Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Sklu_2419.236736719320.0
KLLA0C05984g36436416880.0
Kwal_56.2250236436316710.0
YOL010W (RCL1)36736616440.0
CAGL0E02343g36436316360.0
ACL015W36236216000.0
Scas_644.936436315920.0
KLLA0F01507g472105701.1
Kwal_56.2320127995653.3
KLLA0F21032g29781629.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Sklu_2419.2
         (367 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Sklu_2419.2 YOL010W, Contig c2419 2010-3113                           748   0.0  
KLLA0C05984g 528906..530000 highly similar to sp|Q08096 Saccharo...   654   0.0  
Kwal_56.22502                                                         648   0.0  
YOL010W (RCL1) [4806] chr15 (307938..309041) Protein required fo...   637   0.0  
CAGL0E02343g 225099..226193 highly similar to sp|Q08096 Saccharo...   634   0.0  
ACL015W [1034] [Homologous to ScYOL010W (RCL1) - SH] complement(...   620   0.0  
Scas_644.9                                                            617   0.0  
KLLA0F01507g 144356..145774 some similarities with sp|P47042 Sac...    32   1.1  
Kwal_56.23201                                                          30   3.3  
KLLA0F21032g 1964630..1965523 highly similar to sp|Q9P4C1 Kluyve...    28   9.9  

>Sklu_2419.2 YOL010W, Contig c2419 2010-3113
          Length = 367

 Score =  748 bits (1932), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 367/367 (100%), Positives = 367/367 (100%)

Query: 1   MSSANSSRYTVFQGARNFRLRIILATLSGKAIKLEKIRSDDLNPGLKDYEVSFLRLMEAV 60
           MSSANSSRYTVFQGARNFRLRIILATLSGKAIKLEKIRSDDLNPGLKDYEVSFLRLMEAV
Sbjct: 1   MSSANSSRYTVFQGARNFRLRIILATLSGKAIKLEKIRSDDLNPGLKDYEVSFLRLMEAV 60

Query: 61  TNGSAIEISYTGTTVIYKPGIIIGGSYTHTCPSSKPVGYFVEPMLYLAPFSKKKFSILFR 120
           TNGSAIEISYTGTTVIYKPGIIIGGSYTHTCPSSKPVGYFVEPMLYLAPFSKKKFSILFR
Sbjct: 61  TNGSAIEISYTGTTVIYKPGIIIGGSYTHTCPSSKPVGYFVEPMLYLAPFSKKKFSILFR 120

Query: 121 GITASHNDAGIEAIKWGMLPVMEKFGVRECALHTLKRGSPPLGGGEVHLVVDSLIAQPIT 180
           GITASHNDAGIEAIKWGMLPVMEKFGVRECALHTLKRGSPPLGGGEVHLVVDSLIAQPIT
Sbjct: 121 GITASHNDAGIEAIKWGMLPVMEKFGVRECALHTLKRGSPPLGGGEVHLVVDSLIAQPIT 180

Query: 181 MHALDTPLISSIRGVSYSTRVSPSMVNRMIDGAKAVLKNVGCEVNITADVWRGDNSGKSP 240
           MHALDTPLISSIRGVSYSTRVSPSMVNRMIDGAKAVLKNVGCEVNITADVWRGDNSGKSP
Sbjct: 181 MHALDTPLISSIRGVSYSTRVSPSMVNRMIDGAKAVLKNVGCEVNITADVWRGDNSGKSP 240

Query: 241 GWGITLVAENKKGWRYFSEAIGDAGDVPEDIGTKVAYQLLEEISKSGVVGRAQLPLAITY 300
           GWGITLVAENKKGWRYFSEAIGDAGDVPEDIGTKVAYQLLEEISKSGVVGRAQLPLAITY
Sbjct: 241 GWGITLVAENKKGWRYFSEAIGDAGDVPEDIGTKVAYQLLEEISKSGVVGRAQLPLAITY 300

Query: 301 MVIGKEDIGRLRIKKEQIDEKFIWLLRDIKQVFGTEVYLKPTDEIDSDDLIATIKGIGFT 360
           MVIGKEDIGRLRIKKEQIDEKFIWLLRDIKQVFGTEVYLKPTDEIDSDDLIATIKGIGFT
Sbjct: 301 MVIGKEDIGRLRIKKEQIDEKFIWLLRDIKQVFGTEVYLKPTDEIDSDDLIATIKGIGFT 360

Query: 361 NTSKKIA 367
           NTSKKIA
Sbjct: 361 NTSKKIA 367

>KLLA0C05984g 528906..530000 highly similar to sp|Q08096
           Saccharomyces cerevisiae YOL010w RCL1 singleton, start
           by similarity
          Length = 364

 Score =  654 bits (1688), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 309/364 (84%), Positives = 342/364 (93%), Gaps = 1/364 (0%)

Query: 4   ANSSRYTVFQGARNFRLRIILATLSGKAIKLEKIRSDDLNPGLKDYEVSFLRLMEAVTNG 63
           ++SSRY  F+G+RNFRLR+++ATLSGKAIK+EKIRSDDLNPGLKDYEVSFLRLMEAVTNG
Sbjct: 2   SSSSRYVTFEGSRNFRLRVVMATLSGKAIKIEKIRSDDLNPGLKDYEVSFLRLMEAVTNG 61

Query: 64  SAIEISYTGTTVIYKPGIIIGGSYTHTCPSSKPVGYFVEPMLYLAPFSKKKFSILFRGIT 123
           S+IEISYTGTTVI++PGII GGSYTH CP+SKPVGYF EPMLYLAPFSKKKFSILFRGIT
Sbjct: 62  SSIEISYTGTTVIFRPGIITGGSYTHQCPNSKPVGYFAEPMLYLAPFSKKKFSILFRGIT 121

Query: 124 ASHNDAGIEAIKWGMLPVMEKFGVRECALHTLKRGSPPLGGGEVHLVVDSLIAQPITMHA 183
           +SHNDAGI+AIKWG++P+MEKFGVRECALHTLKRGSPPLGGGEVHLVVDSLIAQPITMHA
Sbjct: 122 SSHNDAGIDAIKWGLMPIMEKFGVRECALHTLKRGSPPLGGGEVHLVVDSLIAQPITMHA 181

Query: 184 LDTPLISSIRGVSYSTRVSPSMVNRMIDGAKAVLKNVGCEVNITADVWRGDNSGKSPGWG 243
           LD  +ISSIRGVSYSTRVSPS+VNRMIDGAK VLK+  CEVNITADVWRG+NSGKSPGWG
Sbjct: 182 LDKTMISSIRGVSYSTRVSPSLVNRMIDGAKKVLKSASCEVNITADVWRGENSGKSPGWG 241

Query: 244 ITLVAENKKGWRYFSEAIGDAGDVPEDIGTKVAYQLLEEISKSGVVGRAQLPLAITYMVI 303
           +TLVAENK+GWR FSEAIGDAGDVPEDIG  VAY LLEEISKSGVVGR QLPL I YM+I
Sbjct: 242 LTLVAENKQGWRIFSEAIGDAGDVPEDIGASVAYHLLEEISKSGVVGRNQLPLTILYMII 301

Query: 304 GKEDIGRLRIKKEQIDEKFIWLLRDIKQVFGTEVYLKPTDEIDSDDLIATIKGIGFTNTS 363
           GKEDIGRLRI K+QIDE+F+WLLRDIK+VFGTE+ LKP D+ ++ DLIATIKGIGFTNT+
Sbjct: 302 GKEDIGRLRITKDQIDERFVWLLRDIKKVFGTEILLKPVDD-NTTDLIATIKGIGFTNTN 360

Query: 364 KKIA 367
           KKIA
Sbjct: 361 KKIA 364

>Kwal_56.22502
          Length = 364

 Score =  648 bits (1671), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 308/363 (84%), Positives = 336/363 (92%)

Query: 5   NSSRYTVFQGARNFRLRIILATLSGKAIKLEKIRSDDLNPGLKDYEVSFLRLMEAVTNGS 64
           +S R   FQG RNFRL I+LATLSGK IK+EKIRSDDLNPGL+D+EVSFLRLMEAVTNGS
Sbjct: 2   SSMRINSFQGVRNFRLLIVLATLSGKPIKIEKIRSDDLNPGLRDHEVSFLRLMEAVTNGS 61

Query: 65  AIEISYTGTTVIYKPGIIIGGSYTHTCPSSKPVGYFVEPMLYLAPFSKKKFSILFRGITA 124
            IEISYTGTTVIYKPGIIIGGSYTH CP  KPVGY+VEPMLYLAPFSKKKFSI+FRG+TA
Sbjct: 62  TIEISYTGTTVIYKPGIIIGGSYTHNCPPGKPVGYYVEPMLYLAPFSKKKFSIIFRGVTA 121

Query: 125 SHNDAGIEAIKWGMLPVMEKFGVRECALHTLKRGSPPLGGGEVHLVVDSLIAQPITMHAL 184
           SHNDAGIEAIKWG++PVMEKFGVRECALHTLKRG+PPLGGGEVHLVVDSLIAQPITMHAL
Sbjct: 122 SHNDAGIEAIKWGLMPVMEKFGVRECALHTLKRGAPPLGGGEVHLVVDSLIAQPITMHAL 181

Query: 185 DTPLISSIRGVSYSTRVSPSMVNRMIDGAKAVLKNVGCEVNITADVWRGDNSGKSPGWGI 244
           DTP I+SIRGV+YSTRVSPSMVNRMI+GA+ VLKNVGCEV+ITADVWRG+NSGKSPGWGI
Sbjct: 182 DTPQIASIRGVAYSTRVSPSMVNRMIEGARNVLKNVGCEVDITADVWRGENSGKSPGWGI 241

Query: 245 TLVAENKKGWRYFSEAIGDAGDVPEDIGTKVAYQLLEEISKSGVVGRAQLPLAITYMVIG 304
           TLVAE KKGW+YFSE IG AGDVPEDIG ++AY+LLEEIS S VVGR QL LAI YMVIG
Sbjct: 242 TLVAETKKGWKYFSEGIGGAGDVPEDIGAQIAYELLEEISTSAVVGRNQLALAIIYMVIG 301

Query: 305 KEDIGRLRIKKEQIDEKFIWLLRDIKQVFGTEVYLKPTDEIDSDDLIATIKGIGFTNTSK 364
           KEDIGRLRI K QIDEKFIWLLR IKQ+FGTEV+LKP D+ DSDDLIAT+KGIGF+NT+K
Sbjct: 302 KEDIGRLRITKAQIDEKFIWLLRHIKQIFGTEVFLKPVDDADSDDLIATVKGIGFSNTNK 361

Query: 365 KIA 367
           K+A
Sbjct: 362 KMA 364

>YOL010W (RCL1) [4806] chr15 (307938..309041) Protein required for
           pre-rRNA processing at cleavage sites A0, A1 and A2, has
           similarity to RNA 3'-terminal phosphate cyclase,
           interacts with Bms1p [1104 bp, 367 aa]
          Length = 367

 Score =  637 bits (1644), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 304/366 (83%), Positives = 339/366 (92%), Gaps = 1/366 (0%)

Query: 3   SANSSRYTVFQGARNFRLRIILATLSGKAIKLEKIRSDDLNPGLKDYEVSFLRLMEAVTN 62
           S+++ +YT FQG++NFRLRI+LATLSGK IK+EKIRS DLNPGLKDYEVSFLRL+E+VTN
Sbjct: 2   SSSAPKYTTFQGSQNFRLRIVLATLSGKPIKIEKIRSGDLNPGLKDYEVSFLRLIESVTN 61

Query: 63  GSAIEISYTGTTVIYKPGIIIGGSYTHTCPSSKPVGYFVEPMLYLAPFSKKKFSILFRGI 122
           GS IEISYTGTTVIY+PGII+GG+ TH CPSSKPVGYFVEPMLYLAPFSKKKFSILF+GI
Sbjct: 62  GSVIEISYTGTTVIYRPGIIVGGASTHICPSSKPVGYFVEPMLYLAPFSKKKFSILFKGI 121

Query: 123 TASHNDAGIEAIKWGMLPVMEKFGVRECALHTLKRGSPPLGGGEVHLVVDSLIAQPITMH 182
           TASHNDAGIEAIKWG++PVMEKFGVRECALHTLKRGSPPLGGGEVHLVVDSLIAQPITMH
Sbjct: 122 TASHNDAGIEAIKWGLMPVMEKFGVRECALHTLKRGSPPLGGGEVHLVVDSLIAQPITMH 181

Query: 183 ALDTPLISSIRGVSYSTRVSPSMVNRMIDGAKAVLKNVGCEVNITADVWRGDNSGKSPGW 242
            +D P+ISSI GV+YSTRVSPS+VNRMIDGAK VLKN+ CEVNITADVWRG+NSGKSPGW
Sbjct: 182 EIDRPIISSITGVAYSTRVSPSLVNRMIDGAKKVLKNLQCEVNITADVWRGENSGKSPGW 241

Query: 243 GITLVAENK-KGWRYFSEAIGDAGDVPEDIGTKVAYQLLEEISKSGVVGRAQLPLAITYM 301
           GITLVA++K KGW YF+E IGDAG +PE++G KVA QLLEEISKS  VGR QLPLAI YM
Sbjct: 242 GITLVAQSKQKGWSYFAEDIGDAGSIPEELGEKVACQLLEEISKSAAVGRNQLPLAIVYM 301

Query: 302 VIGKEDIGRLRIKKEQIDEKFIWLLRDIKQVFGTEVYLKPTDEIDSDDLIATIKGIGFTN 361
           VIGKEDIGRLRI KEQIDE+FI LLRDIK++F TEV+LKP DE D++D+IATIKGIGFTN
Sbjct: 302 VIGKEDIGRLRINKEQIDERFIILLRDIKKIFNTEVFLKPVDEADNEDMIATIKGIGFTN 361

Query: 362 TSKKIA 367
           TSKKIA
Sbjct: 362 TSKKIA 367

>CAGL0E02343g 225099..226193 highly similar to sp|Q08096
           Saccharomyces cerevisiae YOL010w RCL1, start by
           similarity
          Length = 364

 Score =  634 bits (1636), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 304/363 (83%), Positives = 334/363 (92%), Gaps = 1/363 (0%)

Query: 6   SSRYTVFQGARNFRLRIILATLSGKAIKLEKIRSDDLNPGLKDYEVSFLRLMEAVTNGSA 65
           SS+Y VFQG  NFR RII ATLSGK IK+EKIRS DLNPGL+D+EVSFLRLMEAVTNGS 
Sbjct: 2   SSQYVVFQGPENFRHRIIFATLSGKPIKIEKIRSQDLNPGLRDHEVSFLRLMEAVTNGSV 61

Query: 66  IEISYTGTTVIYKPGIIIGGSYTHTCPSSKPVGYFVEPMLYLAPFSKKKFSILFRGITAS 125
           IEISYTGTTVIY+PGIIIGG YTHTCP SKPVGYFVEPMLYLAPFSKKKFSI+F+GITAS
Sbjct: 62  IEISYTGTTVIYRPGIIIGGPYTHTCPPSKPVGYFVEPMLYLAPFSKKKFSIVFKGITAS 121

Query: 126 HNDAGIEAIKWGMLPVMEKFGVRECALHTLKRGSPPLGGGEVHLVVDSLIAQPITMHALD 185
           HNDAGIEAIKWG++PVMEKFGVRECALHTLKRGSPP GGGEVHLVVDSLIAQPITMH LD
Sbjct: 122 HNDAGIEAIKWGLMPVMEKFGVRECALHTLKRGSPPQGGGEVHLVVDSLIAQPITMHELD 181

Query: 186 TPLISSIRGVSYSTRVSPSMVNRMIDGAKAVLKNVGCEVNITADVWRGDNSGKSPGWGIT 245
            P+ISSIRGV+YSTRVSPSMVNRMIDGAK VLKNV CEVNITADVWRG+NSGKSPGWGIT
Sbjct: 182 RPVISSIRGVAYSTRVSPSMVNRMIDGAKQVLKNVKCEVNITADVWRGENSGKSPGWGIT 241

Query: 246 LVAEN-KKGWRYFSEAIGDAGDVPEDIGTKVAYQLLEEISKSGVVGRAQLPLAITYMVIG 304
           +VAE  KKGW YF+E IG +GD+PE+IG+KVAY+L+EEISKS  V R QLPLAITYMVIG
Sbjct: 242 IVAETKKKGWCYFAEEIGGSGDIPEEIGSKVAYKLIEEISKSAAVDRNQLPLAITYMVIG 301

Query: 305 KEDIGRLRIKKEQIDEKFIWLLRDIKQVFGTEVYLKPTDEIDSDDLIATIKGIGFTNTSK 364
           KEDIGRLRI +EQ+DE+FI +LRDIK++FGTEV+LKP D+I SDD IAT+KGIGFTNT+K
Sbjct: 302 KEDIGRLRITREQVDERFIQMLRDIKKIFGTEVFLKPVDDIGSDDFIATVKGIGFTNTNK 361

Query: 365 KIA 367
           KIA
Sbjct: 362 KIA 364

>ACL015W [1034] [Homologous to ScYOL010W (RCL1) - SH]
           complement(332683..333771) [1089 bp, 362 aa]
          Length = 362

 Score =  620 bits (1600), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 291/362 (80%), Positives = 330/362 (91%), Gaps = 1/362 (0%)

Query: 6   SSRYTVFQGARNFRLRIILATLSGKAIKLEKIRSDDLNPGLKDYEVSFLRLMEAVTNGSA 65
           SS+Y  F+GA NFR RI++ATLSGKA+K+EKIRS+D+NPGL+D+EVSFLRL+EAVTNGS 
Sbjct: 2   SSKYVTFRGATNFRHRIVMATLSGKAVKIEKIRSEDMNPGLRDHEVSFLRLIEAVTNGSV 61

Query: 66  IEISYTGTTVIYKPGIIIGGSYTHTCPSSKPVGYFVEPMLYLAPFSKKKFSILFRGITAS 125
           IEISYTGTTVIY+PGII+GGS+TH CP+ K VGY+VEP+LYLAPFSKKKFSI+ RG+T++
Sbjct: 62  IEISYTGTTVIYRPGIIVGGSHTHNCPNGKAVGYYVEPLLYLAPFSKKKFSIILRGVTST 121

Query: 126 HNDAGIEAIKWGMLPVMEKFGVRECALHTLKRGSPPLGGGEVHLVVDSLIAQPITMHALD 185
           H DAGIEAIKWG++PVMEKFGVRECALHTLKRG+PPLGGGEVHLVVDSLIAQPITMHAL+
Sbjct: 122 HQDAGIEAIKWGLMPVMEKFGVRECALHTLKRGAPPLGGGEVHLVVDSLIAQPITMHALE 181

Query: 186 TPLISSIRGVSYSTRVSPSMVNRMIDGAKAVLKNVGCEVNITADVWRGDNSGKSPGWGIT 245
            PLIS+IRGV+YSTRVSPSMVNRMIDGAK+VLK V CE NITADVWRG NSGKSPGWGIT
Sbjct: 182 RPLISAIRGVAYSTRVSPSMVNRMIDGAKSVLKQVPCEANITADVWRGANSGKSPGWGIT 241

Query: 246 LVAENKKGWRYFSEAIGDAGDVPEDIGTKVAYQLLEEISKSGVVGRAQLPLAITYMVIGK 305
           LVAE KKGWRYF+EAIGDAG+VPEDIG K AY LLEEIS+S VV R+QLPLAI YMVIGK
Sbjct: 242 LVAETKKGWRYFTEAIGDAGEVPEDIGNKAAYNLLEEISRSAVVCRSQLPLAIVYMVIGK 301

Query: 306 EDIGRLRIKKEQIDEKFIWLLRDIKQVFGTEVYLKPTDEIDSDDLIATIKGIGFTNTSKK 365
           EDIGRLRI + Q+DE  + LLRDIK++FGTE  LKP D+ D+DDLI TIKGIGFTNTSKK
Sbjct: 302 EDIGRLRIARAQVDESLVLLLRDIKELFGTEALLKPADD-DTDDLIVTIKGIGFTNTSKK 360

Query: 366 IA 367
           IA
Sbjct: 361 IA 362

>Scas_644.9
          Length = 364

 Score =  617 bits (1592), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 292/363 (80%), Positives = 330/363 (90%)

Query: 5   NSSRYTVFQGARNFRLRIILATLSGKAIKLEKIRSDDLNPGLKDYEVSFLRLMEAVTNGS 64
           +S  Y  FQG++NFRLRIIL+TLSGK+IK+EKIRS DLNPGLKDYEVSFLRLME+VTNGS
Sbjct: 2   SSKPYITFQGSQNFRLRIILSTLSGKSIKIEKIRSTDLNPGLKDYEVSFLRLMESVTNGS 61

Query: 65  AIEISYTGTTVIYKPGIIIGGSYTHTCPSSKPVGYFVEPMLYLAPFSKKKFSILFRGITA 124
            IEISYTGTT++Y+PGII GG++TH CP SKPVGYFVEPMLYLAPFSKKKFSI+F+GITA
Sbjct: 62  VIEISYTGTTILYRPGIISGGAHTHNCPPSKPVGYFVEPMLYLAPFSKKKFSIIFKGITA 121

Query: 125 SHNDAGIEAIKWGMLPVMEKFGVRECALHTLKRGSPPLGGGEVHLVVDSLIAQPITMHAL 184
           SH+DAGIEAIKWG+LP++EKFG RECALHTLKRGSPP GGGEVHLVVDSLIAQPITMH L
Sbjct: 122 SHSDAGIEAIKWGLLPILEKFGCRECALHTLKRGSPPNGGGEVHLVVDSLIAQPITMHEL 181

Query: 185 DTPLISSIRGVSYSTRVSPSMVNRMIDGAKAVLKNVGCEVNITADVWRGDNSGKSPGWGI 244
           + P I+++RGV+YSTRVSPSMVNRMID AK VL  + C V ITADVWRG+NSGKSPGWGI
Sbjct: 182 ERPTIATVRGVAYSTRVSPSMVNRMIDSAKKVLNKLSCPVEITADVWRGENSGKSPGWGI 241

Query: 245 TLVAENKKGWRYFSEAIGDAGDVPEDIGTKVAYQLLEEISKSGVVGRAQLPLAITYMVIG 304
           TLVA++KKGW YFSEAIGDAGDVPEDIG  VAY+LLEEIS S  VGR QL LAI YMVIG
Sbjct: 242 TLVAQSKKGWCYFSEAIGDAGDVPEDIGQLVAYRLLEEISMSAAVGRNQLALAIVYMVIG 301

Query: 305 KEDIGRLRIKKEQIDEKFIWLLRDIKQVFGTEVYLKPTDEIDSDDLIATIKGIGFTNTSK 364
           KEDIGRLRI K+QIDE FI+LLRDIK+VFGTEV+LKP D+++SDD+IATIKG+GFTNT+K
Sbjct: 302 KEDIGRLRITKDQIDENFIYLLRDIKKVFGTEVFLKPVDDLNSDDMIATIKGVGFTNTNK 361

Query: 365 KIA 367
           KIA
Sbjct: 362 KIA 364

>KLLA0F01507g 144356..145774 some similarities with sp|P47042
           Saccharomyces cerevisiae YJL057c IKS1 singleton,
           hypothetical start
          Length = 472

 Score = 31.6 bits (70), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 29/105 (27%), Positives = 46/105 (43%), Gaps = 16/105 (15%)

Query: 240 PGWGITLVAENKKGWRYFSEAIGDAG----------DVPEDIGTKVAYQLLEEISKSGVV 289
           PG G  +V  N+  + Y     G AG           +PEDI  +  YQ      + GV+
Sbjct: 14  PGEG-QIVVYNQAYFEYLQAEDGYAGFEDGARRRNSRIPEDIFVQGYYQRF--FKQVGVL 70

Query: 290 GRAQLPLA--ITYMVIGKEDIGRLRIKKEQIDEKFIWLLRDIKQV 332
           G     +   + +M++  E +G   +KK  I +   WL R +K+V
Sbjct: 71  GNGSRAVVYKVKHMLLENE-LGTFALKKICIGDDMHWLYRCLKEV 114

>Kwal_56.23201
          Length = 279

 Score = 29.6 bits (65), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 23/95 (24%), Positives = 44/95 (46%), Gaps = 7/95 (7%)

Query: 272 GTKVAYQLLEEISKSGVVGRAQLPLAITYMVIGKEDIGRLRIKKEQIDEKFIWLLRDIKQ 331
            ++V+ + L+E  +S  VGR +   A  Y+V G    G + +   Q+++ F+     +K 
Sbjct: 141 ASQVSLKTLDEFGRSVAVGRRKTSTAKVYLVRG---TGEILVNGRQLNDYFV----KMKD 193

Query: 332 VFGTEVYLKPTDEIDSDDLIATIKGIGFTNTSKKI 366
                  L+  D I   ++ AT  G G T  ++ +
Sbjct: 194 RESVAYPLRVVDSIGKYNVFATTSGGGITGQAEAL 228

>KLLA0F21032g 1964630..1965523 highly similar to sp|Q9P4C1
           Kluyveromyces marxianus 40S ribosomal protein S9,
           mitochondrial precursor, start by similarity
          Length = 297

 Score = 28.5 bits (62), Expect = 9.9,   Method: Compositional matrix adjust.
 Identities = 21/81 (25%), Positives = 41/81 (50%), Gaps = 7/81 (8%)

Query: 280 LEEISKSGVVGRAQLPLAITYMVIGKEDIGRLRIKKEQIDEKFIWLLRDIKQVFGTEVYL 339
           L+E  +S  +GR +   A  Y+V G+   G++ +   Q+++ F+  ++D + V      L
Sbjct: 167 LDEFGRSLAIGRRKTSTAKVYVVRGE---GKILVNDRQLNDYFVK-MKDRESVMYP---L 219

Query: 340 KPTDEIDSDDLIATIKGIGFT 360
           K  D +   ++ A + G G T
Sbjct: 220 KAIDSVGKYNVFAMVSGGGIT 240

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.318    0.137    0.399 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 11,678,659
Number of extensions: 501231
Number of successful extensions: 1115
Number of sequences better than 10.0: 12
Number of HSP's gapped: 1146
Number of HSP's successfully gapped: 12
Length of query: 367
Length of database: 16,596,109
Length adjustment: 103
Effective length of query: 264
Effective length of database: 13,030,455
Effective search space: 3440040120
Effective search space used: 3440040120
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 62 (28.5 bits)