Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Sklu_2430.122572579211e-126
Scas_721.1302121874057e-49
Kwal_26.76482021793412e-39
YKL119C (VPH2)2151903013e-33
CAGL0K11594g2091882192e-21
KLLA0B12870g2051832166e-21
ABL021C2391111451e-10
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Sklu_2430.12
         (257 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Sklu_2430.12 YKL119C, Contig c2430 21414-22187 reverse complement     359   e-126
Scas_721.130                                                          160   7e-49
Kwal_26.7648                                                          135   2e-39
YKL119C (VPH2) [3146] chr11 complement(218216..218863) Vacuolar ...   120   3e-33
CAGL0K11594g 1121044..1121673 similar to sp|P32341 Saccharomyces...    89   2e-21
KLLA0B12870g complement(1123581..1124198) weakly similar to sp|P...    88   6e-21
ABL021C [571] [Homologous to ScYKL119C (VPH2) - SH] (358274..358...    60   1e-10

>Sklu_2430.12 YKL119C, Contig c2430 21414-22187 reverse complement
          Length = 257

 Score =  359 bits (921), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 191/257 (74%), Positives = 191/257 (74%)

Query: 1   MRKKKSLVRGEEAHNISSNNAITXXXXXXXXXXXXXXXXXXXXXXISNISEKEMFEIQLN 60
           MRKKKSLVRGEEAHNISSNNAIT                      ISNISEKEMFEIQLN
Sbjct: 1   MRKKKSLVRGEEAHNISSNNAITRRGRRRRRRRRRRRRRRRRRKRISNISEKEMFEIQLN 60

Query: 61  DELKELLNGIQPKECRVEELLQNDSIPIKLLLEYHLEYWSERPIXXXXXXXXXXXXXXYE 120
           DELKELLNGIQPKECRVEELLQNDSIPIKLLLEYHLEYWSERPI              YE
Sbjct: 61  DELKELLNGIQPKECRVEELLQNDSIPIKLLLEYHLEYWSERPISKLLSPLKFKFKEKYE 120

Query: 121 RGVNYSEEFKRQLEHLKLQQEENEYQEMIKRDGLGYLKENAEELTPSQMSKQIREQITTI 180
           RGVNYSEEFKRQLEHLKLQQEENEYQEMIKRDGLGYLKENAEELTPSQMSKQIREQITTI
Sbjct: 121 RGVNYSEEFKRQLEHLKLQQEENEYQEMIKRDGLGYLKENAEELTPSQMSKQIREQITTI 180

Query: 181 FNILLSVVSVVWAIWYWSSSSTRIATHNRIXXXXXXXXXXXXAEIVVYNSYLXXXXXXXX 240
           FNILLSVVSVVWAIWYWSSSSTRIATHNRI            AEIVVYNSYL        
Sbjct: 181 FNILLSVVSVVWAIWYWSSSSTRIATHNRIFLCLFFGVLVLVAEIVVYNSYLKKIEEAKI 240

Query: 241 XXXXXXXXXXVVQKIVI 257
                     VVQKIVI
Sbjct: 241 TERKKREKKTVVQKIVI 257

>Scas_721.130
          Length = 212

 Score =  160 bits (405), Expect = 7e-49,   Method: Compositional matrix adjust.
 Identities = 88/187 (47%), Positives = 115/187 (61%), Gaps = 8/187 (4%)

Query: 54  MFEIQLNDELKELLNGIQ-----PKECRVEELLQNDSIPIKLLLEYHLEYWSER-PIXXX 107
           MF+I+LN  LKE L  ++     P    ++ LL N  IP+K LL+YH EYW  + P+   
Sbjct: 1   MFDIKLNVPLKEALGELKEKAKDPLRKEIDTLLNNGYIPMKTLLKYHSEYWKNQIPMRQL 60

Query: 108 XXXXXXXXXXXYERGVNYSEEFKRQLEHLKLQQEENEYQEMIK--RDGLGYLKENAEELT 165
                      Y+ G  YS EFK+QLE LKL+QEE +YQ MIK  R  L  +KE  E LT
Sbjct: 61  LNPIEFQFKEKYQPGSTYSPEFKKQLETLKLKQEELDYQNMIKNERKTLQIIKEEGETLT 120

Query: 166 PSQMSKQIREQITTIFNILLSVVSVVWAIWYWSSSSTRIATHNRIXXXXXXXXXXXXAEI 225
           P+QM+KQI+EQ+TTIFNI +SV+SVV+AIWYW+ +S  +  H R+            AE+
Sbjct: 121 PAQMNKQIKEQVTTIFNIFVSVISVVFAIWYWTGTSAHMPVHYRLLLCIFTGILVLVAEV 180

Query: 226 VVYNSYL 232
           VVYNSYL
Sbjct: 181 VVYNSYL 187

>Kwal_26.7648
          Length = 202

 Score =  135 bits (341), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 76/179 (42%), Positives = 112/179 (62%), Gaps = 1/179 (0%)

Query: 54  MFEIQLNDELKELLNGIQPKECRVEELLQNDSIPIKLLLEYHLEYWSERPIXXXXXXXXX 113
           MFEI+LN +L   L  +   +   + +L   SI +K LL +  ++W +  I         
Sbjct: 1   MFEIKLNSKLTSQL-ALLADDGEAKAILDKGSISMKSLLSFCEKHWQDVAISELVTPLDF 59

Query: 114 XXXXXYERGVNYSEEFKRQLEHLKLQQEENEYQEMIKRDGLGYLKENAEELTPSQMSKQI 173
                 ERG +YSEEFK QLE L+L+QEE+EYQ M++RDGL    ++++  TP+Q++KQ+
Sbjct: 60  VYKTKRERGAHYSEEFKLQLERLRLEQEESEYQNMVRRDGLAVGLQDSDNQTPAQITKQV 119

Query: 174 REQITTIFNILLSVVSVVWAIWYWSSSSTRIATHNRIXXXXXXXXXXXXAEIVVYNSYL 232
           +EQITT+FNIL+SVVSVV+A+WYW+ SS  +   +R+            AE+VVY+SYL
Sbjct: 120 KEQITTVFNILVSVVSVVFAVWYWTGSSAGMRPQSRVLFCLFGGILVLVAEVVVYSSYL 178

>YKL119C (VPH2) [3146] chr11 complement(218216..218863) Vacuolar
           H(+)-ATPase (V-ATPase) assembly protein acting in the
           endoplasmic reticulum [648 bp, 215 aa]
          Length = 215

 Score =  120 bits (301), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 78/190 (41%), Positives = 114/190 (60%), Gaps = 11/190 (5%)

Query: 54  MFEIQLNDELKELL----NGIQPKECRVEEL---LQNDSIPIKLLLEYHLEYWSERPIXX 106
           MFEI+LND + E L    N  +  E   E++   L+  +IP++ LL Y  EY  +  +  
Sbjct: 1   MFEIKLNDRITEFLRKFKNSAKSNEGIDEDIDLFLKRHAIPMQSLLFYVKEYRKDSDLQC 60

Query: 107 XXXXXXXXXXXXYE----RGVNYSEEFKRQLEHLKLQQEENEYQEMIKRDGLGYLKENAE 162
                       ++    RG++YSE+FK++LE LK Q++E EYQ M+KR    +  +  +
Sbjct: 61  SIKELLKPLEFEFKPKAVRGLHYSEDFKKKLEFLKYQEQELEYQSMVKRSKSVFSLQEDD 120

Query: 163 ELTPSQMSKQIREQITTIFNILLSVVSVVWAIWYWSSSSTRIATHNRIXXXXXXXXXXXX 222
           ELTPSQ++KQI+EQ+TT+FN+L+SV+SVV AIWYW+ SST    H R+            
Sbjct: 121 ELTPSQINKQIKEQVTTVFNVLVSVISVVVAIWYWTGSSTNFPVHVRLLLCLFFGILVLV 180

Query: 223 AEIVVYNSYL 232
           A++VVYNSYL
Sbjct: 181 ADVVVYNSYL 190

>CAGL0K11594g 1121044..1121673 similar to sp|P32341 Saccharomyces
           cerevisiae YKL119c VPH2 H+-ATPase assembly protein,
           start by similarity
          Length = 209

 Score = 89.0 bits (219), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 65/188 (34%), Positives = 98/188 (52%), Gaps = 13/188 (6%)

Query: 54  MFEIQLNDELKELLNGIQPK---------ECRVEELLQNDSIPIKLLLEYHLEYWSERPI 104
           MFE+ +   L+  L               + R+ EL++  S+P   L E    + SE  +
Sbjct: 1   MFEVAVGSALRRALESAVEAAVAAGDGDAKVRLLELIERGSVPCGELAELCRAWGSEVSV 60

Query: 105 XXXXXXXXXXXXXXYERGVNYSEEFKRQLEHLKLQQEENEYQEMIKRDGLGYLKENAEEL 164
                           R    S EF+ QL  L+  Q+E EYQ+++K   L    E+  E 
Sbjct: 61  SEALSGLEFKFKDRETR--KPSPEFQAQLARLRALQQEQEYQQIVKNRDLAITTES--EA 116

Query: 165 TPSQMSKQIREQITTIFNILLSVVSVVWAIWYWSSSSTRIATHNRIXXXXXXXXXXXXAE 224
           TP+Q++++I+EQ+TT+FNI++SV+SVV AIWYWS +S  +A H+RI            AE
Sbjct: 117 TPAQINREIKEQVTTVFNIIISVISVVVAIWYWSRTSAGLAIHHRIFLCMFFGILVLVAE 176

Query: 225 IVVYNSYL 232
           +VVY+SYL
Sbjct: 177 VVVYSSYL 184

>KLLA0B12870g complement(1123581..1124198) weakly similar to
           sp|P32341 Saccharomyces cerevisiae YKL119c VPH2
           H+-ATPase assembly protein singleton, start by
           similarity
          Length = 205

 Score = 87.8 bits (216), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 57/183 (31%), Positives = 99/183 (54%), Gaps = 8/183 (4%)

Query: 54  MFEIQLNDEL-KELLNGIQPKECRVEELLQNDSIPIKLLLEYHLEYWSERPIXXXXXXXX 112
           MF+I +++ L ++ L  ++ ++ R    LQ +SI  +LL E + ++W +           
Sbjct: 1   MFDITIDEGLLRQRLEKLK-EDHRASLSLQQNSISFELLSELYQQFWRDDATVSMKQLLK 59

Query: 113 XXXXXXYER---GVNYSEEFKRQLEHLKLQQEENEYQEMIKRDGLGYLKENAE-ELTPSQ 168
                  E+   G  YSE FK +LE+LK  Q+E EYQEM+KRD L      A+ E + +Q
Sbjct: 60  SGKLRYKEKRVPGEGYSESFKAELENLKALQQEKEYQEMLKRDSLHLAGSTADKEPSIAQ 119

Query: 169 MSKQIREQITTIFNILLSVVSVVWAIWYWSSSSTRIATHNRIXXXXXXXXXXXXAEIVVY 228
           ++K+I+EQ++ + N+LL+V   ++A+WY + +   I  H R+            A++ +Y
Sbjct: 120 INKEIKEQVSAVVNVLLTVFGTIYAVWYVTRTGWDI--HVRVLLCLFSGLLVLTADVAMY 177

Query: 229 NSY 231
           N Y
Sbjct: 178 NVY 180

>ABL021C [571] [Homologous to ScYKL119C (VPH2) - SH]
           (358274..358993) [720 bp, 239 aa]
          Length = 239

 Score = 60.5 bits (145), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 27/111 (24%), Positives = 56/111 (50%), Gaps = 6/111 (5%)

Query: 121 RGVNYSEEFKRQLEHLKLQQEENEYQEMIKRDGLGYLKENAEELTPSQMSKQIREQITTI 180
           R  NYS+EF+ Q + L+    E+EY+ +      G +++  +       ++++REQ+  +
Sbjct: 112 RSSNYSDEFRAQQQRLRAAAAEDEYRALT-----GGMQQEQQRHGFGSAAREVREQLAAV 166

Query: 181 FNILLSVVSVVWAIWYWSSSSTRIATHNRIXXXXXXXXXXXXAEIVVYNSY 231
            N++L+VV V + +W W + +  +    R+            A++ +YN Y
Sbjct: 167 ANVVLTVVGVAYGVW-WVARAAGVGAEARVLLALGCGLTALVADVAMYNVY 216

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.314    0.131    0.364 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 6,209,726
Number of extensions: 217301
Number of successful extensions: 830
Number of sequences better than 10.0: 12
Number of HSP's gapped: 821
Number of HSP's successfully gapped: 12
Length of query: 257
Length of database: 16,596,109
Length adjustment: 99
Effective length of query: 158
Effective length of database: 13,168,927
Effective search space: 2080690466
Effective search space used: 2080690466
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 60 (27.7 bits)