Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Sklu_2430.1320620510961e-154
Kwal_26.76475651655876e-73
ABL020W6102055853e-72
CAGL0K03333g6022115688e-70
KLLA0B12892g6252085304e-64
YMR100W (MUB1)6201715228e-63
Scas_717.666121704982e-59
ACR073C87139700.51
Scas_594.71703113652.0
AGR004W85146652.2
KLLA0F26653g791108624.6
CAGL0F07733g72376615.5
CAGL0L04950g80541608.9
YMR049C (ERB1)80741608.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Sklu_2430.13
         (206 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Sklu_2430.13 YMR100W, Contig c2430 23178-23793                        426   e-154
Kwal_26.7647                                                          230   6e-73
ABL020W [572] [Homologous to ScYMR100W (MUB1) - SH] complement(3...   229   3e-72
CAGL0K03333g 302891..304699 similar to sp|Q03162 Saccharomyces c...   223   8e-70
KLLA0B12892g 1124666..1126543 weakly similar to sp|Q03162 Saccha...   208   4e-64
YMR100W (MUB1) [4058] chr13 (466299..468161) Zinc finger protein...   205   8e-63
Scas_717.66                                                           196   2e-59
ACR073C [1120] [Homologous to ScYHR028C (DAP2) - SH] (492979..49...    32   0.51 
Scas_594.7                                                             30   2.0  
AGR004W [4314] [Homologous to ScYFR002W (NIC96) - SH] complement...    30   2.2  
KLLA0F26653g 2461876..2464251 similar to sp|Q04660 Saccharomyces...    28   4.6  
CAGL0F07733g 753761..755932 similar to sp|P38920 Saccharomyces c...    28   5.5  
CAGL0L04950g complement(562491..564908) highly similar to sp|Q04...    28   8.9  
YMR049C (ERB1) [4011] chr13 complement(368093..370516) Protein w...    28   8.9  

>Sklu_2430.13 YMR100W, Contig c2430 23178-23793
          Length = 206

 Score =  426 bits (1096), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 205/205 (100%), Positives = 205/205 (100%)

Query: 1   MRECNHRSVLLNRASITITSTIYDRRALDCHSDVPLINSLNHLTYLASNSAKVRETIATD 60
           MRECNHRSVLLNRASITITSTIYDRRALDCHSDVPLINSLNHLTYLASNSAKVRETIATD
Sbjct: 1   MRECNHRSVLLNRASITITSTIYDRRALDCHSDVPLINSLNHLTYLASNSAKVRETIATD 60

Query: 61  GALERLVSILHGCYLPLHDLAFIEDRQHDSALLNVVKKKRLAVVAWKWTLAFQCLVLTGT 120
           GALERLVSILHGCYLPLHDLAFIEDRQHDSALLNVVKKKRLAVVAWKWTLAFQCLVLTGT
Sbjct: 61  GALERLVSILHGCYLPLHDLAFIEDRQHDSALLNVVKKKRLAVVAWKWTLAFQCLVLTGT 120

Query: 121 RGTESIRKEVVKSGIIPILATVLDNYLIYNRNYDYFKDKKLDSDFASVRYLEFTQHLNEQ 180
           RGTESIRKEVVKSGIIPILATVLDNYLIYNRNYDYFKDKKLDSDFASVRYLEFTQHLNEQ
Sbjct: 121 RGTESIRKEVVKSGIIPILATVLDNYLIYNRNYDYFKDKKLDSDFASVRYLEFTQHLNEQ 180

Query: 181 EFGDSRGEMQSKDPDFKEFWQRERA 205
           EFGDSRGEMQSKDPDFKEFWQRERA
Sbjct: 181 EFGDSRGEMQSKDPDFKEFWQRERA 205

>Kwal_26.7647
          Length = 565

 Score =  230 bits (587), Expect = 6e-73,   Method: Compositional matrix adjust.
 Identities = 108/165 (65%), Positives = 134/165 (81%)

Query: 1   MRECNHRSVLLNRASITITSTIYDRRALDCHSDVPLINSLNHLTYLASNSAKVRETIATD 60
           MR+CNHR VLLNR SITITS +YDRR LDC+S++PLINSLNHLTYL SNSAKVRET+A D
Sbjct: 1   MRDCNHRCVLLNRPSITITSAVYDRRGLDCNSEIPLINSLNHLTYLTSNSAKVRETVAND 60

Query: 61  GALERLVSILHGCYLPLHDLAFIEDRQHDSALLNVVKKKRLAVVAWKWTLAFQCLVLTGT 120
           GAL RLVSILH C +   +L  ++     + +  + ++++LA++AWKWTLAFQCLVLTGT
Sbjct: 61  GALIRLVSILHDCCISASELPRMQVTGALTLVEKIERERKLAMIAWKWTLAFQCLVLTGT 120

Query: 121 RGTESIRKEVVKSGIIPILATVLDNYLIYNRNYDYFKDKKLDSDF 165
           RGTE IRK+VV SG+IPILATVLDNYL+  +NYDY ++  L+ DF
Sbjct: 121 RGTEQIRKQVVSSGVIPILATVLDNYLLLEKNYDYLRNTPLEFDF 165

>ABL020W [572] [Homologous to ScYMR100W (MUB1) - SH]
           complement(359098..360930) [1833 bp, 610 aa]
          Length = 610

 Score =  229 bits (585), Expect = 3e-72,   Method: Compositional matrix adjust.
 Identities = 115/205 (56%), Positives = 151/205 (73%), Gaps = 2/205 (0%)

Query: 1   MRECNHRSVLLNRASITITSTIYDRRALDCHSDVPLINSLNHLTYLASNSAKVRETIATD 60
           MRE NHRSVL NRAS  I+ T+YDRRALD  +D+PLINSLNHLT+L S+SAKVRET++ D
Sbjct: 1   MRELNHRSVLSNRASFIISQTVYDRRALDNVADLPLINSLNHLTFLTSSSAKVRETMSED 60

Query: 61  GALERLVSILHGCYLPLHDLAF-IEDRQHDSALLNVVKKKRLAVVAWKWTLAFQCLVLTG 119
           GALERLVSILH CYL LHDL   +        + ++V+++++A+VAWKWTLAFQCLVLTG
Sbjct: 61  GALERLVSILHDCYLTLHDLCIGLHVGFRMGTVDSIVRQRKMAMVAWKWTLAFQCLVLTG 120

Query: 120 TRGTESIRKEVVKSGIIPILATVLDNYLIYNRNYDYFKDKKLDSDFASVRYLEFTQHLNE 179
           TRGT+ IRK+V  SG+IPI+ATVLDNY+IY++N+D+F+D+ ++ DF S+      Q L  
Sbjct: 121 TRGTQEIRKQVAHSGVIPIIATVLDNYMIYHKNFDFFRDEPIEFDFKSIASGNIFQ-LQP 179

Query: 180 QEFGDSRGEMQSKDPDFKEFWQRER 204
           +E      +M    P+ +     ER
Sbjct: 180 EEMESFFQKMDKSHPNLRLCINMER 204

>CAGL0K03333g 302891..304699 similar to sp|Q03162 Saccharomyces
           cerevisiae YMR100w involved in budding, start by
           similarity
          Length = 602

 Score =  223 bits (568), Expect = 8e-70,   Method: Compositional matrix adjust.
 Identities = 120/211 (56%), Positives = 153/211 (72%), Gaps = 15/211 (7%)

Query: 1   MRECNHRSVLLNRASITITSTIYDRRALDCHSDVPLINSLNHLTYLASNSAKVRETIATD 60
           MR+ NHRS+  N+  ITITST+YDRRALD  S VPLINSLNHLTYL SNSAK+RETIA D
Sbjct: 1   MRDSNHRSISNNKPVITITSTVYDRRALDIESTVPLINSLNHLTYLTSNSAKIRETIAND 60

Query: 61  GALERLVSILHGCYLPLH-----DLAFIEDRQHDSALLNVVKKKRLAVVAWKWTLAFQCL 115
           GAL+RLVSILH C+L LH     DL F   + H+ A  ++ K+KRLA+ AWKWTLAFQCL
Sbjct: 61  GALDRLVSILHNCHLSLHEILDKDLEFF--KTHERA-KSIYKRKRLALCAWKWTLAFQCL 117

Query: 116 VLTGTRGTESIRKEVVKSGIIPILATVLDNYLIYNRNYDYFKDKKLDSD------FASVR 169
           VLTGTRGTE IRK+VV +G+IP+LATVLDNY++++++YD+ +D+ LD +      F S +
Sbjct: 118 VLTGTRGTEQIRKKVVLAGVIPVLATVLDNYMLFHKHYDFIRDETLDFEIDEILTFDSYK 177

Query: 170 YL-EFTQHLNEQEFGDSRGEMQSKDPDFKEF 199
            L + ++   E+      G  + K  DFK F
Sbjct: 178 LLRKNSEETYEEYISYLIGRDKLKPTDFKRF 208

>KLLA0B12892g 1124666..1126543 weakly similar to sp|Q03162
           Saccharomyces cerevisiae YMR100w MUB1 involved in
           budding singleton, start by similarity
          Length = 625

 Score =  208 bits (530), Expect = 4e-64,   Method: Compositional matrix adjust.
 Identities = 108/208 (51%), Positives = 145/208 (69%), Gaps = 4/208 (1%)

Query: 1   MRECNHRSVLLNRASITITSTIYDRRALDCHSDVPLINSLNHLTYLASNSAKVRETIATD 60
           MRE N+RSV  NRA+++I+ T+YDRRALD  SD+PLINSLNHL +L S S  +RE ++ D
Sbjct: 1   MRETNYRSVTGNRATVSISQTVYDRRALDNVSDLPLINSLNHLAFLCSTSTLIREAMSRD 60

Query: 61  GALERLVSILHGCYLPLHDLA--FIEDRQHDSALLNVVKKKR-LAVVAWKWTLAFQCLVL 117
           GALERLVSILH CY+P+ +L    +   Q+ S  L  VK+ R LA ++WKWTLA+QCLVL
Sbjct: 61  GALERLVSILHECYIPITNLPQVMVSSAQNQSNPLQTVKRDRHLAYLSWKWTLAYQCLVL 120

Query: 118 TGTRGTESIRKEVVKSGIIPILATVLDNYLIYNRNYDYFKDKKLDSDFASVRYLEFTQ-H 176
           TGTRGT  IR++VVKSGIIPI+ATVLDNY+IY +N+D+  +  +   F+ +  L+     
Sbjct: 121 TGTRGTLGIREQVVKSGIIPIIATVLDNYMIYCKNFDFINNTAIPFTFSELADLDSDLFQ 180

Query: 177 LNEQEFGDSRGEMQSKDPDFKEFWQRER 204
             + E   S  ++  KD  +K+F   ER
Sbjct: 181 FTDDELRKSNEKVDPKDSYYKDFISMER 208

>YMR100W (MUB1) [4058] chr13 (466299..468161) Zinc finger protein,
           involved in the regulation of bud site selection [1863
           bp, 620 aa]
          Length = 620

 Score =  205 bits (522), Expect = 8e-63,   Method: Compositional matrix adjust.
 Identities = 103/171 (60%), Positives = 136/171 (79%), Gaps = 4/171 (2%)

Query: 1   MRECNHRSVLLNRASITITSTIYDRRALDCHSDVPLINSLNHLTYLASNSAKVRETIATD 60
           MR+ NHRS+  N+  +TITST+YDRRALD +S +PLINSLN+LTYL SNS+KVRET+A D
Sbjct: 1   MRDSNHRSLTSNKPIVTITSTVYDRRALDINSSIPLINSLNYLTYLTSNSSKVRETVAND 60

Query: 61  GALERLVSILHGCYLPLHDLAFIED---RQHDSALLNVVKKKRLAVVAWKWTLAFQCLVL 117
           GALERLVSIL  C+L L +L  ++     +H++ + ++ K+KRLA+ AWKWTL FQCLVL
Sbjct: 61  GALERLVSILRSCHLSLFELLDLDLENFNEHEN-IKDLWKEKRLALCAWKWTLTFQCLVL 119

Query: 118 TGTRGTESIRKEVVKSGIIPILATVLDNYLIYNRNYDYFKDKKLDSDFASV 168
           TGTRGTE IRK+VV SG++ +L TVLDNYL+Y++NYD+ KD+ +  DF  +
Sbjct: 120 TGTRGTEQIRKKVVMSGVLSVLVTVLDNYLLYHKNYDFIKDQTMTFDFKGI 170

>Scas_717.66
          Length = 612

 Score =  196 bits (498), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 95/170 (55%), Positives = 125/170 (73%), Gaps = 2/170 (1%)

Query: 1   MRECNHRSVLLNRASITITSTIYDRRALDCHSDVPLINSLNHLTYLASNSAKVRETIATD 60
           MR+ NHRSV  N+  I ITST YDRRALD +SD PL++SLNHLTY   NS K+RETIA D
Sbjct: 1   MRDSNHRSVTSNKPVIVITSTSYDRRALDVNSDRPLVSSLNHLTYQVCNSVKIRETIAND 60

Query: 61  GALERLVSILHGCYLPLHDLAFIEDRQHDSALL--NVVKKKRLAVVAWKWTLAFQCLVLT 118
           GA++R+VSIL  C+  L++L  +  R   +  +  ++ KKK+ A++ WKW L  QCLVLT
Sbjct: 61  GAMDRIVSILRSCHFSLYELLDLPLRHVSNHKMAQDIWKKKKQALMGWKWLLGLQCLVLT 120

Query: 119 GTRGTESIRKEVVKSGIIPILATVLDNYLIYNRNYDYFKDKKLDSDFASV 168
           GTRG E IR++V  +GIIPILAT+LDNYL+Y++NYDY K + L  DF ++
Sbjct: 121 GTRGPEDIRRKVFHAGIIPILATILDNYLLYHKNYDYMKGEPLSFDFKAL 170

>ACR073C [1120] [Homologous to ScYHR028C (DAP2) - SH]
           (492979..495597) [2619 bp, 872 aa]
          Length = 871

 Score = 31.6 bits (70), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 18/39 (46%), Positives = 21/39 (53%), Gaps = 2/39 (5%)

Query: 26  RALDCHSDVPLINSLNHLTYLASNSAKVRETIATDGALE 64
           RA D + DV  +N  NHL Y +  SA    TI T GA E
Sbjct: 449 RANDGYIDVVSVNGYNHLAYYSPPSAST--TIMTSGAWE 485

>Scas_594.7
          Length = 1703

 Score = 29.6 bits (65), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 25/113 (22%), Positives = 47/113 (41%), Gaps = 18/113 (15%)

Query: 41  NHLTYLASNSAKVRETIATDGALERLVSI--LHGCYLPLHDLAFIEDRQHDSALLNVVKK 98
           NHL  + ++   + +TI T   L  L     +HG YL +  L+ + +  ++ A       
Sbjct: 830 NHLNGILADEMGLGKTIQTISLLTYLYETKHIHGPYLVIVPLSTLSNWSNEFA------- 882

Query: 99  KRLAVVAWKWTLAFQCLVLTGTRGTESIRKEVVKSGIIPILATVLDNYLIYNR 151
                   KW    +C+   G+      +  ++KSG   ++ T  + Y+I  R
Sbjct: 883 --------KWAPTMRCISYKGSPNERKSKHAIIKSGEFDVVLTTFE-YIIKER 926

>AGR004W [4314] [Homologous to ScYFR002W (NIC96) - SH]
           complement(726899..729454) [2556 bp, 851 aa]
          Length = 851

 Score = 29.6 bits (65), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 15/46 (32%), Positives = 25/46 (54%)

Query: 139 LATVLDNYLIYNRNYDYFKDKKLDSDFASVRYLEFTQHLNEQEFGD 184
           L  V  ++L+Y + Y   KDK+L  +F +  + E+ QH+     GD
Sbjct: 367 LKKVEQSFLVYFKAYVSSKDKRLPQEFITRLHTEYNQHIKNSLDGD 412

>KLLA0F26653g 2461876..2464251 similar to sp|Q04660 Saccharomyces
           cerevisiae YMR049c singleton, start by similarity
          Length = 791

 Score = 28.5 bits (62), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 30/108 (27%), Positives = 43/108 (39%), Gaps = 29/108 (26%)

Query: 85  DRQHDSALLNVVKKKRLAVVAWKWTLAFQ-----CLVLTGTRGTESIRKEVVKSGIIPIL 139
           D + D A  + VKK+   V  W      Q     C+V+T        RK V K       
Sbjct: 541 DDEDDGAESHAVKKQ---VAQWNKPTERQAANDICIVIT-------CRKSVKK------- 583

Query: 140 ATVLDNYLIYNRNYDYFKDKKLDSDFASVRYLEFTQHLNEQEFGDSRG 187
                  L ++R  DYF   + DS   SV   + ++HL +  F  S+G
Sbjct: 584 -------LSWHRKGDYFVTVQPDSGNTSVLIHQLSKHLTQSPFKKSKG 624

>CAGL0F07733g 753761..755932 similar to sp|P38920 Saccharomyces
           cerevisiae YMR167w MLH1 DNA mismatch repair protein,
           hypothetical start
          Length = 723

 Score = 28.1 bits (61), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 20/76 (26%), Positives = 36/76 (47%), Gaps = 4/76 (5%)

Query: 36  LINSLNHLTYLASNS----AKVRETIATDGALERLVSILHGCYLPLHDLAFIEDRQHDSA 91
           +I+ +N L  +  NS    A + E +  DG ++ L    +GC + L DL  + +R   S 
Sbjct: 21  IISPVNALKEILENSIDAGATMLEILVRDGGIKLLQVSDNGCGIQLDDLPLLCERFATSK 80

Query: 92  LLNVVKKKRLAVVAWK 107
           L N    + +A   ++
Sbjct: 81  LTNFQDLENIATYGFR 96

>CAGL0L04950g complement(562491..564908) highly similar to sp|Q04660
           Saccharomyces cerevisiae YMR049c, start by similarity
          Length = 805

 Score = 27.7 bits (60), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 22/41 (53%)

Query: 147 LIYNRNYDYFKDKKLDSDFASVRYLEFTQHLNEQEFGDSRG 187
           L ++R  DYF   + DS   SV   + ++HL +  F  S+G
Sbjct: 598 LSWHRKGDYFVTVQPDSGNTSVLIHQLSKHLTQSPFRKSKG 638

>YMR049C (ERB1) [4011] chr13 complement(368093..370516) Protein with
           possible role in ribosome biogenesis, has similarity to
           mouse Bop1 growth suppressor, has five WD (WD-40)
           domains [2424 bp, 807 aa]
          Length = 807

 Score = 27.7 bits (60), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 22/41 (53%)

Query: 147 LIYNRNYDYFKDKKLDSDFASVRYLEFTQHLNEQEFGDSRG 187
           L ++R  DYF   + DS   SV   + ++HL +  F  S+G
Sbjct: 600 LSWHRKGDYFVTVQPDSGNTSVLIHQVSKHLTQSPFKKSKG 640

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.322    0.135    0.402 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 6,634,462
Number of extensions: 273330
Number of successful extensions: 730
Number of sequences better than 10.0: 18
Number of HSP's gapped: 725
Number of HSP's successfully gapped: 18
Length of query: 206
Length of database: 16,596,109
Length adjustment: 97
Effective length of query: 109
Effective length of database: 13,238,163
Effective search space: 1442959767
Effective search space used: 1442959767
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 59 (27.3 bits)