Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Sklu_2419.874274234710.0
Kwal_56.2248476076227490.0
Scas_644.1475364027030.0
YOL006C (TOP1)76963226940.0
KLLA0C06116g78564326340.0
ACL008C73264926150.0
CAGL0J11660g74464325210.0
CAGL0E02431g71765224190.0
KLLA0F04609g916138770.45
Sklu_1708.167535703.2
CAGL0F05489g487193684.2
YLR087C (CSF1)295894685.6
AFR702W497189676.8
AFR301C1655104677.2
Scas_683.39224106657.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Sklu_2419.8
         (742 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Sklu_2419.8 YOL006C, Contig c2419 11000-13228 reverse complement     1341   0.0  
Kwal_56.22484                                                        1063   0.0  
Scas_644.14                                                          1045   0.0  
YOL006C (TOP1) [4810] chr15 complement(313078..315387) DNA topoi...  1042   0.0  
KLLA0C06116g complement(536524..538881) similar to sp|P04786 Sac...  1019   0.0  
ACL008C [1041] [Homologous to ScYOL006C (TOP1) - SH] (341157..34...  1011   0.0  
CAGL0J11660g 1133494..1135728 highly similar to sp|P04786 Saccha...   975   0.0  
CAGL0E02431g complement(230559..232712) highly similar to sp|P04...   936   0.0  
KLLA0F04609g complement(451579..454329) similar to sp|P40467 Sac...    34   0.45 
Sklu_1708.1 YBL061C, Contig c1708 249-2276 reverse complement          32   3.2  
CAGL0F05489g 553902..555365 similar to tr|Q03944 Saccharomyces c...    31   4.2  
YLR087C (CSF1) [3502] chr12 complement(306856..315732) Protein r...    31   5.6  
AFR702W [3895] [Homologous to ScYCL029C (BIK1) - SH] complement(...    30   6.8  
AFR301C [3493] [Homologous to ScYIL159W (BNR1) - SH] (981215..98...    30   7.2  
Scas_683.39                                                            30   7.3  

>Sklu_2419.8 YOL006C, Contig c2419 11000-13228 reverse complement
          Length = 742

 Score = 1341 bits (3471), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 661/742 (89%), Positives = 661/742 (89%)

Query: 1   MTVNTKHEISGDEEEDVPLSSILPKKRRKTNIKVEESENNXXXXXXXXXXDQEYDSDEVL 60
           MTVNTKHEISGDEEEDVPLSSILPKKRRKTNIKVEESENN          DQEYDSDEVL
Sbjct: 1   MTVNTKHEISGDEEEDVPLSSILPKKRRKTNIKVEESENNVKPKVKTVKKDQEYDSDEVL 60

Query: 61  SXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQDAEERESDEFKWWEQENDDDSIKWTT 120
           S                                QDAEERESDEFKWWEQENDDDSIKWTT
Sbjct: 61  SKAVKKNRKKTTKPVAKDEDDEEEEKAILKKEDQDAEERESDEFKWWEQENDDDSIKWTT 120

Query: 121 LRHNGVIFPPEYEPLPLHVKLYYDGKPVDLPPQAEEVAGFFAALLESDHAKNPVFQKNFF 180
           LRHNGVIFPPEYEPLPLHVKLYYDGKPVDLPPQAEEVAGFFAALLESDHAKNPVFQKNFF
Sbjct: 121 LRHNGVIFPPEYEPLPLHVKLYYDGKPVDLPPQAEEVAGFFAALLESDHAKNPVFQKNFF 180

Query: 181 NDFLEVLKXXXXXXXXXXXXSLDKCDFTKMFDHFXXXXXXXXXXXXXXXXXXXXXXXXXX 240
           NDFLEVLK            SLDKCDFTKMFDHF                          
Sbjct: 181 NDFLEVLKEEGGTGNGITIESLDKCDFTKMFDHFQLEKEQKKQLSSQEKKQLKLEKEKLE 240

Query: 241 XPFKFCYLDGRREQVGNFRIEPAGLFRGRGAHPKTGKLKRRVYPEDVVLNLDKDAPIPEP 300
            PFKFCYLDGRREQVGNFRIEPAGLFRGRGAHPKTGKLKRRVYPEDVVLNLDKDAPIPEP
Sbjct: 241 EPFKFCYLDGRREQVGNFRIEPAGLFRGRGAHPKTGKLKRRVYPEDVVLNLDKDAPIPEP 300

Query: 301 PTGHKWGEIRHDNTVQWLAMWRENISNSFKYVRFAASSSLKGISDYKKFEKARQLKDHID 360
           PTGHKWGEIRHDNTVQWLAMWRENISNSFKYVRFAASSSLKGISDYKKFEKARQLKDHID
Sbjct: 301 PTGHKWGEIRHDNTVQWLAMWRENISNSFKYVRFAASSSLKGISDYKKFEKARQLKDHID 360

Query: 361 AVRKDYNKQLKSKVMLDRQMAVATYLIDVFALRAGGEKSEDEADTVGCCSLRYEHVTLKP 420
           AVRKDYNKQLKSKVMLDRQMAVATYLIDVFALRAGGEKSEDEADTVGCCSLRYEHVTLKP
Sbjct: 361 AVRKDYNKQLKSKVMLDRQMAVATYLIDVFALRAGGEKSEDEADTVGCCSLRYEHVTLKP 420

Query: 421 PNTVIFDFLGKDSIRFYQEVQVDKQVFKNLTIFKRPPKQPGHQLFDRLDPSILNKHLQNY 480
           PNTVIFDFLGKDSIRFYQEVQVDKQVFKNLTIFKRPPKQPGHQLFDRLDPSILNKHLQNY
Sbjct: 421 PNTVIFDFLGKDSIRFYQEVQVDKQVFKNLTIFKRPPKQPGHQLFDRLDPSILNKHLQNY 480

Query: 481 MPGLTAKVFRTYNASKTMQDQLDLIPNEGTVAEKMLRYNAANRTVAILCNHQRTVTKGHA 540
           MPGLTAKVFRTYNASKTMQDQLDLIPNEGTVAEKMLRYNAANRTVAILCNHQRTVTKGHA
Sbjct: 481 MPGLTAKVFRTYNASKTMQDQLDLIPNEGTVAEKMLRYNAANRTVAILCNHQRTVTKGHA 540

Query: 541 AAVQKANDKIEELEWQKIRYKRAILQLDKNELKKNLKYFEEISDLTKEEESAIHKRVIER 600
           AAVQKANDKIEELEWQKIRYKRAILQLDKNELKKNLKYFEEISDLTKEEESAIHKRVIER
Sbjct: 541 AAVQKANDKIEELEWQKIRYKRAILQLDKNELKKNLKYFEEISDLTKEEESAIHKRVIER 600

Query: 601 EREKYNRKFLRENEKRKHEKQELLPEAQLTEWMTQVDELKEQYEKELETGDIELKPTLQS 660
           EREKYNRKFLRENEKRKHEKQELLPEAQLTEWMTQVDELKEQYEKELETGDIELKPTLQS
Sbjct: 601 EREKYNRKFLRENEKRKHEKQELLPEAQLTEWMTQVDELKEQYEKELETGDIELKPTLQS 660

Query: 661 VDKLKVQIEKLEQRIRTSTVQLKDREDNSQVALGTSKINYIDPRLSVVFCKKYNVPIEKV 720
           VDKLKVQIEKLEQRIRTSTVQLKDREDNSQVALGTSKINYIDPRLSVVFCKKYNVPIEKV
Sbjct: 661 VDKLKVQIEKLEQRIRTSTVQLKDREDNSQVALGTSKINYIDPRLSVVFCKKYNVPIEKV 720

Query: 721 FTKSLREKFKWAIESADENWRF 742
           FTKSLREKFKWAIESADENWRF
Sbjct: 721 FTKSLREKFKWAIESADENWRF 742

>Kwal_56.22484
          Length = 760

 Score = 1063 bits (2749), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 526/762 (69%), Positives = 598/762 (78%), Gaps = 22/762 (2%)

Query: 1   MTVNTKHEISGDEEEDVPLSSILPKKRRKTNIKVEESENNXXXXXXXXXXDQEYDSDEVL 60
           MTV  K E    EEEDVPL++ L  +R+K  I   E              D  YDSDE L
Sbjct: 1   MTVKLKDE-DRSEEEDVPLTTSL-NRRKKRKIDYSEDGEEQVDEPELKEEDYAYDSDETL 58

Query: 61  S------------XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQDAE--------ERE 100
           S                                            Q+AE          E
Sbjct: 59  SKAAKTASKAKVKTARKTPTKPKGAPRATAKKPKKIAKREPSVEQQNAEPDENTKESTEE 118

Query: 101 SDEFKWWEQENDDDSIKWTTLRHNGVIFPPEYEPLPLHVKLYYDGKPVDLPPQAEEVAGF 160
           ++ FKWWE+ENDDDSIKWTTL+HNGVIFPP YEPLP H+K+YYDGKPVDLPPQAEEVAGF
Sbjct: 119 TEGFKWWEKENDDDSIKWTTLKHNGVIFPPAYEPLPSHIKMYYDGKPVDLPPQAEEVAGF 178

Query: 161 FAALLESDHAKNPVFQKNFFNDFLEVLKXXXXXXXXXXXXSLDKCDFTKMFDHFXXXXXX 220
           FAALLESDHA+NPVFQ+NFFNDFL+VL+              + CDF+KMFD+F      
Sbjct: 179 FAALLESDHAQNPVFQQNFFNDFLDVLRESGGPRNGVQPVKFEHCDFSKMFDYFQLQKEQ 238

Query: 221 XXXXXXXXXXXXXXXXXXXXXPFKFCYLDGRREQVGNFRIEPAGLFRGRGAHPKTGKLKR 280
                                PFK+CYLDGR+EQVGNFRIEP GLFRGRGAHPKTGKLKR
Sbjct: 239 KKQLSTQEKKALKKEKEEFEEPFKYCYLDGRKEQVGNFRIEPPGLFRGRGAHPKTGKLKR 298

Query: 281 RVYPEDVVLNLDKDAPIPEPPTGHKWGEIRHDNTVQWLAMWRENISNSFKYVRFAASSSL 340
           RVYPEDVVLNLDK+A +P+ P GHKWGEIRHD+TVQWLAMWRENISNSFKYVRFAA+SSL
Sbjct: 299 RVYPEDVVLNLDKEAVVPKAPDGHKWGEIRHDSTVQWLAMWRENISNSFKYVRFAANSSL 358

Query: 341 KGISDYKKFEKARQLKDHIDAVRKDYNKQLKSKVMLDRQMAVATYLIDVFALRAGGEKSE 400
           KG+SD+KKFEKARQL+ +ID +R DY K LKSKVML+RQ+AVA Y IDVFALRAGGEK+E
Sbjct: 359 KGMSDFKKFEKARQLRGYIDTIRSDYTKNLKSKVMLERQIAVACYFIDVFALRAGGEKAE 418

Query: 401 DEADTVGCCSLRYEHVTLKPPNTVIFDFLGKDSIRFYQEVQVDKQVFKNLTIFKRPPKQP 460
           DEADTVGCCSLRYEHVTLKPPNTVIFDFLGKDSIRFYQEV+V KQVFKNLTIFK+ PK+P
Sbjct: 419 DEADTVGCCSLRYEHVTLKPPNTVIFDFLGKDSIRFYQEVEVTKQVFKNLTIFKKAPKKP 478

Query: 461 GHQLFDRLDPSILNKHLQNYMPGLTAKVFRTYNASKTMQDQLDLIPNEGTVAEKMLRYNA 520
           GHQLFDRLDPSILNKHLQNYMPGLTAKVFRTYNASKTMQDQLDLIPNEGTVAEKML+YNA
Sbjct: 479 GHQLFDRLDPSILNKHLQNYMPGLTAKVFRTYNASKTMQDQLDLIPNEGTVAEKMLKYNA 538

Query: 521 ANRTVAILCNHQRTVTKGHAAAVQKANDKIEELEWQKIRYKRAILQLDKNELKKNLKYFE 580
           ANRTVAILCNHQRTVTKGHAA+VQKA ++IEELEWQKIR KRAILQLDK+ELK+N KYF 
Sbjct: 539 ANRTVAILCNHQRTVTKGHAASVQKATERIEELEWQKIRLKRAILQLDKSELKQNPKYFA 598

Query: 581 EISDLTKEEESAIHKRVIEREREKYNRKFLRENEKRKHEKQELLPEAQLTEWMTQVDELK 640
           E+ DL KE+E+AIHKR+IE+EREK  +KF RENEKRK + +E LPE+QL EW+ +VD+L+
Sbjct: 599 EVKDLVKEQEAAIHKRLIEKEREKVTKKFARENEKRKFDNEEALPESQLKEWLARVDDLE 658

Query: 641 EQYEKELETGDIELKPTLQSVDKLKVQIEKLEQRIRTSTVQLKDREDNSQVALGTSKINY 700
            QY++ELETG+++LK + ++V+KLK QIEKL+QRI T+++QLKD+EDNSQVALGTSKINY
Sbjct: 659 NQYKEELETGEVQLKSSTENVEKLKTQIEKLDQRIETASIQLKDKEDNSQVALGTSKINY 718

Query: 701 IDPRLSVVFCKKYNVPIEKVFTKSLREKFKWAIESADENWRF 742
           IDPRLSVVFCKKY VPIEKVFTKSLR+KFKWA+ESADE+WRF
Sbjct: 719 IDPRLSVVFCKKYGVPIEKVFTKSLRDKFKWAVESADESWRF 760

>Scas_644.14
          Length = 753

 Score = 1045 bits (2703), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 489/640 (76%), Positives = 557/640 (87%)

Query: 103 EFKWWEQENDDDSIKWTTLRHNGVIFPPEYEPLPLHVKLYYDGKPVDLPPQAEEVAGFFA 162
           E+KWWE EN+DDSIKWTTL+HNGV+ PP YEPLP H+KLYYDGKPVDLPP+AEEVAGF+ 
Sbjct: 114 EYKWWENENEDDSIKWTTLKHNGVVIPPPYEPLPSHIKLYYDGKPVDLPPEAEEVAGFYG 173

Query: 163 ALLESDHAKNPVFQKNFFNDFLEVLKXXXXXXXXXXXXSLDKCDFTKMFDHFXXXXXXXX 222
           A+LE+DHAKNPVFQKNFF DFLEVLK              +KCDFTKMFD+F        
Sbjct: 174 AMLETDHAKNPVFQKNFFQDFLEVLKTAGGTKNGITIEKFEKCDFTKMFDYFELLKEEKK 233

Query: 223 XXXXXXXXXXXXXXXXXXXPFKFCYLDGRREQVGNFRIEPAGLFRGRGAHPKTGKLKRRV 282
                               +KFC LDGR+EQVGNF++EP GLFRGRGAHPKTGKLKRRV
Sbjct: 234 KLTSQEKKQIRLDREKAEEKYKFCELDGRKEQVGNFKVEPPGLFRGRGAHPKTGKLKRRV 293

Query: 283 YPEDVVLNLDKDAPIPEPPTGHKWGEIRHDNTVQWLAMWRENISNSFKYVRFAASSSLKG 342
            PED++LNLDKDAPIPE P GH WGEIR+DN+VQWLAMWRENI NS KYVR AA+SSLKG
Sbjct: 294 QPEDIILNLDKDAPIPEAPEGHHWGEIRNDNSVQWLAMWRENIFNSVKYVRLAANSSLKG 353

Query: 343 ISDYKKFEKARQLKDHIDAVRKDYNKQLKSKVMLDRQMAVATYLIDVFALRAGGEKSEDE 402
            SDYKKFEKARQLKDHIDA+RKDY KQLKS+VML+RQ AVA YLIDVFALRAGGEKSEDE
Sbjct: 354 QSDYKKFEKARQLKDHIDAIRKDYKKQLKSEVMLERQKAVAIYLIDVFALRAGGEKSEDE 413

Query: 403 ADTVGCCSLRYEHVTLKPPNTVIFDFLGKDSIRFYQEVQVDKQVFKNLTIFKRPPKQPGH 462
           ADTVGCCSLRYEHVTLKPPNTV+FDFLGKDSIRFYQEV+VDK+VFKNL IFKRPPKQPGH
Sbjct: 414 ADTVGCCSLRYEHVTLKPPNTVVFDFLGKDSIRFYQEVEVDKKVFKNLKIFKRPPKQPGH 473

Query: 463 QLFDRLDPSILNKHLQNYMPGLTAKVFRTYNASKTMQDQLDLIPNEGTVAEKMLRYNAAN 522
           QLFDRLDPS LNKHLQNYMPGL+AKVFRTYNASKTMQDQLDLIPNEG+VAEK+LRYNAAN
Sbjct: 474 QLFDRLDPSTLNKHLQNYMPGLSAKVFRTYNASKTMQDQLDLIPNEGSVAEKLLRYNAAN 533

Query: 523 RTVAILCNHQRTVTKGHAAAVQKANDKIEELEWQKIRYKRAILQLDKNELKKNLKYFEEI 582
           RTVAILCNHQRTVTKGHA +VQKANDKI+ELEWQKIR K+A+LQL+   LKKN  YFEEI
Sbjct: 534 RTVAILCNHQRTVTKGHAQSVQKANDKIKELEWQKIRLKKALLQLEPERLKKNPAYFEEI 593

Query: 583 SDLTKEEESAIHKRVIEREREKYNRKFLRENEKRKHEKQELLPEAQLTEWMTQVDELKEQ 642
            D+TKE+E+ IH+R+IERE EKY++KF REN+KRK EK+ELLPE+QL EW+  VDELK+Q
Sbjct: 594 EDMTKEDEAEIHRRIIEREIEKYHKKFARENDKRKFEKEELLPESQLKEWLDGVDELKKQ 653

Query: 643 YEKELETGDIELKPTLQSVDKLKVQIEKLEQRIRTSTVQLKDREDNSQVALGTSKINYID 702
           Y++EL+TG +ELKPT+ +V+K++ QIE+L+ RI+T+++QLKD+E+NSQV+LGTSKINYID
Sbjct: 654 YKEELKTGVVELKPTMNTVEKIEKQIERLDNRIQTNSIQLKDKEENSQVSLGTSKINYID 713

Query: 703 PRLSVVFCKKYNVPIEKVFTKSLREKFKWAIESADENWRF 742
           PRL+VVFCKKY+VPIEK+FTK+LREKFKWAIES DENWRF
Sbjct: 714 PRLTVVFCKKYDVPIEKIFTKTLREKFKWAIESVDENWRF 753

>YOL006C (TOP1) [4810] chr15 complement(313078..315387) DNA
           topoisomerase I, relaxes supercoiled DNA by making
           single-stranded breaks [2310 bp, 769 aa]
          Length = 769

 Score = 1042 bits (2694), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 492/632 (77%), Positives = 551/632 (87%)

Query: 111 NDDDSIKWTTLRHNGVIFPPEYEPLPLHVKLYYDGKPVDLPPQAEEVAGFFAALLESDHA 170
           N+DD+IKW TL+HNGVIFPP Y+PLP H+KLYYDGKPVDLPPQAEEVAGFFAALLESDHA
Sbjct: 138 NEDDTIKWVTLKHNGVIFPPPYQPLPSHIKLYYDGKPVDLPPQAEEVAGFFAALLESDHA 197

Query: 171 KNPVFQKNFFNDFLEVLKXXXXXXXXXXXXSLDKCDFTKMFDHFXXXXXXXXXXXXXXXX 230
           KNPVFQKNFFNDFL+VLK               +CDFTKMFD+F                
Sbjct: 198 KNPVFQKNFFNDFLQVLKESGGPLNGIEIKEFSRCDFTKMFDYFQLQKEQKKQLTSQEKK 257

Query: 231 XXXXXXXXXXXPFKFCYLDGRREQVGNFRIEPAGLFRGRGAHPKTGKLKRRVYPEDVVLN 290
                       +KFC LDGRREQVGNF++EP  LFRGRGAHPKTGKLKRRV PED+VLN
Sbjct: 258 QIRLEREKFEEDYKFCELDGRREQVGNFKVEPPDLFRGRGAHPKTGKLKRRVNPEDIVLN 317

Query: 291 LDKDAPIPEPPTGHKWGEIRHDNTVQWLAMWRENISNSFKYVRFAASSSLKGISDYKKFE 350
           L KDAP+P  P GHKWGEIRHDNTVQWLAMWRENI NSFKYVR AA+SSLKG SDYKKFE
Sbjct: 318 LSKDAPVPPAPEGHKWGEIRHDNTVQWLAMWRENIFNSFKYVRLAANSSLKGQSDYKKFE 377

Query: 351 KARQLKDHIDAVRKDYNKQLKSKVMLDRQMAVATYLIDVFALRAGGEKSEDEADTVGCCS 410
           KARQLK +IDA+R+DY + LKSKVML+RQ AVA YLIDVFALRAGGEKSEDEADTVGCCS
Sbjct: 378 KARQLKSYIDAIRRDYTRNLKSKVMLERQKAVAIYLIDVFALRAGGEKSEDEADTVGCCS 437

Query: 411 LRYEHVTLKPPNTVIFDFLGKDSIRFYQEVQVDKQVFKNLTIFKRPPKQPGHQLFDRLDP 470
           LRYEHVTLKPPNTVIFDFLGKDSIRFYQEV+VDKQVFKNLTIFKRPPKQPGHQLFDRLDP
Sbjct: 438 LRYEHVTLKPPNTVIFDFLGKDSIRFYQEVEVDKQVFKNLTIFKRPPKQPGHQLFDRLDP 497

Query: 471 SILNKHLQNYMPGLTAKVFRTYNASKTMQDQLDLIPNEGTVAEKMLRYNAANRTVAILCN 530
           SILNK+LQNYMPGLTAKVFRTYNASKTMQDQLDLIPN+G+VAEK+L+YNAANRTVAILCN
Sbjct: 498 SILNKYLQNYMPGLTAKVFRTYNASKTMQDQLDLIPNKGSVAEKILKYNAANRTVAILCN 557

Query: 531 HQRTVTKGHAAAVQKANDKIEELEWQKIRYKRAILQLDKNELKKNLKYFEEISDLTKEEE 590
           HQRTVTKGHA  V+KAN++I+ELEWQKIR KRAILQLDK+ LKK  KYFEEI DLTKE+E
Sbjct: 558 HQRTVTKGHAQTVEKANNRIQELEWQKIRCKRAILQLDKDLLKKEPKYFEEIDDLTKEDE 617

Query: 591 SAIHKRVIEREREKYNRKFLRENEKRKHEKQELLPEAQLTEWMTQVDELKEQYEKELETG 650
           + IHKR+I+RE EKY RKF+REN+KRK EK+ELLPE+QL EW+ +VDE K+++EKEL+TG
Sbjct: 618 ATIHKRIIDREIEKYQRKFVRENDKRKFEKEELLPESQLKEWLEKVDEKKQEFEKELKTG 677

Query: 651 DIELKPTLQSVDKLKVQIEKLEQRIRTSTVQLKDREDNSQVALGTSKINYIDPRLSVVFC 710
           ++ELK +  SV+K+K Q+EKLEQRI+TS++QLKD+E+NSQV+LGTSKINYIDPRLSVVFC
Sbjct: 678 EVELKSSWNSVEKIKAQVEKLEQRIQTSSIQLKDKEENSQVSLGTSKINYIDPRLSVVFC 737

Query: 711 KKYNVPIEKVFTKSLREKFKWAIESADENWRF 742
           KKY+VPIEK+FTK+LREKFKWAIES DENWRF
Sbjct: 738 KKYDVPIEKIFTKTLREKFKWAIESVDENWRF 769

>KLLA0C06116g complement(536524..538881) similar to sp|P04786
           Saccharomyces cerevisiae YOL006c TOP1 DNA topoisomerase
           I singleton, start by similarity
          Length = 785

 Score = 1019 bits (2634), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 482/643 (74%), Positives = 546/643 (84%), Gaps = 1/643 (0%)

Query: 101 SDEFKWWEQ-ENDDDSIKWTTLRHNGVIFPPEYEPLPLHVKLYYDGKPVDLPPQAEEVAG 159
           S++FKWWE  + +DD+IKWTTL+HNGVIFP  YEPLP HVKLYY+GKPVDLPPQAEEVAG
Sbjct: 143 SEDFKWWENGDKEDDTIKWTTLKHNGVIFPSTYEPLPAHVKLYYNGKPVDLPPQAEEVAG 202

Query: 160 FFAALLESDHAKNPVFQKNFFNDFLEVLKXXXXXXXXXXXXSLDKCDFTKMFDHFXXXXX 219
           FFAA+LESDH K P FQKNF +DFL+VLK               K DFTK+F++F     
Sbjct: 203 FFAAILESDHVKIPTFQKNFLHDFLQVLKENGGARNGVQIKEFGKLDFTKIFEYFQVQKE 262

Query: 220 XXXXXXXXXXXXXXXXXXXXXXPFKFCYLDGRREQVGNFRIEPAGLFRGRGAHPKTGKLK 279
                                 P+KFC +DGR EQVGNFRIEP GLFRGRGAHPK GKLK
Sbjct: 263 QKKQLSPQEKKQLRLEKEELEKPYKFCEIDGRVEQVGNFRIEPPGLFRGRGAHPKNGKLK 322

Query: 280 RRVYPEDVVLNLDKDAPIPEPPTGHKWGEIRHDNTVQWLAMWRENISNSFKYVRFAASSS 339
           RRVYPEDVVLNLDK+APIPEPP GHKWGEIRHDNTVQWL+MWRENISNSFKYVRFAA+S+
Sbjct: 323 RRVYPEDVVLNLDKEAPIPEPPKGHKWGEIRHDNTVQWLSMWRENISNSFKYVRFAANST 382

Query: 340 LKGISDYKKFEKARQLKDHIDAVRKDYNKQLKSKVMLDRQMAVATYLIDVFALRAGGEKS 399
           LKG+SD+KKFEKAR LKDHID VR DY  ++KS   LDRQMAVATYLIDVFALRAGGEK+
Sbjct: 383 LKGMSDFKKFEKARMLKDHIDKVRTDYKSKMKSPKTLDRQMAVATYLIDVFALRAGGEKA 442

Query: 400 EDEADTVGCCSLRYEHVTLKPPNTVIFDFLGKDSIRFYQEVQVDKQVFKNLTIFKRPPKQ 459
           +DEADTVGCCSLRYEHVTL+PPNTV+FDFLGKDSIR+YQEV+VD QVFKNL IFKRPP  
Sbjct: 443 DDEADTVGCCSLRYEHVTLRPPNTVVFDFLGKDSIRYYQEVEVDAQVFKNLKIFKRPPSG 502

Query: 460 PGHQLFDRLDPSILNKHLQNYMPGLTAKVFRTYNASKTMQDQLDLIPNEGTVAEKMLRYN 519
           PGHQLFDRLDPSILNKHLQNYMPGLTAKVFRTYNASKTMQDQLDLIPNEGTVAEK+LRYN
Sbjct: 503 PGHQLFDRLDPSILNKHLQNYMPGLTAKVFRTYNASKTMQDQLDLIPNEGTVAEKILRYN 562

Query: 520 AANRTVAILCNHQRTVTKGHAAAVQKANDKIEELEWQKIRYKRAILQLDKNELKKNLKYF 579
           AANRTVAILCNHQRTVTKGHA++VQKA ++IEELEWQK+RYKRAILQLDK+E KKN  YF
Sbjct: 563 AANRTVAILCNHQRTVTKGHASSVQKATERIEELEWQKVRYKRAILQLDKSERKKNQNYF 622

Query: 580 EEISDLTKEEESAIHKRVIEREREKYNRKFLRENEKRKHEKQELLPEAQLTEWMTQVDEL 639
           +EI DLTKEEE  IHKR+IEREREKY RKF RENEKRK  K++ +P++QL EW+ +VD+L
Sbjct: 623 KEIDDLTKEEELTIHKRIIEREREKYKRKFERENEKRKFSKEDPIPDSQLLEWLAKVDDL 682

Query: 640 KEQYEKELETGDIELKPTLQSVDKLKVQIEKLEQRIRTSTVQLKDREDNSQVALGTSKIN 699
           ++ YE+E  TG IEL+ +LQ+++KLK  +EKLE+RI   ++QLKD+EDNS VALGTSKIN
Sbjct: 683 EKLYERESTTGKIELRESLQNLEKLKQNVEKLEKRITNCSLQLKDKEDNSTVALGTSKIN 742

Query: 700 YIDPRLSVVFCKKYNVPIEKVFTKSLREKFKWAIESADENWRF 742
           YIDPRLSV FCKK++VPIEKVFTK+LR+KF+WAIESADENW F
Sbjct: 743 YIDPRLSVAFCKKFDVPIEKVFTKTLRDKFRWAIESADENWTF 785

>ACL008C [1041] [Homologous to ScYOL006C (TOP1) - SH]
           (341157..343355) [2199 bp, 732 aa]
          Length = 732

 Score = 1011 bits (2615), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 477/649 (73%), Positives = 548/649 (84%), Gaps = 2/649 (0%)

Query: 95  DAEERESDEFKWWEQEND-DDSIKWTTLRHNGVIFPPEYEPLPLHVKLYYDGKPVDLPPQ 153
           D EE +S+EFKWWE+E + DDS+KW TLRHNGV+FPPEY PLP HV+LYY GK V+LP +
Sbjct: 85  DGEE-DSEEFKWWEREEEKDDSVKWVTLRHNGVMFPPEYTPLPSHVRLYYGGKAVELPAE 143

Query: 154 AEEVAGFFAALLESDHAKNPVFQKNFFNDFLEVLKXXXXXXXXXXXXSLDKCDFTKMFDH 213
           AEEVAGFFAALL+SDHA+NPVFQKNFF DFL VL                KCDF+KM  +
Sbjct: 144 AEEVAGFFAALLQSDHAQNPVFQKNFFEDFLSVLNKHGGARNGIDIQEFSKCDFSKMHAY 203

Query: 214 FXXXXXXXXXXXXXXXXXXXXXXXXXXXPFKFCYLDGRREQVGNFRIEPAGLFRGRGAHP 273
                                       P +   L GR+EQV  F+I+P  LFRGRGAHP
Sbjct: 204 IQQQRVQMKQLSSHERKLLKQEKGQTEGPVQVLLLTGRKEQVDTFKIDPPDLFRGRGAHP 263

Query: 274 KTGKLKRRVYPEDVVLNLDKDAPIPEPPTGHKWGEIRHDNTVQWLAMWRENISNSFKYVR 333
           KTGKLKRRV PEDVVLNLDKDAPIPEPP GHKWGEIRHDNTVQWL MWRENISNSFKYVR
Sbjct: 264 KTGKLKRRVQPEDVVLNLDKDAPIPEPPAGHKWGEIRHDNTVQWLCMWRENISNSFKYVR 323

Query: 334 FAASSSLKGISDYKKFEKARQLKDHIDAVRKDYNKQLKSKVMLDRQMAVATYLIDVFALR 393
            AA+SSLKG+SD+KKFEK+R+LK++ID +R DY K LKSKVMLDRQ+AVATYLIDVFALR
Sbjct: 324 LAANSSLKGMSDFKKFEKSRELKNYIDIIRADYRKNLKSKVMLDRQIAVATYLIDVFALR 383

Query: 394 AGGEKSEDEADTVGCCSLRYEHVTLKPPNTVIFDFLGKDSIRFYQEVQVDKQVFKNLTIF 453
           AGGEKSEDEADTVGCCSLRYEH++LKPPNTV+FDFLGKDSIR+YQEV+VDKQVFKNL+IF
Sbjct: 384 AGGEKSEDEADTVGCCSLRYEHISLKPPNTVVFDFLGKDSIRYYQEVEVDKQVFKNLSIF 443

Query: 454 KRPPKQPGHQLFDRLDPSILNKHLQNYMPGLTAKVFRTYNASKTMQDQLDLIPNEGTVAE 513
           KRPPK+PGHQLFDRLDPSILNKHLQNYMPGLTAKVFRTYNASKTMQDQLDLIPNEG+V E
Sbjct: 444 KRPPKEPGHQLFDRLDPSILNKHLQNYMPGLTAKVFRTYNASKTMQDQLDLIPNEGSVTE 503

Query: 514 KMLRYNAANRTVAILCNHQRTVTKGHAAAVQKANDKIEELEWQKIRYKRAILQLDKNELK 573
           KM+RYNAANR VAILCNHQRTV + HA ++QKA +KIEE +WQKIRYK+AILQLD++ELK
Sbjct: 504 KMVRYNAANRAVAILCNHQRTVGRSHAQSMQKATEKIEEYQWQKIRYKKAILQLDESELK 563

Query: 574 KNLKYFEEISDLTKEEESAIHKRVIEREREKYNRKFLRENEKRKHEKQELLPEAQLTEWM 633
            N K+F+EI+DLTKEE+ +IHKRV+EREREKY +KF RENEKRK E +ELLPE+QL  W+
Sbjct: 564 ANPKFFKEINDLTKEEQMSIHKRVLEREREKYQKKFARENEKRKFEGEELLPESQLESWL 623

Query: 634 TQVDELKEQYEKELETGDIELKPTLQSVDKLKVQIEKLEQRIRTSTVQLKDREDNSQVAL 693
             V+E+ ++Y +ELETG + +KPTLQSV+KLK QI+KLEQRIRT+++Q+KD+EDNS VAL
Sbjct: 624 ADVEEMGKEYVEELETGLVTVKPTLQSVEKLKAQIDKLEQRIRTTSIQMKDKEDNSTVAL 683

Query: 694 GTSKINYIDPRLSVVFCKKYNVPIEKVFTKSLREKFKWAIESADENWRF 742
            TSKI+YIDPRLSV FCKKY+VP+EKVFTK+LREKFKWAIESADENWRF
Sbjct: 684 STSKISYIDPRLSVAFCKKYDVPLEKVFTKTLREKFKWAIESADENWRF 732

>CAGL0J11660g 1133494..1135728 highly similar to sp|P04786
           Saccharomyces cerevisiae YOL006c TOP1 DNA topoisomerase
           I, hypothetical start
          Length = 744

 Score =  975 bits (2521), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 459/643 (71%), Positives = 535/643 (83%)

Query: 100 ESDEFKWWEQENDDDSIKWTTLRHNGVIFPPEYEPLPLHVKLYYDGKPVDLPPQAEEVAG 159
           E +++KWWE E +DD+IKW +L+HNGV+FPPEYEPLP HVKLYYDGKPVDLPP AEEVAG
Sbjct: 102 EEEKYKWWENEKNDDTIKWVSLKHNGVLFPPEYEPLPSHVKLYYDGKPVDLPPAAEEVAG 161

Query: 160 FFAALLESDHAKNPVFQKNFFNDFLEVLKXXXXXXXXXXXXSLDKCDFTKMFDHFXXXXX 219
           FFA LL +DHAKNPVFQKNFF DFL+VLK               KCDF+KM  +F     
Sbjct: 162 FFANLLHTDHAKNPVFQKNFFEDFLQVLKESGGTRNKINITVFKKCDFSKMNQYFELKKE 221

Query: 220 XXXXXXXXXXXXXXXXXXXXXXPFKFCYLDGRREQVGNFRIEPAGLFRGRGAHPKTGKLK 279
                                  FKFC LDGR+EQVGNFR+EP  LFRGRGAHPKTGKLK
Sbjct: 222 EKRNMSREEKKQIKLEKDKFEEKFKFCELDGRKEQVGNFRVEPPDLFRGRGAHPKTGKLK 281

Query: 280 RRVYPEDVVLNLDKDAPIPEPPTGHKWGEIRHDNTVQWLAMWRENISNSFKYVRFAASSS 339
           RRVYPED++LNL KDAPIP  P GH WGEIRHDNTVQWLAMW+ENI  SFKYVR AA+SS
Sbjct: 282 RRVYPEDIILNLSKDAPIPPAPQGHHWGEIRHDNTVQWLAMWKENIFGSFKYVRLAANSS 341

Query: 340 LKGISDYKKFEKARQLKDHIDAVRKDYNKQLKSKVMLDRQMAVATYLIDVFALRAGGEKS 399
           L G SD KKFEKAR+LK +I  +RKDY +  KSK+ML+RQ AVATY IDVFALRAGGEKS
Sbjct: 342 LNGQSDLKKFEKARELKKYIGDIRKDYRESFKSKIMLERQKAVATYFIDVFALRAGGEKS 401

Query: 400 EDEADTVGCCSLRYEHVTLKPPNTVIFDFLGKDSIRFYQEVQVDKQVFKNLTIFKRPPKQ 459
           EDEADTVGCCSLR+EHVTLKPPNTVIFDFLGKDSIR++QEV+V+KQVFKNL IFKRPPK+
Sbjct: 402 EDEADTVGCCSLRFEHVTLKPPNTVIFDFLGKDSIRYHQEVEVEKQVFKNLKIFKRPPKK 461

Query: 460 PGHQLFDRLDPSILNKHLQNYMPGLTAKVFRTYNASKTMQDQLDLIPNEGTVAEKMLRYN 519
            G  LFDRLDPSILNK+LQNYMPGLTAKVFRTYNASKTMQDQLDLIPNEGTVAEK+L+YN
Sbjct: 462 DGDDLFDRLDPSILNKYLQNYMPGLTAKVFRTYNASKTMQDQLDLIPNEGTVAEKLLKYN 521

Query: 520 AANRTVAILCNHQRTVTKGHAAAVQKANDKIEELEWQKIRYKRAILQLDKNELKKNLKYF 579
           AANR VAILCNHQR+VTKGHA +V+K N KIEEL WQKIR K+ ILQL+ +  +KN KYF
Sbjct: 522 AANRAVAILCNHQRSVTKGHAQSVEKMNQKIEELLWQKIRLKKGILQLEPSRAQKNKKYF 581

Query: 580 EEISDLTKEEESAIHKRVIEREREKYNRKFLRENEKRKHEKQELLPEAQLTEWMTQVDEL 639
           +EI+D+TK E++ IHKR+++RERE+  +KF R+NEK   EK++ LP+ +L EW+ +VD+L
Sbjct: 582 KEINDMTKVEQATIHKRIVDRERERLKKKFERDNEKLVAEKKDPLPKTELKEWLKKVDDL 641

Query: 640 KEQYEKELETGDIELKPTLQSVDKLKVQIEKLEQRIRTSTVQLKDREDNSQVALGTSKIN 699
           ++QY+ EL+TG +ELK T+QSV+KL+ Q+EKLE+RI+TS++QLKD+E+NSQV+LGTSKIN
Sbjct: 642 EKQYKTELKTGKVELKATMQSVEKLEKQVEKLEERIKTSSIQLKDKEENSQVSLGTSKIN 701

Query: 700 YIDPRLSVVFCKKYNVPIEKVFTKSLREKFKWAIESADENWRF 742
           YIDPRLSVVFCKKYNVPIEK+FTK+LREKF WAIESADENWRF
Sbjct: 702 YIDPRLSVVFCKKYNVPIEKIFTKTLREKFAWAIESADENWRF 744

>CAGL0E02431g complement(230559..232712) highly similar to sp|P04786
           Saccharomyces cerevisiae YOL006c TOP1 DNA topoisomerase
           I, hypothetical start
          Length = 717

 Score =  936 bits (2419), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 447/652 (68%), Positives = 523/652 (80%), Gaps = 4/652 (0%)

Query: 95  DAEERESDE----FKWWEQENDDDSIKWTTLRHNGVIFPPEYEPLPLHVKLYYDGKPVDL 150
           D EE  SD+    +KWWE+++ DD+IKWTTL HNGV+FPP YE LP HVKLYY+G PVDL
Sbjct: 66  DLEENVSDDLEEDYKWWEEQDKDDTIKWTTLEHNGVLFPPPYEALPSHVKLYYEGNPVDL 125

Query: 151 PPQAEEVAGFFAALLESDHAKNPVFQKNFFNDFLEVLKXXXXXXXXXXXXSLDKCDFTKM 210
           P +AEEVAGFFA LLE+ HA+NPVFQKNFF DF  VL             S D+ DF+ M
Sbjct: 126 PLEAEEVAGFFAHLLETPHAQNPVFQKNFFEDFKHVLNDAGGTQNGIEIESFDRMDFSAM 185

Query: 211 FDHFXXXXXXXXXXXXXXXXXXXXXXXXXXXPFKFCYLDGRREQVGNFRIEPAGLFRGRG 270
            D+F                            +KFC LDGRREQVGNF++EP  LFRGRG
Sbjct: 186 HDYFVQLKEEKKSMTAMQKKEIRLEREKFEEKYKFCELDGRREQVGNFKVEPPDLFRGRG 245

Query: 271 AHPKTGKLKRRVYPEDVVLNLDKDAPIPEPPTGHKWGEIRHDNTVQWLAMWRENISNSFK 330
           AHPKTGKLKRR+ PED+VLNL + APIP PP+GH+WGEIRHDNTVQWLAMWRENI  SFK
Sbjct: 246 AHPKTGKLKRRIRPEDIVLNLGEGAPIPPPPSGHQWGEIRHDNTVQWLAMWRENIFGSFK 305

Query: 331 YVRFAASSSLKGISDYKKFEKARQLKDHIDAVRKDYNKQLKSKVMLDRQMAVATYLIDVF 390
           YVR AA+SSLKG SD+KKFEKAR+LK HID +RK+Y    KSK+M++RQ AVA YLIDVF
Sbjct: 306 YVRLAANSSLKGQSDFKKFEKARELKKHIDRIRKEYRNNFKSKLMVERQKAVAVYLIDVF 365

Query: 391 ALRAGGEKSEDEADTVGCCSLRYEHVTLKPPNTVIFDFLGKDSIRFYQEVQVDKQVFKNL 450
           ALRAGGEKSE+EADTVGCCSLRYEH+TLKPPNTVIFDFLGKDSIRFYQEVQVD +VFKNL
Sbjct: 366 ALRAGGEKSEEEADTVGCCSLRYEHITLKPPNTVIFDFLGKDSIRFYQEVQVDPKVFKNL 425

Query: 451 TIFKRPPKQPGHQLFDRLDPSILNKHLQNYMPGLTAKVFRTYNASKTMQDQLDLIPNEGT 510
            +FK+PPKQPGHQLFDRLDPS+LNK LQNYM GLTAKVFRTYNASKTMQ+QLDLIPNEG+
Sbjct: 426 ALFKKPPKQPGHQLFDRLDPSLLNKFLQNYMTGLTAKVFRTYNASKTMQEQLDLIPNEGS 485

Query: 511 VAEKMLRYNAANRTVAILCNHQRTVTKGHAAAVQKANDKIEELEWQKIRYKRAILQLDKN 570
           VAEK+L+YNAANRTVAILCNHQRTVT GHA +V K++D+IEE +WQK R K+ ILQ++ +
Sbjct: 486 VAEKLLKYNAANRTVAILCNHQRTVTAGHAKSVAKSSDRIEEFKWQKERLKKGILQIEPD 545

Query: 571 ELKKNLKYFEEISDLTKEEESAIHKRVIEREREKYNRKFLRENEKRKHEKQELLPEAQLT 630
            +K    YFE+I+ + KE E+ IH+R+IERE +KY+ KF REN+KRK E +E LPE  L 
Sbjct: 546 RIKDTPNYFEDINSIDKEIEAKIHERIIEREIQKYHNKFKRENDKRKFEGEEPLPEETLK 605

Query: 631 EWMTQVDELKEQYEKELETGDIELKPTLQSVDKLKVQIEKLEQRIRTSTVQLKDREDNSQ 690
           EW+  V +LK+QY +EL TG ++LK ++ SV+KL+  IE+L+QRI TS VQL+DRE NS+
Sbjct: 606 EWLDNVKQLKQQYAEELATGIVQLKASMNSVEKLEKAIERLDQRISTSQVQLQDREANSE 665

Query: 691 VALGTSKINYIDPRLSVVFCKKYNVPIEKVFTKSLREKFKWAIESADENWRF 742
           V+LGTSKINYIDPRLSVVFCKKY VPIEK+FTKSLREKFKWAIES DE WRF
Sbjct: 666 VSLGTSKINYIDPRLSVVFCKKYGVPIEKIFTKSLREKFKWAIESVDETWRF 717

>KLLA0F04609g complement(451579..454329) similar to sp|P40467
           Saccharomyces cerevisiae YIL130w, start by similarity
          Length = 916

 Score = 34.3 bits (77), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 36/138 (26%), Positives = 58/138 (42%), Gaps = 18/138 (13%)

Query: 376 LDRQMAVATYLIDVFAL----RAGGEKSEDEADTVGCCSLRYEHVTLKPPNTVIFDFLGK 431
           L+RQ+    +L + F +       G  + + + T    S      +L P    +  +L  
Sbjct: 780 LERQIPTPNFLTNTFPVEPNTSISGVNTLNTSQTANLFSSTNFGASLDPVENNMDRYLPV 839

Query: 432 DSIRFYQEVQVDKQVFKNLTIFKRPPKQ------PGHQLFDRLDPSILNKHLQNYMPGLT 485
           DS +  Q +Q   Q     T  + P         PG  +FD+LD  +  ++L  YM G+T
Sbjct: 840 DSNQNKQSLQQTPQYISTTTPNQIPDSAVDGTYVPG--MFDQLDVQLFGRYLPPYMSGVT 897

Query: 486 AKVFRTYNASKTMQDQLD 503
           A      N SKT ++ LD
Sbjct: 898 A------NDSKTKEEPLD 909

>Sklu_1708.1 YBL061C, Contig c1708 249-2276 reverse complement
          Length = 675

 Score = 31.6 bits (70), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 14/35 (40%), Positives = 18/35 (51%)

Query: 702 DPRLSVVFCKKYNVPIEKVFTKSLREKFKWAIESA 736
           DP   +  C  Y V  E  F K  RE F+WA+ +A
Sbjct: 446 DPEAMLGLCAWYLVGAEPAFEKDEREAFQWALRAA 480

>CAGL0F05489g 553902..555365 similar to tr|Q03944 Saccharomyces
           cerevisiae YDR200c or tr|Q06001 Saccharomyces cerevisiae
           YLR238w, hypothetical start
          Length = 487

 Score = 30.8 bits (68), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 42/193 (21%), Positives = 84/193 (43%), Gaps = 21/193 (10%)

Query: 451 TIFKRPPKQPGHQLFDRLDPSILNKHL---------QNYMPGLTAK--VFRTYNASKTMQ 499
           T+    PK   H + ++  P++ NK +         ++ +  +TA+   F        + 
Sbjct: 220 TVATNLPKTIDHTIHNQQQPTLSNKSIGDNNFNLPPESAVSTVTAQRAAFEAAMFGNVLH 279

Query: 500 DQLD--LIPNEGTVAEKMLRYNAANRTVAILCNHQRTVTKGHAAAVQKANDKIEELEWQK 557
             LD  ++  +  +   +   N+A  T   L N  +T++   A   Q+   K+  ++   
Sbjct: 280 SDLDDNILGVQTEILSGIFVNNSAG-TSPNLLNTIKTLSTELALEKQET-QKLTAMQNFL 337

Query: 558 IRYKRAILQLDKNELKKNLKYFEEISDLTKEEESAIHKRVIE------REREKYNRKFLR 611
           + Y   + ++ K   + N+KY  ++ +  ++  S  H RVI       ++ E+ N  F +
Sbjct: 338 VNYTSKLDEIKKVMDQNNVKYLAKLQESLRQSLSETHNRVINERLDRRKKLEEGNESFKQ 397

Query: 612 ENEKRKHEKQELL 624
           E +K   EKQELL
Sbjct: 398 ERDKEIKEKQELL 410

>YLR087C (CSF1) [3502] chr12 complement(306856..315732) Protein
            required for normal growth rate and resistance to NaCl
            and H2O2 [8877 bp, 2958 aa]
          Length = 2958

 Score = 30.8 bits (68), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 24/94 (25%), Positives = 42/94 (44%), Gaps = 19/94 (20%)

Query: 601  EREKYNRKFLRENEKRKHEKQELLPEAQLTEWMTQVDELKEQYEK-ELETGDIELKPTLQ 659
            E++KYNR FL              P  Q++ W  +  ELK+ + +   E  D+   P+  
Sbjct: 2141 EKDKYNRSFL--------------PNMQISYWFKRCGELKDWFFRFHGEALDVNFVPSFM 2186

Query: 660  SVDKLKVQ----IEKLEQRIRTSTVQLKDREDNS 689
             V +  +Q     ++L++ I   +  L+   DNS
Sbjct: 2187 DVIESTLQSMRAFQELKKNILDVSESLRAENDNS 2220

>AFR702W [3895] [Homologous to ScYCL029C (BIK1) - SH]
           complement(1734746..1736239) [1494 bp, 497 aa]
          Length = 497

 Score = 30.4 bits (67), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 49/189 (25%), Positives = 84/189 (44%), Gaps = 20/189 (10%)

Query: 528 LCNHQRTVTKGHAAAVQKANDKIEELEWQKIRYKRAILQLDKNELKKNLKYFEEISDLTK 587
           L + QR V +    A+    +K+  LE +K R +   LQ ++  L K  +YFE   +   
Sbjct: 240 LLDDQRIVLEEIQPAIDDYEEKLRYLEAEKQRLQNT-LQSEREHLAKQKQYFEAEHEQLL 298

Query: 588 EEESAIHKRVIERE----REKYNRKFLRENEKRKHEKQELLPE-----AQLTEWMTQVDE 638
                +HK + E E    R++  +  + E+E +  E   L  E      QL E + Q +E
Sbjct: 299 SVVDELHKEIKENEERMLRQRRRQTIIMEDEGQVLEMDTLKSENDRLKRQLEELLKQCEE 358

Query: 639 ---LKEQYEKE---LETGDIELKPTLQSVDKLKVQIEKLEQRIRTSTVQLKDREDNSQVA 692
              LK +++KE   L+T ++ L     S+ K   +     QR     VQ +  +  + +A
Sbjct: 359 QELLKAEWQKERARLQTDNLSLNDGYSSLSKELAET----QRKLDDIVQGQSLKSGTDLA 414

Query: 693 LGTSKINYI 701
              S+I Y+
Sbjct: 415 SYQSEIEYL 423

>AFR301C [3493] [Homologous to ScYIL159W (BNR1) - SH]
           (981215..986182) [4968 bp, 1655 aa]
          Length = 1655

 Score = 30.4 bits (67), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 31/104 (29%), Positives = 47/104 (45%), Gaps = 10/104 (9%)

Query: 531 HQRTVTKGHAAAVQKANDK--IEELEWQKIRYKRAI---LQLDKNELKKNLKYFEEISDL 585
           +QR V +  AA  Q  + K  + +LE QK   K  I   L   K  L + L Y  E+ D 
Sbjct: 482 NQRAVQELEAAHAQIEDLKKAVTKLEHQKFVTKSIISRELSATKQTLSQKLDYIAELEDK 541

Query: 586 TKEEESAIHKRVIEREREKYNRKFLRENEKRKHEKQELLPEAQL 629
            +  E+ +     + EREKY R+    + +R+     +   AQL
Sbjct: 542 LEALETQL-----KNEREKYEREIANRDSERRLSNSSVFLFAQL 580

>Scas_683.39
          Length = 224

 Score = 29.6 bits (65), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 23/106 (21%), Positives = 46/106 (43%), Gaps = 6/106 (5%)

Query: 597 VIEREREKYNRKFLRENEKRKHEKQELLPEAQLTEWMTQVDELKEQYEKELETGDIELKP 656
           +++ + EKY  K    N   KH   +L+P  +L E+  +V      +   +E    E+ P
Sbjct: 49  LLQSKIEKYTYKIYHSNRFGKHNLSKLIPRHKLVEFANEVFGFDGWHVDVIEVDASEMPP 108

Query: 657 TLQSVDKLKVQIEKLEQRIRTST---VQLKDREDNSQVALGTSKIN 699
              S  +L V+ + ++  +       + LKD  +     +G + +N
Sbjct: 109 ---SSAQLNVEDDTVKHTVLAEAQVKITLKDGTNTQMGGIGKATMN 151

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.316    0.134    0.391 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 23,588,517
Number of extensions: 1045985
Number of successful extensions: 5760
Number of sequences better than 10.0: 356
Number of HSP's gapped: 5625
Number of HSP's successfully gapped: 467
Length of query: 742
Length of database: 16,596,109
Length adjustment: 109
Effective length of query: 633
Effective length of database: 12,822,747
Effective search space: 8116798851
Effective search space used: 8116798851
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 65 (29.6 bits)