Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Sklu_2430.1138938920320.0
Kwal_26.76493623159991e-134
Scas_717.673432828381e-110
ABL022W4332908191e-106
YMR101C (SRT1)3432797811e-102
CAGL0K03355g3422807751e-101
KLLA0B12848g3612736839e-87
AER003C2742554522e-53
Scas_716.563302644432e-51
CAGL0C04279g2742354131e-47
KLLA0E17259g2752604042e-46
Kwal_27.109862852604035e-46
YBR002C (RER2)2862643842e-43
YNL272C (SEC2)75946760.27
Scas_636.1028885653.7
Sklu_2401.957747663.9
Kwal_23.6394137457664.0
ADR033W57748664.0
CAGL0A01023g41142629.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Sklu_2430.11
         (389 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Sklu_2430.11 YMR101C, Contig c2430 20248-21417                        787   0.0  
Kwal_26.7649                                                          389   e-134
Scas_717.67                                                           327   e-110
ABL022W [570] [Homologous to ScYMR101C (SRT1) - SH] complement(3...   320   e-106
YMR101C (SRT1) [4059] chr13 complement(468444..469475) cis-Preny...   305   e-102
CAGL0K03355g complement(304962..305990) similar to sp|Q03175 Sac...   303   e-101
KLLA0B12848g 1122397..1123482 similar to sp|Q03175 Saccharomyces...   267   9e-87
AER003C [2508] [Homologous to ScYBR002C (RER2) - SH] (638834..63...   178   2e-53
Scas_716.56                                                           175   2e-51
CAGL0C04279g 416100..416924 similar to sp|P35196 Saccharomyces c...   163   1e-47
KLLA0E17259g 1530035..1530862 similar to sp|P35196 Saccharomyces...   160   2e-46
Kwal_27.10986                                                         159   5e-46
YBR002C (RER2) [195] chr2 complement(241672..242532) Cis-prenylt...   152   2e-43
YNL272C (SEC2) [4337] chr14 complement(126803..129082) Guanine n...    34   0.27 
Scas_636.10                                                            30   3.7  
Sklu_2401.9 YGR092W, Contig c2401 17788-19521                          30   3.9  
Kwal_23.6394                                                           30   4.0  
ADR033W [1774] [Homologous to ScYGR092W (DBF2) - SH; ScYPR111W (...    30   4.0  
CAGL0A01023g 102793..104028 similar to sp|Q06178 Saccharomyces c...    28   9.7  

>Sklu_2430.11 YMR101C, Contig c2430 20248-21417
          Length = 389

 Score =  787 bits (2032), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 378/389 (97%), Positives = 378/389 (97%)

Query: 1   MSNSRGSVVDVTFSTREPDVIQRAFTLKAEDQDTEHPQAPDPTAKRTKKGPQLPNIWKRE 60
           MSNSRGSVVDVTFSTREPDVIQRAFTLKAEDQDTEHPQAPDPTAKRTKKGPQLPNIWKRE
Sbjct: 1   MSNSRGSVVDVTFSTREPDVIQRAFTLKAEDQDTEHPQAPDPTAKRTKKGPQLPNIWKRE 60

Query: 61  DVKCYLDHQKKQTYQYLLSLPLISWLITLLQDFLLDILRAGPLPNHISFIMDGNRRYAKS 120
           DVKCYLDHQKKQTYQYLLSLPLISWLITLLQDFLLDILRAGPLPNHISFIMDGNRRYAKS
Sbjct: 61  DVKCYLDHQKKQTYQYLLSLPLISWLITLLQDFLLDILRAGPLPNHISFIMDGNRRYAKS 120

Query: 121 LGMPIIKGHEAGAITLLRMLYNCKKLGIKTTSAYAFSIENFNRPKEEVDTLTRLLAEKLD 180
           LGMPIIKGHEAGAITLLRMLYNCKKLGIKTTSAYAFSIENFNRPKEEVDTLTRLLAEKLD
Sbjct: 121 LGMPIIKGHEAGAITLLRMLYNCKKLGIKTTSAYAFSIENFNRPKEEVDTLTRLLAEKLD 180

Query: 181 EIAVKAQDVKDELYGSSFKVVGDRSLISRELNDKITNVERMTAVNDVDEEKTSLLYICFP 240
           EIAVKAQDVKDELYGSSFKVVGDRSLISRELNDKITNVERMTAVNDVDEEKTSLLYICFP
Sbjct: 181 EIAVKAQDVKDELYGSSFKVVGDRSLISRELNDKITNVERMTAVNDVDEEKTSLLYICFP 240

Query: 241 YTSRNDIYHAMYNTVERVKYHGMSTESISVESLTDAMYFDEFSNKCDLLIRTSGHTRLSD 300
           YTSRNDIYHAMYNTVERVKYHGMSTESISVESLTDAMYFDEFSNKCDLLIRTSGHTRLSD
Sbjct: 241 YTSRNDIYHAMYNTVERVKYHGMSTESISVESLTDAMYFDEFSNKCDLLIRTSGHTRLSD 300

Query: 301 YMLWQSHENGMIEFSTTLWPSYTFLEFYLVLVRWSFFTSLQRFQTSGFSARGQMFNFVRE 360
           YMLWQSHENGMIEFSTTLWPSYTFLEFYLVLVRWSFFTSLQRFQTSGFSARGQMFNFVRE
Sbjct: 301 YMLWQSHENGMIEFSTTLWPSYTFLEFYLVLVRWSFFTSLQRFQTSGFSARGQMFNFVRE 360

Query: 361 ALFSKGHGTXXXXXXXXXXXVAVSVAERA 389
           ALFSKGHGT           VAVSVAERA
Sbjct: 361 ALFSKGHGTPIPLEELPPPPVAVSVAERA 389

>Kwal_26.7649
          Length = 362

 Score =  389 bits (999), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 185/315 (58%), Positives = 229/315 (72%), Gaps = 5/315 (1%)

Query: 49  KGPQLPNIWKREDVKCYLDHQKKQTYQYLLSLPLISWLITLLQDFLLDILRAGPLPNHIS 108
           K P  PN+  R  VK Y+  QK + + ++L++ ++ W++  +Q  L +ILR GPLP H+S
Sbjct: 28  KKPAFPNLLNRSSVKEYVHAQKLRIWSFVLNMAIVRWILIQIQMILTNILRVGPLPPHVS 87

Query: 109 FIMDGNRRYAKSLGMPIIKGHEAGAITLLRMLYNCKKLGIKTTSAYAFSIENFNRPKEEV 168
           FIMDGNRRYAKSL +PI  GHEAGA+TLL +L  C+ LGIKT SAYAFSIENFNRP+EEV
Sbjct: 88  FIMDGNRRYAKSLSVPIKAGHEAGALTLLNLLVTCRNLGIKTVSAYAFSIENFNRPQEEV 147

Query: 169 DTLTRLLAEKLDEIAVKAQDVKDELYGSSFKVVGDRSLISRELNDKITNVERMTAVNDVD 228
           DTLT LLAEKLDE+A +A D + ELYG   +VVG+RS IS+ LND+I+ VER+T     D
Sbjct: 148 DTLTGLLAEKLDEVARRACDRESELYGLRLRVVGERSRISKSLNDRISRVERLT-----D 202

Query: 229 EEKTSLLYICFPYTSRNDIYHAMYNTVERVKYHGMSTESISVESLTDAMYFDEFSNKCDL 288
           E     LYICFPYTSRNDIYHA+YN  E  KY       I    LT+ M+  E SNKCDL
Sbjct: 203 EGDIMTLYICFPYTSRNDIYHAIYNCAESCKYLNSPVSDIDETYLTNNMFMKEQSNKCDL 262

Query: 289 LIRTSGHTRLSDYMLWQSHENGMIEFSTTLWPSYTFLEFYLVLVRWSFFTSLQRFQTSGF 348
           LIRTSGHTRLSDYMLWQ+HENG+IEFS TLWP + F EF+ +L++WSFFTS++R Q +  
Sbjct: 263 LIRTSGHTRLSDYMLWQAHENGVIEFSNTLWPDFDFFEFFKMLLKWSFFTSVRRKQLNNV 322

Query: 349 SARGQMFNFVREALF 363
           S R Q  +F +  LF
Sbjct: 323 SLRSQTLSFFKRTLF 337

>Scas_717.67
          Length = 343

 Score =  327 bits (838), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 153/282 (54%), Positives = 192/282 (68%), Gaps = 5/282 (1%)

Query: 70  KKQTYQYLLSLPLISWLITLLQDFLLDILRAGPLPNHISFIMDGNRRYAKSLGMPIIKGH 129
           K+    +L SLP+  W     Q  L+ IL    +P H+SFIMDGNRRYAKS  +P+ KGH
Sbjct: 32  KQHLTNFLFSLPIFVWFHKKTQLLLIKILSVAQVPEHVSFIMDGNRRYAKSRNLPLNKGH 91

Query: 130 EAGAITLLRMLYNCKKLGIKTTSAYAFSIENFNRPKEEVDTLTRLLAEKLDEIAVKAQDV 189
           EAG +TLL + Y CKK+G+K  SAYAFSIENFNR KEEVDTL  L + KLDE A +A D 
Sbjct: 92  EAGGVTLLTLAYICKKIGVKCVSAYAFSIENFNRSKEEVDTLMELFSAKLDEFAKRAIDY 151

Query: 190 KDELYGSSFKVVGDRSLISRELNDKITNVERMTAVNDVDEEKTSLLYICFPYTSRNDIYH 249
           +D LYGS  KVVGD SLIS+EL DKI  VE++T      +      Y+CFPYT+RNDIYH
Sbjct: 152 RDPLYGSRLKVVGDHSLISKELRDKIYKVEQLTT-----DGSDFTFYVCFPYTARNDIYH 206

Query: 250 AMYNTVERVKYHGMSTESISVESLTDAMYFDEFSNKCDLLIRTSGHTRLSDYMLWQSHEN 309
            MYN +   +     +E +++E  T  MY  EFSNKCDLLIRTSGH R SDYMLWQ+HEN
Sbjct: 207 TMYNFIANPEPEKEKSEELTIEKFTSQMYLREFSNKCDLLIRTSGHNRFSDYMLWQTHEN 266

Query: 310 GMIEFSTTLWPSYTFLEFYLVLVRWSFFTSLQRFQTSGFSAR 351
           G IEF  T WP + F+  Y+++++WSFF ++Q+F    FS +
Sbjct: 267 GTIEFCNTFWPDFGFMGMYMIILKWSFFKTIQKFNEMNFSLK 308

>ABL022W [570] [Homologous to ScYMR101C (SRT1) - SH]
           complement(356930..358231) [1302 bp, 433 aa]
          Length = 433

 Score =  320 bits (819), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 150/290 (51%), Positives = 201/290 (69%), Gaps = 12/290 (4%)

Query: 59  REDVKCYLDHQKKQTYQ-------YLLSLPLISWLITLLQDFLLDILRAGPLPNHISFIM 111
           R  VK  +  + KQTY+        L    L+  ++  +Q+ LL IL+ GPLP H+SFIM
Sbjct: 105 RARVKRLVRGEWKQTYRNRPKISHILFQFGLLRMVVNFVQNLLLKILQMGPLPQHVSFIM 164

Query: 112 DGNRRYAKSLGMPIIKGHEAGAITLLRMLYNCKKLGIKTTSAYAFSIENFNRPKEEVDTL 171
           DGNRRYAKS+ +P+  GHEAG++ L+R L+ CK+ GI+  SAYAFSIENFNRPKEE+DTL
Sbjct: 165 DGNRRYAKSMNLPLKLGHEAGSVALMRTLHTCKRAGIEAVSAYAFSIENFNRPKEEIDTL 224

Query: 172 TRLLAEKLDEIAVKAQDVKDELYGSSFKVVGDRSLISRELNDKITNVERMTAVNDVDEEK 231
           T +L+ +L + A +A ++KD +YG+   VVGDR+L+S ELNDKIT +E MT  N      
Sbjct: 225 TEMLSRRLQDFANRATNLKDRMYGARLLVVGDRALLSPELNDKITYIEDMTKHNTA---- 280

Query: 232 TSLLYICFPYTSRNDIYHAMYNTVERVKYHGMSTESISVESLTDAMYFDEFSNKCDLLIR 291
              +YIC PYT+RNDIYHAM++ V   +   + ++ IS E LT+AMY    SN+ D+L+R
Sbjct: 281 -FTVYICLPYTTRNDIYHAMFDLVRLCQAGALDSKDISTEMLTNAMYLGANSNRADILVR 339

Query: 292 TSGHTRLSDYMLWQSHENGMIEFSTTLWPSYTFLEFYLVLVRWSFFTSLQ 341
           TSGHTRLSDYMLWQ HE   IEFS  +WP +TF  F+ +L++WSF T+L 
Sbjct: 340 TSGHTRLSDYMLWQVHEQSYIEFSNCMWPDFTFRTFFTILLKWSFVTALH 389

>YMR101C (SRT1) [4059] chr13 complement(468444..469475)
           cis-Prenyltransferase (dehydrodolichyl diphosphate
           synthetase), synthesizes long-chain polyprenol compounds
           [1032 bp, 343 aa]
          Length = 343

 Score =  305 bits (781), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 150/279 (53%), Positives = 197/279 (70%), Gaps = 7/279 (2%)

Query: 71  KQTYQYLLSLPLISWLITLLQDFLLDILRAGPLPNHISFIMDGNRRYAKSLGMPIIKGHE 130
           ++ + +++SL L SW    LQ+ L+  LR GP+P H+SFIMDGNRRYAKS  +P+ KGHE
Sbjct: 34  QRVFAWVMSLSLFSWFYVNLQNILIKALRVGPVPEHVSFIMDGNRRYAKSRRLPVKKGHE 93

Query: 131 AGAITLLRMLYNCKKLGIKTTSAYAFSIENFNRPKEEVDTLTRLLAEKLDEIAVKAQDVK 190
           AG +TLL +LY CK+LG+K  SAYAFSIENFNRPKEEVDTL  L   KLDE A +A+D K
Sbjct: 94  AGGLTLLTLLYICKRLGVKCVSAYAFSIENFNRPKEEVDTLMNLFTVKLDEFAKRAKDYK 153

Query: 191 DELYGSSFKVVGDRSLISRELNDKITNVERMTAVNDVDEEKTSLLYICFPYTSRNDIYHA 250
           D LYGS  ++VGD+SL+S E+  KI  VE +T   D        L+ICFPYTSRND+ H 
Sbjct: 154 DPLYGSKIRIVGDQSLLSPEMRKKIKKVEEITQDGD-----DFTLFICFPYTSRNDMLHT 208

Query: 251 MYNTVERVKYHGMSTESISVESLTDAMYFDEFSNKCDLLIRTSGHTRLSDYMLWQSHENG 310
           + ++VE   +    +  I++   T+ MY    SNKC+LLIRTSGH RLSDYMLWQ HEN 
Sbjct: 209 IRDSVE--DHLENKSPRINIRKFTNKMYMGFHSNKCELLIRTSGHRRLSDYMLWQVHENA 266

Query: 311 MIEFSTTLWPSYTFLEFYLVLVRWSFFTSLQRFQTSGFS 349
            IEFS TLWP+++F   YL++++WSFF+++Q++     S
Sbjct: 267 TIEFSDTLWPNFSFFAMYLMILKWSFFSTIQKYNEKNHS 305

>CAGL0K03355g complement(304962..305990) similar to sp|Q03175
           Saccharomyces cerevisiae YMR101c, hypothetical start
          Length = 342

 Score =  303 bits (775), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 141/280 (50%), Positives = 193/280 (68%), Gaps = 5/280 (1%)

Query: 74  YQYLLSLPLISWLITLLQDFLLDILRAGPLPNHISFIMDGNRRYAKSLGMPIIKGHEAGA 133
           + Y  S   I+ + T +Q  L+  LR GP+P H++FIMDGNRR+AKS  +P+ KGHEAG 
Sbjct: 35  FYYCKSFYYINVITTSIQKMLIFALRTGPVPAHVAFIMDGNRRFAKSKDIPLRKGHEAGG 94

Query: 134 ITLLRMLYNCKKLGIKTTSAYAFSIENFNRPKEEVDTLTRLLAEKLDEIAVKAQDVKDEL 193
            TLL ++Y CK LG+K  SAYAFSIENFNRP+EEV+TL  L  +KLDE A KA D KD L
Sbjct: 95  ETLLTLVYICKTLGVKCISAYAFSIENFNRPREEVETLMNLFGDKLDEFAQKANDYKDPL 154

Query: 194 YGSSFKVVGDRSLISRELNDKITNVERMTAVNDVDEEKTSLLYICFPYTSRNDIYHAMYN 253
           YGSS ++VGDRSLIS EL ++I NVE++T     +  +  +LYICFPYTSRNDI+  +  
Sbjct: 155 YGSSLRIVGDRSLISPELRERIENVEKLT-----ENSEKFILYICFPYTSRNDIFQTVTK 209

Query: 254 TVERVKYHGMSTESISVESLTDAMYFDEFSNKCDLLIRTSGHTRLSDYMLWQSHENGMIE 313
             ++     +   ++S+   T +M+F E+S+ CD+LIRTSGH RLSD+MLWQ +E+  +E
Sbjct: 210 VTDKYVQSNIIDSNLSINEFTKSMHFKEYSDNCDILIRTSGHKRLSDFMLWQVNEHATME 269

Query: 314 FSTTLWPSYTFLEFYLVLVRWSFFTSLQRFQTSGFSARGQ 353
           FST+LWP + F + YL+++RWS F   Q +  +  S   +
Sbjct: 270 FSTSLWPQFNFFQMYLIILRWSMFKMFQIYNMNNVSKHSK 309

>KLLA0B12848g 1122397..1123482 similar to sp|Q03175 Saccharomyces
           cerevisiae YMR101c SRT1 cis-prenyltransferase homologue,
           start by similarity
          Length = 361

 Score =  267 bits (683), Expect = 9e-87,   Method: Compositional matrix adjust.
 Identities = 137/273 (50%), Positives = 185/273 (67%), Gaps = 9/273 (3%)

Query: 69  QKKQTYQYLLSLPLISWLITLLQDFLLDILRAGPLPNHISFIMDGNRRYAKSLGMPIIKG 128
           +++  Y+ + S P  S L   LQ F++ ILR GP+P H+SFIMDGNRRYAK L  P+ +G
Sbjct: 47  RQRLNYKDVGSYPF-SRLFAWLQMFMVRILRMGPVPRHLSFIMDGNRRYAKKLDQPVKEG 105

Query: 129 HEAGAITLLRMLYNCKKLGIKTTSAYAFSIENFNRPKEEVDTLTRLLAEKLDEIAVKAQD 188
           H AG  TL+ +L+ C++L + + SAYAFSIENFNR  +EV TL  LL   +D+   +A +
Sbjct: 106 HRAGGATLIDILHICRRLNVSSVSAYAFSIENFNRSPQEVATLMELLGYYIDQFTERATN 165

Query: 189 VKDELYGSSFKVVGDRSLISRELNDKITNVERMTAVNDVDEEKTSLLYICFPYTSRNDIY 248
            KDELYG   +VVGD SL+S EL  KI N E++T      + +  +LY+  PYTSRNDI 
Sbjct: 166 AKDELYGIRLRVVGDLSLLSEELLKKIRNAEKLTR-----DGQEFVLYLALPYTSRNDIA 220

Query: 249 HAMYNTVERVKYHGMSTESISVESLTDAMYFDEFSNKCDLLIRTSGHTRLSDYMLWQSHE 308
           H+M  T ++      S E I+ ++LTD MYF+++SNKCDLLIRTSGHTRLSDYMLWQ HE
Sbjct: 221 HSMQVTTDKCI---NSNEDITEQALTDNMYFEQYSNKCDLLIRTSGHTRLSDYMLWQVHE 277

Query: 309 NGMIEFSTTLWPSYTFLEFYLVLVRWSFFTSLQ 341
             +IEF   LWP + F   Y ++++WSF+ + Q
Sbjct: 278 GSIIEFVDCLWPDFNFWRLYWIMLKWSFYQTWQ 310

>AER003C [2508] [Homologous to ScYBR002C (RER2) - SH]
           (638834..639658) [825 bp, 274 aa]
          Length = 274

 Score =  178 bits (452), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 94/255 (36%), Positives = 150/255 (58%), Gaps = 13/255 (5%)

Query: 84  SWLITLLQDFLLDILRA-GPLPNHISFIMDGNRRYAKSLGMPIIKGHEAGAITLLRMLYN 142
           SWLI+ L+D  + +LR+ G +P H+ FIMDGNRRYAK   + + +GH AG +++ ++L  
Sbjct: 11  SWLISRLKDVFVSVLRSSGRVPKHVGFIMDGNRRYAKKHNIEVREGHSAGFMSMNKVLEL 70

Query: 143 CKKLGIKTTSAYAFSIENFNRPKEEVDTLTRLLAEKLDEIAVKAQDVKDELYGSSFKVVG 202
           C + G+ T + +AFS++NF R   EVD+L  L  E++ +I    +    E YG   +++G
Sbjct: 71  CYESGVTTATVFAFSVDNFRRSAFEVDSLMELAKERVMQITQHGELA--EQYGIHVRIIG 128

Query: 203 DRSLISRELNDKITNVERMTAVNDVDEEKTSLLYICFPYTSRNDIYHAMYNTVERVKYHG 262
           DRSL+  ++ +++   E+ T  N       ++L +C PYT+R +I HAM  T+   +  G
Sbjct: 129 DRSLLPADVQEEMARAEKATEAN-----TRAVLNVCIPYTARGEILHAMKGTIADAQSDG 183

Query: 263 MSTESISVESLTDAMYFDEFSNKCDLLIRTSGHTRLSDYMLWQSHENG-MIEFSTTLWPS 321
                   E+  DA  +       DLLIRTSG +RLSD++LWQ  + G +IE  + LWP 
Sbjct: 184 API----TEADLDAHMYTGGLPPLDLLIRTSGVSRLSDFLLWQVCQKGVVIELLSCLWPD 239

Query: 322 YTFLEFYLVLVRWSF 336
           +  L    +L+R++F
Sbjct: 240 FGPLTMAWILLRYAF 254

>Scas_716.56
          Length = 330

 Score =  175 bits (443), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 97/264 (36%), Positives = 146/264 (55%), Gaps = 9/264 (3%)

Query: 79  SLPLISWLITLLQDFLLDILRAG-PLPNHISFIMDGNRRYAKSLGMPIIKGHEAGAITLL 137
           S+P  S  +  +++     +R    +P H+ FIMDGNRRYA+   + + +GHEAG  T+ 
Sbjct: 42  SIPGYSLTLKWIKNIFSRTIRVSRNVPRHVGFIMDGNRRYARRNHLQVKEGHEAGFFTMS 101

Query: 138 RMLYNCKKLGIKTTSAYAFSIENFNRPKEEVDTLTRLLAEKLDEIAVKAQDVKDELYGSS 197
           ++L  C + G++  + YAFSIENF R   EVD L +L  +++ +I    +    E YG  
Sbjct: 102 KILELCYESGVECATVYAFSIENFKRSPHEVDALMKLAKDRIRQIVASGEMA--EKYGIK 159

Query: 198 FKVVGDRSLISRELNDKITNVERMTAVNDVDEEKTSLLYICFPYTSRNDIYHAMYNTVER 257
            +++GD SL+ +EL D + N   +T  N     K ++L ICFPYT R +I H+M N VE 
Sbjct: 160 VRIIGDLSLLDKELRDDMNNAMEITKNN-----KRAVLNICFPYTGREEIVHSMQNVVEL 214

Query: 258 VKYHGMSTESISVESLTDAMYFDEFSNKCDLLIRTSGHTRLSDYMLWQSHENGM-IEFST 316
            + +    + I  E L +A  +       DLLIRTSG  RLSD+M+WQ    G+ IE   
Sbjct: 215 AQANSDDPKFIIDEQLINANLYTGDQPPLDLLIRTSGMVRLSDFMVWQVSNKGVAIELID 274

Query: 317 TLWPSYTFLEFYLVLVRWSFFTSL 340
            LWP +  L    +L+++ F  S 
Sbjct: 275 CLWPDFGPLRMAWILLKFVFQKSF 298

>CAGL0C04279g 416100..416924 similar to sp|P35196 Saccharomyces
           cerevisiae YBR002c RER2, hypothetical start
          Length = 274

 Score =  163 bits (413), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 94/235 (40%), Positives = 135/235 (57%), Gaps = 12/235 (5%)

Query: 103 LPNHISFIMDGNRRYAKSLGMPIIKGHEAGAITLLRMLYNCKKLGIKTTSAYAFSIENFN 162
           +P HI FIMDGNRRYAK   M   +GHEAG  ++ ++L  C + G+ T + +AFSIENF 
Sbjct: 27  VPRHIGFIMDGNRRYAKKKQMESKEGHEAGFRSMSKILELCYEAGVDTATVFAFSIENFK 86

Query: 163 RPKEEVDTLTRLLAEKLDEIAVKAQDVKDELYGSSFKVVGDRSLISRELNDKITNVERMT 222
           R   EVD +  L  E++ +I    +  +   YG   +V+GD SL+ ++L  +I N   +T
Sbjct: 87  RSAYEVDAIMSLARERIRQIREHGELAQK--YGVRIRVIGDISLLDKDLLKEIKNTMELT 144

Query: 223 AVNDVDEEKTSLLYICFPYTSRNDIYHAMYNTVERVKYHGMSTESISVESLTDAMYFDEF 282
             N       + L IC PYT R +IYH+M   ++   Y   S+++IS E + D   +   
Sbjct: 145 RNN-----TRATLNICMPYTGREEIYHSMKTVLDDDSY---SSKNIS-EEIIDEHLYTAG 195

Query: 283 SNKCDLLIRTSGHTRLSDYMLWQSHENG-MIEFSTTLWPSYTFLEFYLVLVRWSF 336
               DLLIRTSG TRLSD+MLWQ+  N  MIEF   LWP +       +L++++F
Sbjct: 196 QPPLDLLIRTSGVTRLSDFMLWQTCSNDVMIEFIDCLWPEFGPFRMAWILLKFAF 250

>KLLA0E17259g 1530035..1530862 similar to sp|P35196 Saccharomyces
           cerevisiae YBR002c RER2 cis-prenyltransferase, a key
           enzyme in dolichol synthesis, start by similarity
          Length = 275

 Score =  160 bits (404), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 88/260 (33%), Positives = 147/260 (56%), Gaps = 10/260 (3%)

Query: 79  SLPLISWLITLLQDFLLDILRAG-PLPNHISFIMDGNRRYAKSLGMPIIKGHEAGAITLL 137
           S P  +  + +++  L  ++R+   +P H++FIMDGNRR+AK   M + +GH AG  ++ 
Sbjct: 6   SFPGYNQFLEMVKTTLAKVIRSSDKVPQHVAFIMDGNRRFAKKNNMEVNEGHNAGFESMC 65

Query: 138 RMLYNCKKLGIKTTSAYAFSIENFNRPKEEVDTLTRLLAEKLDEIAVKAQDVKDELYGSS 197
           R+L  C + G+K  + +AFSIENF R   EV+ L  L  +K+ +I+   +    E YG  
Sbjct: 66  RILELCYESGMKVATVFAFSIENFKRSTFEVNWLMELAKDKIKQISQHGELA--EQYGIK 123

Query: 198 FKVVGDRSLISRELNDKITNVERMTAVNDVDEEKTSLLYICFPYTSRNDIYHAMYNTVER 257
            +++GDRSL+  ++  ++   E +T  N       ++L ICFPYT R +I H++   ++ 
Sbjct: 124 VQIIGDRSLLPADVLKEVELAEEITMNNS-----RAVLNICFPYTGREEIVHSIQGIMKE 178

Query: 258 VKYHGMSTESISVESLTDAMYFDEFSNKCDLLIRTSGHTRLSDYMLWQ-SHENGMIEFST 316
                +    I  +++ D +Y  +     +LLIRTSG TRLSD++LWQ S+    IE   
Sbjct: 179 TAMGEIDYRDIDEQTIEDHLY-TQGQPPVELLIRTSGVTRLSDFLLWQLSNRGCTIELVD 237

Query: 317 TLWPSYTFLEFYLVLVRWSF 336
            LWP +T      +L++++F
Sbjct: 238 CLWPEFTPFSMLKILIKFAF 257

>Kwal_27.10986
          Length = 285

 Score =  159 bits (403), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 88/260 (33%), Positives = 146/260 (56%), Gaps = 10/260 (3%)

Query: 79  SLPLISWLITLLQDFLLDILR-AGPLPNHISFIMDGNRRYAKSLGMPIIKGHEAGAITLL 137
           S P  S ++   ++    +++ +G +P H+  IMDGNRR+AK   + I +GH AG  ++ 
Sbjct: 6   SFPGSSQVLNFCKNLFSRVIQVSGNVPRHVGLIMDGNRRWAKLKHVEIKEGHNAGFHSMS 65

Query: 138 RMLYNCKKLGIKTTSAYAFSIENFNRPKEEVDTLTRLLAEKLDEIAVKAQDVKDELYGSS 197
           R L  C + G+ T + +AFSIENF R   EV++L  L    + ++    +    E +G  
Sbjct: 66  RALELCYEAGVSTATVFAFSIENFKRSSAEVESLMNLARSGIRQVVQNGE--MAEKFGIK 123

Query: 198 FKVVGDRSLISRELNDKITNVERMTAVNDVDEEKTSLLYICFPYTSRNDIYHAMYNTVER 257
             V+GDRSL+  ++  ++   E +T  N       ++L ICFPYT R+++ H++   V  
Sbjct: 124 INVIGDRSLLPADVLREVETAEEITKAN-----TRAVLNICFPYTGRDELLHSIRGVVNE 178

Query: 258 VKYHGMSTESISVESLTDAMYFDEFSNKCDLLIRTSGHTRLSDYMLWQ-SHENGMIEFST 316
            +   ++T  I+ E+  D   +   S   DLLIRTSG TRLSD+++WQ S ++ +IEF  
Sbjct: 179 AQCGNLNTSDIN-EATIDKFLYTGGSPPVDLLIRTSGVTRLSDFLIWQVSRKDVVIEFLD 237

Query: 317 TLWPSYTFLEFYLVLVRWSF 336
            LWP +   +   +L+R++F
Sbjct: 238 CLWPDFGSRQMAWLLLRFAF 257

>YBR002C (RER2) [195] chr2 complement(241672..242532)
           Cis-prenyltransferase (dehydrodolichyl diphosphate
           synthetase), involved in dolichol synthesis [861 bp, 286
           aa]
          Length = 286

 Score =  152 bits (384), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 93/264 (35%), Positives = 147/264 (55%), Gaps = 14/264 (5%)

Query: 79  SLPLISWLITLLQDFLLDILRA-GPLPNHISFIMDGNRRYAKSLGMPIIKGHEAGAITLL 137
            +P  S+++   ++     LRA   +P H+ FIMDGNRR+A+   M + +GHEAG +++ 
Sbjct: 6   GIPGHSFVLKWTKNIFSRTLRASNCVPRHVGFIMDGNRRFARKKEMDVKEGHEAGFVSMS 65

Query: 138 RMLYNCKKLGIKTTSAYAFSIENFNRPKEEVDTLTRLLAEKLDEIAVKAQDVKDELYGSS 197
           R+L  C + G+ T + +AFSIENF R   EV++L  L  E++ +I  + +      YG  
Sbjct: 66  RILELCYEAGVDTATVFAFSIENFKRSSREVESLMTLARERIRQITERGELACK--YGVR 123

Query: 198 FKVVGDRSLISRELNDKITNVERMTAVNDVDEEKTSLLYICFPYTSRNDIYHAMYNTVER 257
            K++GD SL+ + L + +       AV      K + L ICFPYT R +I HAM  T+ +
Sbjct: 124 IKIIGDLSLLDKSLLEDVR-----VAVETTKNNKRATLNICFPYTGREEILHAMKETIVQ 178

Query: 258 VKYHGMSTESISVESLTDAMYFDEFSNKCDLLIRTSGHTRLSDYMLWQSHENGM-IEFST 316
            K  G + +    ES  ++  +       DLLIRTSG +RLSD+++WQ+   G+ IE   
Sbjct: 179 HK-KGAAID----ESTLESHLYTAGVPPLDLLIRTSGVSRLSDFLIWQASSKGVRIELLD 233

Query: 317 TLWPSYTFLEFYLVLVRWSFFTSL 340
            LWP +  +    +L+++SF  S 
Sbjct: 234 CLWPEFGPIRMAWILLKFSFHKSF 257

>YNL272C (SEC2) [4337] chr14 complement(126803..129082) Guanine
           nucleotide exchange factor with coiled-coil domain
           essential for vesicular transport to the plasma membrane
           [2280 bp, 759 aa]
          Length = 759

 Score = 33.9 bits (76), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 16/46 (34%), Positives = 30/46 (65%)

Query: 147 GIKTTSAYAFSIENFNRPKEEVDTLTRLLAEKLDEIAVKAQDVKDE 192
            +KT ++   +IEN+N+ KE+ +TL R L+++ DE+    +D+  E
Sbjct: 38  SLKTIASQKAAIENYNQLKEDYNTLKRELSDRDDEVKRLREDIAKE 83

>Scas_636.10
          Length = 288

 Score = 29.6 bits (65), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 24/85 (28%), Positives = 37/85 (43%), Gaps = 20/85 (23%)

Query: 276 AMYFDEFSNKCDLLIRTSGHTRLSDYMLWQSHENGMIEFSTTLWP-----SYTFLEF--- 327
            +YF+E  N+          TRLSD      ++   I+FS   W       Y+   F   
Sbjct: 74  GLYFNEKDNE-----NQENETRLSD------NDKAFIKFSKAFWKILCLEWYSIDRFRMD 122

Query: 328 -YLVLVRWSFFTSLQRFQTSGFSAR 351
            YL+L R  FF  L+  Q+  ++A+
Sbjct: 123 KYLLLTRRVFFNQLKYLQSRNWNAK 147

>Sklu_2401.9 YGR092W, Contig c2401 17788-19521
          Length = 577

 Score = 30.0 bits (66), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 28/47 (59%), Gaps = 10/47 (21%)

Query: 252 YNTVERVKY----HGMSTESIS------VESLTDAMYFDEFSNKCDL 288
           +  V+R+KY    H  S  S+S      ++S TDA YFD+FSN+ D+
Sbjct: 473 FEHVKRMKYFAEIHFDSLRSMSPPFIPQLDSETDAGYFDDFSNEADM 519

>Kwal_23.6394
          Length = 1374

 Score = 30.0 bits (66), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 31/57 (54%), Gaps = 5/57 (8%)

Query: 246 DIYHAMYNTVERVKYHGMSTESISVESLTDA-MYFDE----FSNKCDLLIRTSGHTR 297
           ++YH  Y  VE + YH + ++  ++E L D  MY+D+      N   LL++T  H +
Sbjct: 702 EVYHQFYKWVEFIIYHQLLSDLDALECLVDILMYYDKLFPLLINDHILLMKTILHLQ 758

>ADR033W [1774] [Homologous to ScYGR092W (DBF2) - SH; ScYPR111W
           (DBF20) - SH] complement(764718..766451) [1734 bp, 577
           aa]
          Length = 577

 Score = 30.0 bits (66), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 26/48 (54%), Gaps = 7/48 (14%)

Query: 270 VESLTDAMYFDEFSNKCDLLIRTSGHTRLSDYMLWQSHENGMIEFSTT 317
           ++S TDA YFD+F+N+ D+        + +D    Q   N M+E S+ 
Sbjct: 501 LDSETDAGYFDDFTNEADM-------AKYADVFKRQDKLNAMVEESSN 541

>CAGL0A01023g 102793..104028 similar to sp|Q06178 Saccharomyces
          cerevisiae YLR328w or sp|P53204 Saccharomyces
          cerevisiae YGR010w, start by similarity
          Length = 411

 Score = 28.5 bits (62), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 16/42 (38%), Positives = 20/42 (47%), Gaps = 7/42 (16%)

Query: 15 TREPDVIQRAFTLKAEDQDTEHPQAPDPTAKRTKKGPQLPNI 56
          TR+PD        K  D D +    PDPT+K  K GP  P +
Sbjct: 4  TRDPD-------FKPRDPDAKLLPPPDPTSKIPKSGPITPYV 38

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.320    0.134    0.394 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 12,293,520
Number of extensions: 527593
Number of successful extensions: 1619
Number of sequences better than 10.0: 31
Number of HSP's gapped: 1619
Number of HSP's successfully gapped: 31
Length of query: 389
Length of database: 16,596,109
Length adjustment: 104
Effective length of query: 285
Effective length of database: 12,995,837
Effective search space: 3703813545
Effective search space used: 3703813545
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 62 (28.5 bits)