEFIGTEEPTVRT 569

>ABL029W [563] [Homologous to ScYKL127W (PGM1) - SH; ScYMR105C
           (PGM2) - SH] complement(343852..345558) [1707 bp, 568
           aa]
          Length = 568

 Score =  884 bits (2284), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 420/571 (73%), Positives = 497/571 (87%), Gaps = 3/571 (0%)

Query: 1   MSFKIETIPTTPYTDQKPGTSGLRKKTKVFMEEPNYTENFIQAVMDAIPEGSQDATLVVG 60
           MS  IE++PT  + DQKPGTSGLRKKTKVF +  +YTENFIQA+M++IPEGS++A LV+G
Sbjct: 1   MSITIESVPTKAFADQKPGTSGLRKKTKVFEQTEHYTENFIQAIMESIPEGSENAVLVIG 60

Query: 61  GDGRFYNDVVVQKIAAIGAANGVHKLVIGQNGILSTPAASHIIRTYPHAKITGGIILTAS 120
           GDGR+YND V+QKIA +G+ANGV KL+IGQNG+LSTPAASHIIRTY H K+TGGIILTAS
Sbjct: 61  GDGRYYNDAVMQKIAEVGSANGVRKLIIGQNGLLSTPAASHIIRTY-HDKVTGGIILTAS 119

Query: 121 HNPGGAKNDFGIKYNLSNGGPAPESVTNKIFEKSKQLTSYKIVANFPQLDLSKKGTDQRY 180
           HNPGG  NDFGIKYNL+NG PAPE VTN +FE+S+ LT YKI    P+LDL K G +Q+Y
Sbjct: 120 HNPGGPDNDFGIKYNLANGAPAPEKVTNSMFERSRNLTHYKITRGMPKLDLGKIGENQQY 179

Query: 181 GPLLVDIIDSTEAYVKLMKSIFDFDLIKKFIKTQKETVGFKLLFDSLNGVTGPYGKALFV 240
           G LLVD+ID TEAYV+LMK IFDF LIKKF++  ++  G K+LFD+LNG+TGPYGKA+FV
Sbjct: 180 GNLLVDVIDPTEAYVRLMKEIFDFPLIKKFLEHAQKEYGLKVLFDALNGITGPYGKAIFV 239

Query: 241 DELGLSAEESLQNYVPKPDFGGLHPDPNLTYAHTLVERVDKDKIAFGAASDGDGDRNMIY 300
           DELGLS E+SLQN+VPKPDFGGLHPDPNLTYAHTLV RVD++ IAFGAASDGDGDRNMIY
Sbjct: 240 DELGLS-EDSLQNFVPKPDFGGLHPDPNLTYAHTLVSRVDRENIAFGAASDGDGDRNMIY 298

Query: 301 GYGPAFVSPGDSVAIIAEYASEIPYFAKQGIYGLARSFPTSAAIDRVAKAHGLNCYEVPT 360
           G GPAFVSPGDSVAIIAEYASEIPYF K GI+GLARSFPTS AID VAK   L+CYEVPT
Sbjct: 299 GAGPAFVSPGDSVAIIAEYASEIPYFIKNGIHGLARSFPTSGAIDLVAKEKNLDCYEVPT 358

Query: 361 GWKFFCALFDAKKLSICGEESFGTGSNHVREKDGVWAIMAWLNILAIYNRKNPTKEASIK 420
           GWKFFC LFD+KKLSICGEESFGTGS+HVREKDG+WAI+AWLN+LAIY+R++P +E SIK
Sbjct: 359 GWKFFCNLFDSKKLSICGEESFGTGSDHVREKDGLWAIVAWLNVLAIYHRRHPDREPSIK 418

Query: 421 TIQEEFWNKYGRTFFTRYDFEQIASENADKVIQLLHNFVSKKDSVVNKAFPAATDLTVVD 480
           TIQEEFW KYGRTFFTRYDFE+  +E+A+KVI+LL  F ++  +VV + FPA  +++V  
Sbjct: 419 TIQEEFWAKYGRTFFTRYDFEECDTEDANKVIELLRTF-AENPAVVGQPFPAWHEVSVSA 477

Query: 481 AGDFSYTDLDGSVSSNQGLFVKLSNGCKFVVRLSGTGSSGATIRLYVERYSDNKSDYSLT 540
           AGDFSYTDLDGSVS +QGL++KLSNG ++VVRLSGTGSSGATIRLYVERY+++ + Y+ T
Sbjct: 478 AGDFSYTDLDGSVSEHQGLYIKLSNGTRYVVRLSGTGSSGATIRLYVERYTNDPAYYAQT 537

Query: 541 ADQFLGNDIKHVLQFLKFKEFLGTDEPTVRT 571
           ADQFL  DIK VL+FL+FK+ +GT+EPTVRT
Sbjct: 538 ADQFLAPDIKAVLKFLRFKDLIGTEEPTVRT 568

>ABL126W [466] [Homologous to ScYMR278W - SH]
           complement(159209..161083) [1875 bp, 624 aa]
          Length = 624

 Score = 55.5 bits (132), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 134/573 (23%), Positives = 231/573 (40%), Gaps = 92/573 (16%)

Query: 19  GTSGLRKKTKVFMEEPNYTENFIQA-------VMDAIPEGSQDATLVVGGDGRFYNDVVV 71
           GT+GLR + +      N T   IQA       +    P+   D  +V+G D RF++    
Sbjct: 55  GTAGLRARMEAGFSRMN-TLTVIQASQGLARYIKSQFPD---DLKVVIGHDHRFHSREFA 110

Query: 72  QKIAAIGAANGVHKLVIGQNGI---------LSTPAASHIIRTYPHAKITGGIILTASHN 122
           +  A I A   +   +   N +         + TP     I        + G+++TASHN
Sbjct: 111 E--ATIAAFLQLDYDIYYLNYVPPGSDEDVFVHTPMVPFAINNVEGGPTSCGVMITASHN 168

Query: 123 PGGAKNDFGIKYNLSNGGPAPESVTNKIFEKSKQLTSYKIVANFPQLDLSKKGTDQRYGP 182
           P   K D G K   +NG         +I     +L    I AN   L+   +  D +   
Sbjct: 169 P---KMDNGYKVYYANGC--------QIIPPHDELIGRHIDAN---LEPWTRAWDSK--A 212

Query: 183 LLVDIIDSTEAYVKLMKSIFDF-DLIKKFIKTQ---KETVGFKLLFDSLNGVTGPYGKAL 238
           L+ + I S + +    + +  + D I+  +  Q   K   G   ++  ++GV   + K  
Sbjct: 213 LIEEAIKSGKLHDVRKEMLQKYKDSIQTMLVKQSNLKFAGGPWFVYTPMHGVGYEFFKEA 272

Query: 239 FVDELGLSAEESL-----QNYVPKPDFGGLH-PDPNLTYAHTLVERV-DKDKIAFGAASD 291
               LG+  ++       Q Y P P+F  +  P+P    A  +  +V D + I    A+D
Sbjct: 273 VASVLGIEEDKDYIVVPEQKY-PDPEFPTVSFPNPEERGALDMAMKVADANGITVVLAND 331

Query: 292 GDGDR--NMIYGYGPAFVSPGDSVAIIAEYASEIPYFAKQGI----YGLARSFPTSAAID 345
            D DR    +  +G      G+ + I+   A    YF +  +      +  S  +S  + 
Sbjct: 332 PDADRFSVAVKYHGEWNQLTGNQIGILFAQAEMQSYFKEPKLDRKQLAMLTSAVSSQLLR 391

Query: 346 RVAKAHGLNCYEVPTGWKFFCALFDAKKLSICG-------EESFG-TGSNHVREKDGVWA 397
           ++A+  G    E  TG+K+      A++L + G       EE+ G   S  V +KDG+ A
Sbjct: 392 KMAEEEGFLAVETLTGFKWLGN--RARELELEGYYVPFAYEEAIGYMFSQVVHDKDGIAA 449

Query: 398 IMAWLNILAIYNRKNPTKEASIKTIQEEFWNKYGRTFFTRYDFEQIASENADKVIQLLHN 457
              +L +   Y  K   K  S + + +E + KYG  +F  Y+   I+S  A  V + + +
Sbjct: 450 AAVFLQM--CYEWKKVAK--SSQEVLQECYEKYG--YFVDYNGYYISS--APAVTKEVFD 501

Query: 458 FVSKKDSVVNKAFPAAT----------DLTVVDAGDFSYTDLDGSVSSNQGLF------V 501
           +   + +   K +P+            DLTV    D +    D  V  N  +       V
Sbjct: 502 YFRNEYTPAGKPYPSHIGCEFEVEYLRDLTVGYQSDTATNIPDLPVDHNSQMITCVLKPV 561

Query: 502 KLSNGCKFVVRLSGTGS-SGATIRLYVERYSDN 533
           K+   C+  VR +  GS +   +++Y+E  + N
Sbjct: 562 KMETDCE-SVRFTARGSGTEPKLKVYIESCAAN 593

>Kwal_27.10258
          Length = 620

 Score = 43.9 bits (102), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 108/454 (23%), Positives = 183/454 (40%), Gaps = 73/454 (16%)

Query: 19  GTSGLRKKTKVFMEEPNYTENFIQA-------VMDAIPEGSQDATLVVGGDGRFYND--V 69
           GT+GLR K +      N T   +QA       + +  PE   + T+ VG D RF +    
Sbjct: 55  GTAGLRSKMEAGFSRMN-TLTVLQASQGLAKYIAEKFPE---NKTVAVGHDHRFNSRDFA 110

Query: 70  VVQKIAAIGAANGVHKLVIG----QNGILSTPAASHIIRTYPHAKITGGIILTASHNPGG 125
            V  +A +     V+ L       ++  + TP     I        + G+++TASHNP  
Sbjct: 111 EVTSVAFLQLRFKVYSLGFNADPKKDAFVHTPMVPFAID---RLGASAGVMITASHNP-- 165

Query: 126 AKNDFGIKYNLSNGGPAPESVTNKIFEKSKQLTSYKIVANFPQLDLSKKGTDQRYGPLLV 185
            K D G K   SNG         +I     +L +  I+ N   L+  ++  D +      
Sbjct: 166 -KMDNGYKVYYSNGC--------QIIPPHDRLIAQSILDN---LNPWERAWDCK-----A 208

Query: 186 DIIDSTEA--YVKLMKSIFDFDLIKKFIKTQKETVGFK----LLFDSLNGVTGPYGKALF 239
            I ++TE   +V + K + D  + +   K     +G +     ++  L+GV     + + 
Sbjct: 209 VIAEATEKGYFVDMKKPMVDHYVKEISDKLVSSDIGDRSKPWFVYTPLHGVGFEIFERIA 268

Query: 240 VDELGLSAEESL----QNYVPKPDFGGLH-PDPNLTYAHTL-VERVDKDKIAFGAASDGD 293
            + LGL          ++  P P F  +  P+P    A  L +   DK+ I+F   +D D
Sbjct: 269 SEVLGLVEGRDYWCVSEHKQPDPAFPTVSFPNPEEAGALDLAIALADKNGISFVLGNDPD 328

Query: 294 GDR--NMIYGYGPAFVSPGDSVAII------AEYASEIPYFAKQGIYGLARSFPTSAAID 345
            DR    +   G      G+ +  +       +Y  E   F  +    L  S  +S  I 
Sbjct: 329 ADRFSAAVKHQGKWRQLTGNEIGFLFAQFVWEKYQKESSEFKLENPLALINSTVSSQMIK 388

Query: 346 RVAKAHGLNCYEVPTGWKFFCALFDAKKLSICG-------EESFG-TGSNHVREKDGVWA 397
           ++A     +  +  TG+K+      A++L   G       EE+ G   S+ V +KDGV A
Sbjct: 389 KLAGVEKFHYEDTLTGFKWLGN--RARQLESSGYYVPFAYEEAIGFMFSDIVHDKDGVSA 446

Query: 398 IMAWLNILAIYNRKNPTKEASIKTIQEEFWNKYG 431
            + +L +L  + ++     + I  +Q  F  KYG
Sbjct: 447 AVVFLQMLWSWKKQ---ALSPIDVLQSAF-GKYG 476

>CAGL0M02981g 335863..337716 similar to sp|Q03262 Saccharomyces
           cerevisiae YMR278w, hypothetical start
          Length = 617

 Score = 38.1 bits (87), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 35/128 (27%), Positives = 55/128 (42%), Gaps = 16/128 (12%)

Query: 19  GTSGLRKKTKVFMEEPN------YTENFIQAVMDAIPEGSQDATLVVGGDGRFYNDVVVQ 72
           GT+GLR + +      N       ++     + D  P   Q+ T VVG D R+++    Q
Sbjct: 53  GTAGLRARMEAGTNRLNKLVILQASQGLATYIKDKFP---QNLTAVVGHDHRYHSQEFAQ 109

Query: 73  KIAAIGAANGVHKLVIG-QNGILSTPAASHIIRTYPHAKITGGIILTASHNPGGAKNDFG 131
             AA     G     +   +  + TP   + +    H   + G+++TASHNP   K D G
Sbjct: 110 VTAATFIRAGFKVYYLNPHDEFVHTPMVPYSVD---HLNASVGVMITASHNP---KMDNG 163

Query: 132 IKYNLSNG 139
            K   +NG
Sbjct: 164 YKVYYTNG 171

>Scas_696.42
          Length = 625

 Score = 35.8 bits (81), Expect = 0.090,   Method: Compositional matrix adjust.
 Identities = 86/380 (22%), Positives = 151/380 (39%), Gaps = 61/380 (16%)

Query: 19  GTSGLRKKTKVFMEEPNY------TENFIQAVMDAIPEGSQDATLVVGGDGRFYNDVVVQ 72
           GT+GLR + +      N       T+     + +  P    + T VVG D RF++     
Sbjct: 58  GTAGLRSRMEAGFSRMNSLIILQSTQGLANYIKEQFP---NNLTAVVGHDHRFHSKEFAI 114

Query: 73  KIAAIGAANGVHKLVIG-QNGILSTPAASHIIRTYPHAKITGGIILTASHNPGGAKNDFG 131
             A+I    G     +   +  + TP     +    + K + G+++TASHNP   K D G
Sbjct: 115 VTASIFLRAGFKVFYLTPDDQFVHTPLVPFSVL---NLKASVGVMITASHNP---KMDNG 168

Query: 132 IKYNLSNGG---PAPESVTNKIFEKSKQ--LTSYKIVANFPQLDLSKKGTDQRYGPLLVD 186
            K    N     P  +    ++ +K+ +   TS+   A F      KKG +      + D
Sbjct: 169 YKVYYDNACQIIPPHDKNIAEMIQKNLEPWSTSWDWDATF------KKGLETNKLVFIKD 222

Query: 187 IIDSTEAYVKLMKSIFDFDLIKKFIKTQKETVGFKLLFDSLNGVTGPYGKALF--VDELG 244
           ++  TE Y+  MK +    LI     + K+      ++  ++GV    G  +F  V    
Sbjct: 223 LM--TEKYLMQMKRV----LIHSSHLSLKDVKTPFFVYTPMHGV----GAEIFAKVSSEL 272

Query: 245 LSAEESL------QNYVPKPDFGGLH-PDPNLTYAHTL-VERVDKDKIAFGAASDGDGDR 296
           L+  E++      +  +P P F  +  P+P    A +L ++   ++ ++   A+D D DR
Sbjct: 273 LNLHENVDYLVVSEQRLPDPSFPTVSFPNPEEKGALSLAIKLAQENGLSLVIANDPDADR 332

Query: 297 ------NMIYGYGPAFVSPGDSVAIIAEYASEIPY------FAKQGIYGLARSFPTSAAI 344
                 N   G        G+ +  +  Y     Y      F K     +  S  +S  I
Sbjct: 333 FSAAVLNKKTGKWRQLT--GNEIGFLLGYYEFQLYEQQDVAFRKTHPLAMINSTVSSQMI 390

Query: 345 DRVAKAHGLNCYEVPTGWKF 364
            R+A  +G +  +  TG+K+
Sbjct: 391 KRMADMNGFHYEDTLTGFKW 410

>KLLA0D01573g complement(139183..141006) similar to sp|Q03262
           Saccharomyces cerevisiae YMR278w singleton, start by
           similarity
          Length = 607

 Score = 34.7 bits (78), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 77/304 (25%), Positives = 116/304 (38%), Gaps = 65/304 (21%)

Query: 19  GTSGLRKKTKVFMEEPNY------TENFIQAVMDAIPEGSQDATLVVGGD----GRFYND 68
           GT+GLR + +      N       ++   + +    PE   + T+VVG D     R +  
Sbjct: 57  GTAGLRGRMEAGFNRMNALTVKQASQGLAKYIKKQFPE---NLTVVVGHDHRHNSRLFGK 113

Query: 69  VVVQKIAAIGAANGVHKLVIGQNGILSTPAASHIIRTYPHAKITGGIILTASHNPGGAKN 128
           V V     +G     H     +  ++ TP     +        + GI++TASHNP   K 
Sbjct: 114 VTVDTFLQLGF-KVFHLNHENEKSLVHTPLVPFTVNA---TGASVGIMITASHNP---KM 166

Query: 129 DFGIKYNLSNGGPAPESVTNKIFEKSKQLTSYKIVANFPQLDLSKKGTDQRYGPLLVDII 188
           D G K   +NG         +I     +L +  I+ N       + GT          II
Sbjct: 167 DNGYKVYYTNGC--------QIIPPHDKLIAESIIHNLEPFSSPQTGT----------II 208

Query: 189 DSTEAYVK-----LMKSIFDFDLIKK-----FIKTQKETVGFKLLFDSLNGVTGPYGKAL 238
           D  E   K     +  ++ D  + KK     F+ T    VGF+ +F+S++       K L
Sbjct: 209 DCKEKMTKKYIDAIGSTLIDGAVNKKTNEPWFVYTPMHGVGFE-IFESIS-------KQL 260

Query: 239 FVDELG---LSAEESLQNYVPKPDFGGLH-PDPNLTYAHTLVERVDK--DKIAFGAASDG 292
              E G   L  EE  Q Y P  DF  +  P+P    A  L     +  D +    A+D 
Sbjct: 261 LSLEEGKDYLVVEE--QKY-PDADFPTVSFPNPEEKGALDLAVEYGRKNDTVDLIIANDP 317

Query: 293 DGDR 296
           D DR
Sbjct: 318 DADR 321

>Sklu_1994.2 YMR278W, Contig c1994 3654-5528
          Length = 624

 Score = 34.3 bits (77), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 103/456 (22%), Positives = 172/456 (37%), Gaps = 76/456 (16%)

Query: 19  GTSGLRKKTKVFMEEPNYTENFIQA-------VMDAIPEGSQDATLVVGGDGRFYNDVVV 71
           GT+GLR + +      N T   +QA       +    PE   + +++VG D R++++   
Sbjct: 55  GTAGLRSRMEAGFSRMN-TLTVLQASQGLASYIKSQFPE---NLSVIVGHDHRYHSNEFA 110

Query: 72  QKIAAIGAANGVHKLVIGQNGILSTPAASH---IIRTYPHAKITGGIILTASHNPGGAKN 128
           +         G     +  +   ST    H   +  T      + GI++TASHNP   K 
Sbjct: 111 RVTVTAFLQLGFKVYYLNLSSKDSTETFVHTPMVPFTINQLNASAGIMITASHNP---KM 167

Query: 129 DFGIKYNLSNGGPAPESVTNKIFEKSKQLTSYKIVANFPQLDLSKKGTDQRYGPLLVDII 188
           D G K   SNG                     +I+   P   L  +  DQ   P      
Sbjct: 168 DNGYKVYYSNGC--------------------QIIP--PHDRLISETIDQNLVP-WNKAW 204

Query: 189 DSTEAYVKLMKSIFDFD----LIKKFIKT-QKETVGFKLL--------FDSLNGVTGPYG 235
           D  E     ++S F FD    +  K+IKT   E V   +L        +  ++GV     
Sbjct: 205 DCDEVIKTAIESGFLFDVKEKVTSKYIKTVSDELVRVPMLDCDKPWFVYTPMHGVGFEIF 264

Query: 236 KALFVDELGLSAEESL----QNYVPKPDFGGLH-PDPNLTYAHTL-VERVDKDKIAFGAA 289
           + + +  LGL   +      +   P P F  +  P+P    A  L +   ++  I    A
Sbjct: 265 EQIALLALGLKEGKHYVCVPEQRCPDPAFPTVSFPNPEEKGALDLSIALAEEQDIRLVIA 324

Query: 290 SDGDGDR-NMIYGYGPAFVS-PGDSVAIIAEYASEIPY------FAKQGIYGLARSFPTS 341
           +D D DR ++    G  +    G+ +  +  Y     Y      F KQ    +  S  +S
Sbjct: 325 NDPDADRFSVAVKNGDRWSQLTGNEIGFLFAYYQWQDYQKLGESFKKQHPLAMINSTVSS 384

Query: 342 AAIDRVAKAHGLNCYEVPTGWKF-----FCALFDAKKLSICGEESFGTGSNHV-REKDGV 395
             I  +A+A   +  +  TG+K+     F        +    EE+ G     V  +KDG+
Sbjct: 385 QMIKSLAEAEKFHYEDTLTGFKWLGNRAFELETQGYYVPFAYEEAIGYMFPEVEHDKDGI 444

Query: 396 WAIMAWLNILAIYNRKNPTKEASIKTIQEEFWNKYG 431
            A + +L +   +  K+  +   ++ + E F  KYG
Sbjct: 445 SAAVVFLQMYCEWLSKD--RMTPLQVLDEGF-GKYG 477

>YMR278W (YMR278W) [4232] chr13 (822762..824630) Protein containing
           a phosphoglucomutase or phosphomannomutase
           alpha-beta-alpha domain I, has high similarity to
           uncharacterized C. albicans Orf6.8892p [1869 bp, 622 aa]
          Length = 622

 Score = 33.9 bits (76), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 41/130 (31%), Positives = 56/130 (43%), Gaps = 20/130 (15%)

Query: 19  GTSGLRKKTKVFMEEPNYTENFIQA-------VMDAIPEGSQDATLVVGGDGRFYNDVVV 71
           GT+GLR + +      N T   IQA       V    P+   +   VVG D RF++    
Sbjct: 56  GTAGLRSQMQAGFSRMN-TLVVIQASQGLATYVRQQFPD---NLVAVVGHDHRFHSKEFA 111

Query: 72  QKIAAIGAANG--VHKLVIGQNGILSTPAASHIIRTYPHAKITGGIILTASHNPGGAKND 129
           +  AA     G  VH L    +  + TP     +      K + G+++TASHNP   K D
Sbjct: 112 RATAAAFLLKGFKVHYLN-PDHEFVHTPLVPFAVDK---LKASVGVMITASHNP---KMD 164

Query: 130 FGIKYNLSNG 139
            G K   SNG
Sbjct: 165 NGYKVYYSNG 174

>Kwal_14.868
          Length = 282

 Score = 32.0 bits (71), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 18/71 (25%), Positives = 34/71 (47%)

Query: 86  LVIGQNGILSTPAASHIIRTYPHAKITGGIILTASHNPGGAKNDFGIKYNLSNGGPAPES 145
            V+G  G       ++++R Y    ++ G +L A  N  G+K    IK+ +  G   P+ 
Sbjct: 97  FVLGGPGAGKGTQCANLVRDYQFVHLSAGDLLRAEQNREGSKYGALIKHYIKEGLIVPQE 156

Query: 146 VTNKIFEKSKQ 156
           VT  + +++ Q
Sbjct: 157 VTVALLQQAIQ 167

>Sklu_2344.2 YDR359C, Contig c2344 749-3313 reverse complement
          Length = 854

 Score = 31.6 bits (70), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 30/132 (22%), Positives = 56/132 (42%), Gaps = 18/132 (13%)

Query: 47  AIPEGSQDATLVVGGDGRFYNDVVVQKIAAIGAANGVHKLVIGQNGILSTPAASHIIRTY 106
           A+P  ++ + L    D     D+ ++++A    A  V +    QN   ST    H+ R+ 
Sbjct: 666 AVPTPAEMSQLKAQRDDALRRDLQMRRVAKQRLAAAVQQQQQQQNASRSTTKQQHVPRSA 725

Query: 107 PHAKITGGIILTASHNPGGAKNDFGIKYNLSNGGPAPES--VTNKIFEKS--KQLTSYKI 162
           P         +T +  PG   N        ++  P  E   VT +  ++   KQLT  +I
Sbjct: 726 P---------ITNNSRPGSTSNSRQ-----ASSAPTTEEAKVTTQTPQQRPVKQLTEKEI 771

Query: 163 VANFPQLDLSKK 174
           + ++ +  L++K
Sbjct: 772 IESYARKILAQK 783

>KLLA0F14861g 1375042..1376811 some similarities with sp|Q00539
           Saccharomyces cerevisiae YHR086w NAM8 meiotic
           recombination protein, hypothetical start
          Length = 589

 Score = 31.2 bits (69), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 15/47 (31%), Positives = 25/47 (53%)

Query: 197 LMKSIFDFDLIKKFIKTQKETVGFKLLFDSLNGVTGPYGKALFVDEL 243
           L  ++ +  L + FI     T+  K++FD   GV+  YG   FV+E+
Sbjct: 157 LAPNVTEAQLFELFISRYSSTLNAKIVFDQFTGVSKGYGFVKFVNEM 203

>Scas_608.7
          Length = 521

 Score = 29.6 bits (65), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 29/128 (22%), Positives = 46/128 (35%), Gaps = 17/128 (13%)

Query: 40  FIQAVMDAIPEGSQDATLVVGGDGRFYNDVVVQKIAAIGAANGVHKLVIGQNGILSTPAA 99
            +Q  +DA+PE  +  T V                 A+ A  G+  L   ++  +     
Sbjct: 152 LLQVALDAVPEKKRSCTPV-----------------AVKATAGLRLLGDTKSAKILQAVR 194

Query: 100 SHIIRTYPHAKITGGIILTASHNPGGAKNDFGIKYNLSNGGPAPESVTNKIFEKSKQLTS 159
           SH+ + YP A + G  I   S +  G        Y L N G   +  T+ +F+     T 
Sbjct: 195 SHLEKDYPFAVVDGDGISIMSGDEEGVYAWVTTNYLLGNIGTGSKLATSAVFDLGGGSTQ 254

Query: 160 YKIVANFP 167
                 FP
Sbjct: 255 IVFEPTFP 262

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.317    0.136    0.397 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 19,695,137
Number of extensions: 901841
Number of successful extensions: 2218
Number of sequences better than 10.0: 28
Number of HSP's gapped: 2244
Number of HSP's successfully gapped: 28
Length of query: 571
Length of database: 16,596,109
Length adjustment: 107
Effective length of query: 464
Effective length of database: 12,891,983
Effective search space: 5981880112
Effective search space used: 5981880112
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 64 (29.3 bits)