Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Sklu_2419.730730713570.0
Kwal_56.224883082423262e-35
Scas_644.133432453212e-34
YOL007C3412532617e-26
CAGL0E02409g3572472283e-21
ACL009C3211641903e-16
Kwal_23.4878307711196e-07
KLLA0F03465g359931091e-05
Scas_694.26382991011e-04
Scas_671.34323146964e-04
CAGL0J10076g37864940.001
ADL251C23661900.002
YNL058C31624770.11
YIL117C (PRM5)31845770.11
AFR524W45951681.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Sklu_2419.7
         (307 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Sklu_2419.7 YOL007C, Contig c2419 9271-10194 reverse complement       527   0.0  
Kwal_56.22488                                                         130   2e-35
Scas_644.13                                                           128   2e-34
YOL007C (YOL007C) [4809] chr15 complement(311342..312367) Protei...   105   7e-26
CAGL0E02409g complement(228503..229576) similar to sp|Q08054 Sac...    92   3e-21
ACL009C [1040] [Homologous to ScYOL007C - SH] (339554..340519) [...    78   3e-16
Kwal_23.4878                                                           50   6e-07
KLLA0F03465g complement(325270..326349) no similarity, hypotheti...    47   1e-05
Scas_694.26                                                            44   1e-04
Scas_671.34                                                            42   4e-04
CAGL0J10076g complement(985926..987062) weakly similar to sp|P53...    41   0.001
ADL251C [1490] [Homologous to ScYNL058C - SH; ScYIL117C (PRM5) -...    39   0.002
YNL058C (YNL058C) [4531] chr14 complement(515761..516711) Protei...    34   0.11 
YIL117C (PRM5) [2559] chr9 complement(140610..141566) Protein tr...    34   0.11 
AFR524W [3716] [Homologous to ScYOR298W - SH] complement(1378378...    31   1.4  

>Sklu_2419.7 YOL007C, Contig c2419 9271-10194 reverse complement
          Length = 307

 Score =  527 bits (1357), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 259/307 (84%), Positives = 259/307 (84%)

Query: 1   MISKLSSVIVLLAYLXXXXXXXXXXXXXXXXXPSGKETTILVNVVQANVLPTLSLMTSSK 60
           MISKLSSVIVLLAYL                 PSGKETTILVNVVQANVLPTLSLMTSSK
Sbjct: 1   MISKLSSVIVLLAYLASVTAANNNATSVSSASPSGKETTILVNVVQANVLPTLSLMTSSK 60

Query: 61  STAFATFMPTIPVTGDNKNIYTTSYAEGTVFIVIGAIMGFIFVVFTVIWLLLGIRAWYCA 120
           STAFATFMPTIPVTGDNKNIYTTSYAEGTVFIVIGAIMGFIFVVFTVIWLLLGIRAWYCA
Sbjct: 61  STAFATFMPTIPVTGDNKNIYTTSYAEGTVFIVIGAIMGFIFVVFTVIWLLLGIRAWYCA 120

Query: 121 RKEYKLQALENKYQYDPFSFNAMSTLDVNSHCSDGSGDSDISEKVLKFNQXXXXXXXXXX 180
           RKEYKLQALENKYQYDPFSFNAMSTLDVNSHCSDGSGDSDISEKVLKFNQ          
Sbjct: 121 RKEYKLQALENKYQYDPFSFNAMSTLDVNSHCSDGSGDSDISEKVLKFNQSRRKSTHSLG 180

Query: 181 XXXXXXXXXXYENGGKQAVPAVTSSRASMFISPTEILQQQNSSYLNFNGTSQEGSXXXXX 240
                     YENGGKQAVPAVTSSRASMFISPTEILQQQNSSYLNFNGTSQEGS     
Sbjct: 181 SSSTLNLLNKYENGGKQAVPAVTSSRASMFISPTEILQQQNSSYLNFNGTSQEGSTTSTP 240

Query: 241 XXXXXXQFIGSTPNCFDRGRAPGVLLFENPTDALTVSVPLSDTRQEQTRKSFRPPSVHLD 300
                 QFIGSTPNCFDRGRAPGVLLFENPTDALTVSVPLSDTRQEQTRKSFRPPSVHLD
Sbjct: 241 TEKTITQFIGSTPNCFDRGRAPGVLLFENPTDALTVSVPLSDTRQEQTRKSFRPPSVHLD 300

Query: 301 QMFDEDE 307
           QMFDEDE
Sbjct: 301 QMFDEDE 307

>Kwal_56.22488
          Length = 308

 Score =  130 bits (326), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 83/242 (34%), Positives = 115/242 (47%), Gaps = 31/242 (12%)

Query: 67  FMPTIPVTGDNKNIYTTSYAEGTVFIVIGAIMGFIFVVFTVIWLLLGIRAWYCARKEYKL 126
           F P +P +  NKNI  TSY  GTVFI +G  MG I ++FT+ WL L  +AW+ ARKEY L
Sbjct: 95  FTPKVPDSTGNKNIARTSYRNGTVFIAVGGTMGVIALIFTLTWLGLAAKAWHSARKEYHL 154

Query: 127 QALENKYQYDPFSFNAMSTLDVNSHCSDGSGDSDISEKVLKFNQXXXXXXXXXXXXXXXX 186
            A++N+YQ DPF F+   T + +S  S+GS  SD+SE+VLK                   
Sbjct: 155 DAIQNRYQTDPFLFH---TSEGDSDSSEGSDRSDVSERVLKTRASTRPSIYSLGSQSTLN 211

Query: 187 XXXXYENGGKQAVPAVTSSRASMFISPTEILQQ--QNSSYLNFNGTSQEGSXXXXXXXXX 244
               +           T++R SMFISPTEI++    N S ++    + E           
Sbjct: 212 LLQRHPQDNAH---ITTANRGSMFISPTEIIKNSANNKSLMSLATPTSEN---------- 258

Query: 245 XXQFIGSTPNCFDRGRAPGVLLFENPTDALTVSVPLSDTRQEQTRKSFRPPSVHLDQMFD 304
                      F+        L  +       S+P +D       +  RPPSVHL++MFD
Sbjct: 259 -----------FNITPVLNTDLTSHFDPIYQKSLPAND--PNNVNRKARPPSVHLEKMFD 305

Query: 305 ED 306
           ED
Sbjct: 306 ED 307

>Scas_644.13
          Length = 343

 Score =  128 bits (321), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 84/245 (34%), Positives = 120/245 (48%), Gaps = 21/245 (8%)

Query: 72  PVTGDNKNIYTTSYAEGTVFIVIGAIMGFIFVVFTVIWLLLGIRAWYCARKEYKLQALEN 131
           P T  N NIY T+Y +GTVFI  G+ + FI ++ +V+W +LG++AW   RKEY+L+ALE 
Sbjct: 108 PNTNGNYNIYHTNYTDGTVFIAFGSCLLFITLILSVVWAVLGLKAWRDERKEYQLRALEE 167

Query: 132 KYQYDPFSFNAMSTLDVNSHCSDGSGDSDISEKVLKFNQXXXXXXXXXXXXXXX----XX 187
           KYQYDPF     + +D +   SD    SDISEK LK                        
Sbjct: 168 KYQYDPFQL--QNEIDDSRSNSDNDSQSDISEKYLKQKSSRMSFYSLGTASALNLLNPKA 225

Query: 188 XXXYENGGKQAVPAVTSS-RASMFISPTEILQQQNSSYLNFNGTSQ--EGSXXXXXXXXX 244
              Y +     + +  S+ R SMFISPTEILQQ     + FN  S   + +         
Sbjct: 226 NDKYSDDDTNKINSAASNFRKSMFISPTEILQQD----IPFNNDSSIFDSAISTPKGEQT 281

Query: 245 XXQFIGSTPNCFDRGRAPGVLLFENPTDALTVSVPL---SDTRQEQTRKSFRPPSVHLDQ 301
               + + P+  + G     LL ++    L + +     S     Q +K++RPPS HLDQ
Sbjct: 282 STTQVIANPDNNNWG-----LLNDSSFQGLGLKLDSELPSSNENNQKKKNYRPPSAHLDQ 336

Query: 302 MFDED 306
           + D+D
Sbjct: 337 LLDQD 341

>YOL007C (YOL007C) [4809] chr15 complement(311342..312367) Protein
           of unknown function [1026 bp, 341 aa]
          Length = 341

 Score =  105 bits (261), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 93/253 (36%), Positives = 113/253 (44%), Gaps = 42/253 (16%)

Query: 71  IPVTGDNKNIYTTSYAEGTVFIVIGAIMGFIFVVFTVIWLLLGIRAWYCARKEYKLQALE 130
           IPVT  NK +Y   +  GTVFI     +G I +  T  W+ L I++W  ARKE KL+ LE
Sbjct: 115 IPVTDGNKFLYQAHHPNGTVFIAFAGCLGAILLSLTGAWIALNIKSWRSARKENKLRNLE 174

Query: 131 NKYQYDPFSFNAMSTLDVNSHCSDGSGDSDISEKVLKFNQXXXXXXXXXXXXXXXXXXXX 190
           N+YQ+DPF F   +  D  S  S  S DSDISEKVLK N                     
Sbjct: 175 NQYQHDPFYFQT-NINDDESETSSHSDDSDISEKVLKNNSSRMSLYTLGSTSVL------ 227

Query: 191 YENGGKQAVPAVTSSRASMFISPTEILQQQNSSYLNFNGTSQEGSXXXXXXXXXXXQFIG 250
             N       A  + R+SMFISPTEILQ   S   N N  SQ                + 
Sbjct: 228 --NLLNNKTDANDNFRSSMFISPTEILQ---SDANNSNTWSQSNESAIYDS-------LS 275

Query: 251 STPNCFDRGRAPGVLLF-------ENP---------TDALTVSVPLSDTRQEQTRKSFRP 294
           STP      R PG            NP          D+   S P S+  Q + +K +RP
Sbjct: 276 STP------REPGATQILGKFTDSTNPFNYTSYNLSPDSEDRSTPKSNVSQGKVKK-YRP 328

Query: 295 PSVHLDQMFDEDE 307
           PSVHLDQ+ D  E
Sbjct: 329 PSVHLDQLLDGKE 341

>CAGL0E02409g complement(228503..229576) similar to sp|Q08054
           Saccharomyces cerevisiae YOL007c CSI2 involved in chitin
           synthesis, hypothetical start
          Length = 357

 Score = 92.4 bits (228), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 74/247 (29%), Positives = 109/247 (44%), Gaps = 32/247 (12%)

Query: 71  IPVTGDNKNIYTTSYAEGTVFIVIGAIMGFIFVVFTVIWLLLGIRAWYCARKEYKLQALE 130
           IP   +NK +Y  ++  GTVF   G+ + FI +V  ++W+ L +R+W  ARKEY+++  E
Sbjct: 127 IPSAQNNKYVYHATHPSGTVFTAFGSCLAFIALVLVLVWIALTLRSWKNARKEYQIRERE 186

Query: 131 NKYQYDPFSFNAMSTLDVNSHCSDGSGDSDISEKVLKFNQXXXXXXXXXXXXXXXXXXXX 190
           NKYQ DP+ F   +    +   SD    SDISEK+LK  +                    
Sbjct: 187 NKYQLDPYYF--QNGDKDDYSSSDSDVASDISEKILK-KKASRMSLYSLGGGSAFNLLSS 243

Query: 191 YENGGKQAVPAVTSSRASMFISPTEILQQQ-------NSSYLNFNGTSQEGSXXXXXXXX 243
            +   K   P   + R SMFISPTEIL+ +       +S++ +   T +E S        
Sbjct: 244 EKLDTKPPAPPSNNPRLSMFISPTEILKNEGNTWSTDSSAFNSLTSTPREQSVANIIVPQ 303

Query: 244 XXXQFIGSTP------NCFDRGRAPGVLLFENPTDALTVSVPLSDTRQEQTRKSFRPPSV 297
                +G  P      +  D    PG            V++P  +  Q    K  RPPS 
Sbjct: 304 NGLNKLGDPPFTGKNLSNMDISSTPG------------VAIPKPNGNQ----KRGRPPSA 347

Query: 298 HLDQMFD 304
           HLD + D
Sbjct: 348 HLDDLLD 354

>ACL009C [1040] [Homologous to ScYOL007C - SH] (339554..340519) [966
           bp, 321 aa]
          Length = 321

 Score = 77.8 bits (190), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 46/164 (28%), Positives = 84/164 (51%), Gaps = 12/164 (7%)

Query: 58  SSKSTAFATFMPTIPVTGDNKNIYTTSYAEGTVFIVIGAIMGFIFVVFTVIWLLLGIRAW 117
           +S++T    + P IP   +N+NI  +    G +F+  G  +  +   F V W ++ +R+W
Sbjct: 108 ASQTTHIMEYTPGIPSPHNNQNIQKSVLPSGMLFLAFGIALCVVITAFLVSWGIVFLRSW 167

Query: 118 YCARKEYKLQALENKYQYDPFSFNAMSTLDVNSHCSDGSG-DSDISEKVLKFNQXXXXXX 176
           Y ARKE++ QA+ ++YQ      NA +  +++S  +D +  DSD+  KV K +Q      
Sbjct: 168 YFARKEHRFQAMASRYQ------NA-ALYNLSSDSADSAPYDSDLVLKVRKMDQLNRLSL 220

Query: 177 XXXXXXXXXXXXXXYENGGKQAVPAVTSSRASMFISPTEILQQQ 220
                          ++  ++++     +RASM+ISPT ++Q Q
Sbjct: 221 YSLGSMSSLGGGEHSKDANRRSL----ENRASMYISPTNLIQHQ 260

>Kwal_23.4878
          Length = 307

 Score = 50.4 bits (119), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 43/71 (60%), Gaps = 3/71 (4%)

Query: 57  TSSKSTAFATFMPTIPVTGDNKNIYTTSYAEGTVFIVIGAIMGFIFVVFTVIWLLLGIRA 116
           T+S S  FAT   T P    N +I++++   GTVFI +G+I+GFIF+V  + ++   I A
Sbjct: 42  TASSSKKFATPTITPPSIKGNPHIWSSNKPSGTVFIAVGSIVGFIFLVIVLAYV---ISA 98

Query: 117 WYCARKEYKLQ 127
           +   R+  KL+
Sbjct: 99  YISRRQTDKLR 109

>KLLA0F03465g complement(325270..326349) no similarity, hypothetical
           start
          Length = 359

 Score = 46.6 bits (109), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 28/93 (30%), Positives = 48/93 (51%), Gaps = 7/93 (7%)

Query: 71  IPVTGDNKNIYTTSYAEGTVFIVIGAIMGFIFVVFTVIWLLLGIRAWYCARKEY-KLQAL 129
           +P    N NI++++   GTVFI +G+  GFIF+   ++W ++     Y   K+  K   +
Sbjct: 94  LPSAKGNPNIWSSNKPTGTVFIAVGSAAGFIFLAL-LVWFIINTWMSYSQAKQLKKFNNM 152

Query: 130 ENKYQYDPFSFNAMSTLDVNSHCSDGSGDSDIS 162
           E ++Q +PF    +  +D +S       D DIS
Sbjct: 153 EKQFQ-NPF----IDDIDFSSGGGYYKADEDIS 180

 Score = 30.8 bits (68), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 30/114 (26%), Positives = 50/114 (43%), Gaps = 10/114 (8%)

Query: 201 AVTSSRASMFISPT-EILQQQNSSYLNFNGTSQEGSXXXXXXXXXXXQFIGSTPNCFDRG 259
           A T  R S++ISPT E++ QQ  S L FN  +Q              + +      +   
Sbjct: 247 ANTGVRKSLYISPTMEVMNQQRRSTL-FNNLNQSAVSIDTPEMMEPTRTVSPERRTYKHE 305

Query: 260 RAPGVL--LFENPTDALTVSVPLSDTRQEQTRKSFRP-----PSVHLDQMFDED 306
           ++   L  L ++  D LT S  L + +++   K         PSV+LD M +++
Sbjct: 306 KSKSSLSKLVDSTID-LTASTTLDNQKRQGRSKGHNKSSSITPSVYLDNMLEDN 358

>Scas_694.26
          Length = 382

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 34/99 (34%), Positives = 53/99 (53%), Gaps = 13/99 (13%)

Query: 36  KETTILVNVVQANVLPTLS--------LMTSSKSTAFATFMPTI-PVTGDNKNIY---TT 83
           K T  L     A  LPTLS         + SS S++ ++ +PTI P + DN N Y    +
Sbjct: 45  KSTATLSKPKLAGSLPTLSSGASTTVSSLLSSLSSSTSSAIPTIVPPSADN-NPYILGKS 103

Query: 84  SYAEGTVFIVIGAIMGFIFVVFTVIWLLLGIRAWYCARK 122
            + +GTVFI +G ++GFIF+   V W+ L + +   A++
Sbjct: 104 KHPDGTVFIAVGTLVGFIFLALLVRWVTLSVLSRRNAKR 142

>Scas_671.34
          Length = 323

 Score = 41.6 bits (96), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 33/146 (22%), Positives = 63/146 (43%), Gaps = 15/146 (10%)

Query: 88  GTVFIVIGAIMGFIFVVFTVIWLLLGIRAWYCARKEYKLQALENKYQYDPFSFNAMSTLD 147
           GTVFI++G+++G +F + ++ W   GI  +   R  ++   L  KY   P++   + + D
Sbjct: 95  GTVFIIVGSVLGAVFAILSLWW---GITTYLSYRTAHRQSILTEKYNA-PYNIQKVVSND 150

Query: 148 VNSHCSDGSGDSDISEKVLKFNQXXXXXXXXXXXXXXXXXX------XXYENGGKQAVPA 201
                SD S + D  + + K +                           +E+       +
Sbjct: 151 -----SDYSVEIDTEKGLEKPSNKASPIVSQESKELLKRSSFLSGFYDSFEDSVLDTPIS 205

Query: 202 VTSSRASMFISPTEILQQQNSSYLNF 227
             + R S+F+SPTE++Q Q    ++F
Sbjct: 206 NNNVRNSLFVSPTELIQMQRHVPMSF 231

>CAGL0J10076g complement(985926..987062) weakly similar to sp|P53947
           Saccharomyces cerevisiae YNL058c, hypothetical start
          Length = 378

 Score = 40.8 bits (94), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 35/64 (54%), Gaps = 1/64 (1%)

Query: 72  PVTGDNKNIYTTSYAEGTVFIVIGAIMGFIFVVFTVIWLLLGIRAWYCARKEYKLQALEN 131
           P   +N  I+ TS   GTVFI +G+I G I ++  + W +     +   +K+Y L+++  
Sbjct: 99  PSAENNPYIFRTSALSGTVFIAVGSIAGAILMLIFLWWSITKYLNYKRTKKDY-LESMAT 157

Query: 132 KYQY 135
           +Y Y
Sbjct: 158 QYPY 161

>ADL251C [1490] [Homologous to ScYNL058C - SH; ScYIL117C (PRM5) -
           SH] (259355..260065) [711 bp, 236 aa]
          Length = 236

 Score = 39.3 bits (90), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 33/61 (54%), Gaps = 4/61 (6%)

Query: 70  TIPVTGDNKNIYTTSYAEGTVFIVIGAIMGFIFVVFTVIWLLLGIRAWYCARKEYKLQAL 129
           T P   +N NI+ +S   G VFI +GA+   +F++  +IW L+     + +R+E +    
Sbjct: 29  TPPSAANNPNIWKSSQPPGAVFIFVGAVAAGVFLIL-IIWYLV---TEHISRRETRKSQY 84

Query: 130 E 130
           E
Sbjct: 85  E 85

>YNL058C (YNL058C) [4531] chr14 complement(515761..516711) Protein
           of unknown function [951 bp, 316 aa]
          Length = 316

 Score = 34.3 bits (77), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 11/24 (45%), Positives = 18/24 (75%)

Query: 88  GTVFIVIGAIMGFIFVVFTVIWLL 111
           GTV+I +GA++G IF+   + WL+
Sbjct: 91  GTVYIAVGAVIGAIFISILIWWLV 114

>YIL117C (PRM5) [2559] chr9 complement(140610..141566) Protein
           transcriptionally regulated by cell stress, the
           pheromone response pathway, and the cell integrity
           signaling pathway [957 bp, 318 aa]
          Length = 318

 Score = 34.3 bits (77), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 17/45 (37%), Positives = 24/45 (53%), Gaps = 3/45 (6%)

Query: 88  GTVFIVIGAIMGFIFVVFTVIWLLLGIRAWYCARKEYKLQALENK 132
           GTVFIV+G I G IF+   + W+   I  +   R    +Q  E+K
Sbjct: 75  GTVFIVVGGIAGVIFLAILLWWV---ITTYSSHRLTRSVQDYESK 116

>AFR524W [3716] [Homologous to ScYOR298W - SH]
           complement(1378378..1379757) [1380 bp, 459 aa]
          Length = 459

 Score = 30.8 bits (68), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 24/51 (47%)

Query: 33  PSGKETTILVNVVQANVLPTLSLMTSSKSTAFATFMPTIPVTGDNKNIYTT 83
           P G+  ++LV +++  +LP L  M      AF   M    + GDN  I  T
Sbjct: 82  PLGRRLSLLVKLLKTELLPFLDEMVRLTEYAFHVKMINDTICGDNVKIIVT 132

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.317    0.132    0.379 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 8,141,996
Number of extensions: 297827
Number of successful extensions: 817
Number of sequences better than 10.0: 19
Number of HSP's gapped: 804
Number of HSP's successfully gapped: 21
Length of query: 307
Length of database: 16,596,109
Length adjustment: 101
Effective length of query: 206
Effective length of database: 13,099,691
Effective search space: 2698536346
Effective search space used: 2698536346
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 61 (28.1 bits)