Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Sklu_2411.949749725180.0
Kwal_26.821450249815120.0
Scas_709.5055250013500.0
YMR020W (FMS1)50850013460.0
ABR057W52049611311e-150
KLLA0E07744g53350211071e-146
CAGL0M07612g5815739751e-126
KLLA0F13090g36474701.5
AGR202W227277682.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Sklu_2411.9
         (497 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Sklu_2411.9 YMR020W, Contig c2411 17037-18530 reverse complement      974   0.0  
Kwal_26.8214                                                          587   0.0  
Scas_709.50                                                           524   0.0  
YMR020W (FMS1) [3984] chr13 (315376..316902) Protein involved in...   523   0.0  
ABR057W [648] [Homologous to ScYMR020W (FMS1) - SH] complement(5...   440   e-150
KLLA0E07744g complement(696382..697983) similar to sp|P50264 Sac...   431   e-146
CAGL0M07612g complement(760610..762355) similar to sp|P50264 Sac...   380   e-126
KLLA0F13090g 1209397..1210491 no similarity, hypothetical start        32   1.5  
AGR202W [4513] [Homologous to ScYPL085W (SEC16) - SH] complement...    31   2.9  

>Sklu_2411.9 YMR020W, Contig c2411 17037-18530 reverse complement
          Length = 497

 Score =  974 bits (2518), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 473/497 (95%), Positives = 473/497 (95%)

Query: 1   MAIEKSVVXXXXXXXXXXXXSDLYAKNCHSCVVLESRDRIGGRLHTVEGYDGRKYDLGAS 60
           MAIEKSVV            SDLYAKNCHSCVVLESRDRIGGRLHTVEGYDGRKYDLGAS
Sbjct: 1   MAIEKSVVIIGAGIAGLKAASDLYAKNCHSCVVLESRDRIGGRLHTVEGYDGRKYDLGAS 60

Query: 61  WHHDTLMNGXXXXXXXXXXXXRTPFVFDDDDLILFTENGKRLDHDPKLILEVLKEELDRF 120
           WHHDTLMNG            RTPFVFDDDDLILFTENGKRLDHDPKLILEVLKEELDRF
Sbjct: 61  WHHDTLMNGLFLEELQLPEQERTPFVFDDDDLILFTENGKRLDHDPKLILEVLKEELDRF 120

Query: 121 IELQFFESLDVKDISYFQIILKYLYQRRDFLSDEQLKHLPQLARYLELWHGIDWKTLSGK 180
           IELQFFESLDVKDISYFQIILKYLYQRRDFLSDEQLKHLPQLARYLELWHGIDWKTLSGK
Sbjct: 121 IELQFFESLDVKDISYFQIILKYLYQRRDFLSDEQLKHLPQLARYLELWHGIDWKTLSGK 180

Query: 181 YAHIDHQGRNAMVLHYSSIVKRVASSFPKEWLKLSTEVCEVRREGKKVCVKTFEETYVCD 240
           YAHIDHQGRNAMVLHYSSIVKRVASSFPKEWLKLSTEVCEVRREGKKVCVKTFEETYVCD
Sbjct: 181 YAHIDHQGRNAMVLHYSSIVKRVASSFPKEWLKLSTEVCEVRREGKKVCVKTFEETYVCD 240

Query: 241 YVVVTVPQSILELSLHKEARTGRIEFCPPLNKDIVESFGKVHYGTLGKVVFEFDKCCWST 300
           YVVVTVPQSILELSLHKEARTGRIEFCPPLNKDIVESFGKVHYGTLGKVVFEFDKCCWST
Sbjct: 241 YVVVTVPQSILELSLHKEARTGRIEFCPPLNKDIVESFGKVHYGTLGKVVFEFDKCCWST 300

Query: 301 ERAKILSMGKTPEGFARKVRNATDFCALVKELDKDTSYELGNDPWDFPLYFVNLAKTTGV 360
           ERAKILSMGKTPEGFARKVRNATDFCALVKELDKDTSYELGNDPWDFPLYFVNLAKTTGV
Sbjct: 301 ERAKILSMGKTPEGFARKVRNATDFCALVKELDKDTSYELGNDPWDFPLYFVNLAKTTGV 360

Query: 361 PSFVMLMQEPLTGYVESLEDKRHVYEYFKPILESLFKVLGSDAPICDFEKGIDDARENVP 420
           PSFVMLMQEPLTGYVESLEDKRHVYEYFKPILESLFKVLGSDAPICDFEKGIDDARENVP
Sbjct: 361 PSFVMLMQEPLTGYVESLEDKRHVYEYFKPILESLFKVLGSDAPICDFEKGIDDARENVP 420

Query: 421 ILKNVFTTNWTREPYSLGAYSACFPNDDPMDFILALEKGQDSHIRFAGEHTVMDGAGCVY 480
           ILKNVFTTNWTREPYSLGAYSACFPNDDPMDFILALEKGQDSHIRFAGEHTVMDGAGCVY
Sbjct: 421 ILKNVFTTNWTREPYSLGAYSACFPNDDPMDFILALEKGQDSHIRFAGEHTVMDGAGCVY 480

Query: 481 GAWESGKREASYISKRL 497
           GAWESGKREASYISKRL
Sbjct: 481 GAWESGKREASYISKRL 497

>Kwal_26.8214
          Length = 502

 Score =  587 bits (1512), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 279/498 (56%), Positives = 359/498 (72%), Gaps = 3/498 (0%)

Query: 3   IEKSVVXXXXXXXXXXXXSDLYAKNCHSCVVLESRDRIGGRLHTVEGYDGRKYDLGASWH 62
           IEK VV            S L+ K C SC+V+E+RDRIGGRLHTV GY GRKYD+GASWH
Sbjct: 2   IEKKVVIIGAGISGLKAASVLHEKGCDSCIVIEARDRIGGRLHTVSGYKGRKYDVGASWH 61

Query: 63  HDTLMNGXXXXXXXXXXXXRTPFVFDDDDLILFTENGKRLDHDPKLILEVLKEELDRFIE 122
           HDTL+NG            RTPFVFDDD +++F +   R+D+D ++ LE+L EEL ++ +
Sbjct: 62  HDTLVNGLFLEEMGLPREERTPFVFDDDSMLVFDKARGRVDYDSQMELEILVEELSKYTQ 121

Query: 123 LQFFESLDVKDISYFQIILKYLYQRRDFLSDEQLKHLPQLARYLELWHGIDWKTLSGKYA 182
           LQ+FE L+V+D++YFQ I+KYLY+RR+ L+D+Q+++LPQLAR++ELWHGIDWK+ S K  
Sbjct: 122 LQYFEDLEVEDVNYFQTIMKYLYERRELLTDDQIQYLPQLARFMELWHGIDWKSQSSKGL 181

Query: 183 HIDHQGRNAMVLHYSSIVKRVASSFPKEWLKLSTEVCEVRREGKKVCVKTFE-ETYVCDY 241
            I HQGRNA VL++ +I +RVAS+ P+EW +L TEV EV++EG+KV V T + ET  CDY
Sbjct: 182 EIAHQGRNAFVLNFGNIAQRVASTIPQEWFELETEVREVKKEGEKVLVSTSKGETISCDY 241

Query: 242 VVVTVPQSILELSLHKEARTGRIEFCPPLNKDIVESFGKVHYGTLGKVVFEFDKCCWSTE 301
           V+VT+PQSIL  SL  E R GRIEF PPL+ +I  S    H+G LGKVVFEF+ CCWS E
Sbjct: 242 VIVTIPQSILAHSLQPEPRKGRIEFIPPLSSEIKTSLEHAHFGGLGKVVFEFESCCWSKE 301

Query: 302 RAKILSMGKTPEGFARKVRNATDFCALVKELDKDTSYELGN-DPWDFPLYFVNLAKTTGV 360
           R++ L++GK       K+R A D   LV++LD D+ Y   N + WDFPL FVNLAK T +
Sbjct: 302 RSRALALGKPIVDLTSKIREAVDLSQLVEKLDLDSKYTYKNGESWDFPLLFVNLAKHTDI 361

Query: 361 PSFVMLMQEPLTGYVESLEDKRHVYEYFKPILESLFKVLGSDAPIC-DFEKGIDDARENV 419
           PSF+MLM  PLT Y+ES++DK  +YE+FKPIL+ L    G   PI  DF+  I    E  
Sbjct: 362 PSFIMLMPNPLTEYIESIKDKEKLYEFFKPILDQLLVTFGCFEPIIKDFDDEIVSEDEKK 421

Query: 420 PILKNVFTTNWTREPYSLGAYSACFPNDDPMDFILALEKGQDSHIRFAGEHTVMDGAGCV 479
           P+LKN+ TT+WT + Y+LGAYSAC+P DDPM+ +LAL   Q S IRFAGEHT+MDGAGCV
Sbjct: 422 PVLKNILTTSWTGDDYALGAYSACYPGDDPMNVVLALSNNQTSRIRFAGEHTIMDGAGCV 481

Query: 480 YGAWESGKREASYISKRL 497
           YGAWESGKREA +I  +L
Sbjct: 482 YGAWESGKREALFIEDKL 499

>Scas_709.50
          Length = 552

 Score =  524 bits (1350), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 251/500 (50%), Positives = 335/500 (67%), Gaps = 7/500 (1%)

Query: 4   EKSVVXXXXXXXXXXXXSDLYAKNCHSCVVLESRDRIGGRLHTVEGYDGRKYDLGASWHH 63
           E+ V+            S LYA    +C+V+E+RDRIGGRL TV+GY G KYDLGA WHH
Sbjct: 51  EQQVIIIGAGIAGLKAASTLYANGIKNCLVIEARDRIGGRLLTVKGYKGDKYDLGAGWHH 110

Query: 64  DTLMNGX-XXXXXXXXXXXRTPFVFDDDDLILFTENGKRLDHDPKLILEVLKEELDRFIE 122
           DTLMN              +  FVF+D   I   +   R+DHDP + LE +  E+D+F  
Sbjct: 111 DTLMNPLFLEEAEAMKKDSKKRFVFEDSQFIYIDDQRGRIDHDPDMSLEFVDAEIDKFTG 170

Query: 123 LQFFESLDVKDISYFQIILKYLYQRRDFLSDEQLKHLPQLARYLELWHGIDWKTLSGKYA 182
           L+F++SLDVKD S++ IILKYL QRRDFL+D+Q+K   Q+ARYLELWHG  W  LS K  
Sbjct: 171 LEFYQSLDVKDCSFYHIILKYLLQRRDFLTDDQIKFSAQIARYLELWHGASWDKLSAKDT 230

Query: 183 HIDHQGRNAMVLHYSSIVKRVASSFPKEWLKLSTEVCEVRREGKKVCVK-TFEETYVCDY 241
           + DHQGRNA+V ++ S+V R+  +FPK+W++L+TEV  + R+GK V +K +  E Y+C Y
Sbjct: 231 YFDHQGRNALVTNFDSVVNRIGDTFPKDWIRLNTEVKAIERDGKNVLIKLSSGEEYICQY 290

Query: 242 VVVTVPQSILELSLH--KEART-GRIEFCPPLNKDIVESFGKVHYGTLGKVVFEFDKCCW 298
            +VT+PQS+L+LSL    E+ T GRI+F PPLN  I E+F K+H+G LGKVVFEFDKC W
Sbjct: 291 TIVTIPQSVLQLSLQLPDESNTKGRIDFKPPLNPQIQEAFKKIHFGGLGKVVFEFDKCTW 350

Query: 299 STERAKILSMGKTPEGFARKVRNATDFCALVKELDKDTSYELGNDPWDFPLYFVNLAKTT 358
           S E ++I ++  + E F   VR A  +  L+  L K  S +L  + WDFPL F+NLAK+ 
Sbjct: 351 SNESSRIFTLAHSQENFVEDVRKAETWEGLIDNL-KTPSSQLFENCWDFPLLFINLAKSI 409

Query: 359 GVPSFVMLMQEPLTGYVESL-EDKRHVYEYFKPILESLFKVLGSDAPICDFEKGIDDARE 417
           G P+ +MLMQ PL+ Y+ES+  DK+ VYE+F+P+L+ +   L S+  I        +A  
Sbjct: 410 GRPTLIMLMQSPLSNYIESIGNDKQKVYEFFQPVLDKVMTTLQSNKVINGLSANPTEAET 469

Query: 418 NVPILKNVFTTNWTREPYSLGAYSACFPNDDPMDFILALEKGQDSHIRFAGEHTVMDGAG 477
           N PILKN+  TNW  +PYS GAYSACF  DD ++ I+A+  GQDS IRFAGEHT+MDGAG
Sbjct: 470 NSPILKNLLVTNWNNDPYSRGAYSACFAGDDALEMIIAMSNGQDSRIRFAGEHTIMDGAG 529

Query: 478 CVYGAWESGKREASYISKRL 497
            V+G+WESG+RE  YI + L
Sbjct: 530 AVHGSWESGRREGEYILEHL 549

>YMR020W (FMS1) [3984] chr13 (315376..316902) Protein involved in
           the biosynthesis of pantothenic acid, has similarity to
           Candida albicans corticosteroid-binding protein CBP1
           [1527 bp, 508 aa]
          Length = 508

 Score =  523 bits (1346), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 253/500 (50%), Positives = 336/500 (67%), Gaps = 6/500 (1%)

Query: 4   EKSVVXXXXXXXXXXXXSDLYAKNCHSCVVLESRDRIGGRLHTVEGYDGRKYDLGASWHH 63
           +K V+            S L+      C+VLE+RDR+GGRL TV GY GRKYD+GASWHH
Sbjct: 8   KKKVIIIGAGIAGLKAASTLHQNGIQDCLVLEARDRVGGRLQTVTGYQGRKYDIGASWHH 67

Query: 64  DTLMNGX-XXXXXXXXXXXRTPFVFDDDDLILFTENGKRLDHDPKLILEVLKEELDRFIE 122
           DTL N              RT FVFDDD+ I   E   R+DHD +L+LE++  E+ +F E
Sbjct: 68  DTLTNPLFLEEAQLSLNDGRTRFVFDDDNFIYIDEERGRVDHDKELLLEIVDNEMSKFAE 127

Query: 123 LQFFESLDVKDISYFQIILKYLYQRRDFLSDEQLKHLPQLARYLELWHGIDWKTLSGKYA 182
           L+F + L V D S+FQ+++KYL QRR FL+++Q+++LPQL RYLELWHG+DWK LS K  
Sbjct: 128 LEFHQHLGVSDCSFFQLVMKYLLQRRQFLTNDQIRYLPQLCRYLELWHGLDWKLLSAKDT 187

Query: 183 HIDHQGRNAMVLHYSSIVKRVASSFPKEWLKLSTEVCEVRRE-GKKVCVKTFEET-YVCD 240
           +  HQGRNA  L+Y S+V+R+A SFP+ WLKLS EV  + RE  K V V   + T Y  D
Sbjct: 188 YFGHQGRNAFALNYDSVVQRIAQSFPQNWLKLSCEVKSITREPSKNVTVNCEDGTVYNAD 247

Query: 241 YVVVTVPQSILELSLHKEAR-TGRIEFCPPLNKDIVESFGKVHYGTLGKVVFEFDKCCWS 299
           YV++TVPQS+L LS+  E    GRIEF PPL   I ++F K+H+G LGKV+FEF++CCWS
Sbjct: 248 YVIITVPQSVLNLSVQPEKNLRGRIEFQPPLKPVIQDAFDKIHFGALGKVIFEFEECCWS 307

Query: 300 TERAKILSMGKTPEGFARKVRNATDFCALVKELDK-DTSYELGNDPWDFPLYFVNLAKTT 358
            E +KI+++  +   F   VRNA +   L   L++ D+        W  PL+FVNL+K+T
Sbjct: 308 NESSKIVTLANSTNEFVEIVRNAENLDELDSMLEREDSQKHTSVTCWSQPLFFVNLSKST 367

Query: 359 GVPSFVMLMQEPLTGYVESL-EDKRHVYEYFKPILESLFKVLGSDAPICDFEKGIDDARE 417
           GV SF+MLMQ PLT ++ES+ EDK  ++ +F+P+L  + K L S+  I       + A  
Sbjct: 368 GVASFMMLMQAPLTNHIESIREDKERLFSFFQPVLNKIMKCLDSEDVIDGMRPIENIANA 427

Query: 418 NVPILKNVFTTNWTREPYSLGAYSACFPNDDPMDFILALEKGQDSHIRFAGEHTVMDGAG 477
           N P+L+N+  +NWTR+PYS GAYSACFP DDP+D ++A+  GQDS IRFAGEHT+MDGAG
Sbjct: 428 NKPVLRNIIVSNWTRDPYSRGAYSACFPGDDPVDMVVAMSNGQDSRIRFAGEHTIMDGAG 487

Query: 478 CVYGAWESGKREASYISKRL 497
           C YGAWESG+REA+ IS  L
Sbjct: 488 CAYGAWESGRREATRISDLL 507

>ABR057W [648] [Homologous to ScYMR020W (FMS1) - SH]
           complement(500154..501716) [1563 bp, 520 aa]
          Length = 520

 Score =  440 bits (1131), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 215/496 (43%), Positives = 305/496 (61%), Gaps = 8/496 (1%)

Query: 4   EKSVVXXXXXXXXXXXXSDLYAKNCHSCVVLESRDRIGGRLHTVEG--YDGRKYDLGASW 61
           E +VV            ++L++     CVVLE+R R GGRL  VE   + GR+YDLGASW
Sbjct: 9   EYTVVVVGAGIAGLKAAAELHSAGIEKCVVLEARARTGGRLLQVESSVFPGRRYDLGASW 68

Query: 62  HHDTLMNGXXXXXXXXXXXXRTPFVFDDDDLILFTENGKRLDHDPKLILEVLKEELDRFI 121
           HHDTL N             R  +VFDD   ++ +  G+RLD D  L+LE L+ E++ +I
Sbjct: 69  HHDTLSNELFAEELRLPEAERAGYVFDDVPTMVVSPAGRRLDGDFGLMLEALQREVEHYI 128

Query: 122 ELQFFESLDVKDISYFQIILKYLYQRRDFLSDEQLKHLPQLARYLELWHGIDWKTLSGKY 181
           E Q+FESL+ +D+ +F++++ YLY+RR  L+D+Q++ LP   R+ E WH IDWK LS K 
Sbjct: 129 EEQYFESLEARDMPFFELVMAYLYERRGVLTDDQIQQLPGTVRFREFWHAIDWKLLSAKL 188

Query: 182 AHIDHQGRNAMVLHYSSIVKRVASSFPKEWLKLSTEVCEVRREGKKVCVKTFEET-YVCD 240
           + +++ GRNA VL+Y  +++RV S  P+EW++L T V ++ R    V + T +   YV  
Sbjct: 189 SEVENNGRNAFVLNYDKLLRRVESGVPREWIRLGTRVTKIERVRDTVHITTADGACYVSK 248

Query: 241 YVVVTVPQSILELSLHKEARTGRIEFCPPLNKDIVESFGKVHYGTLGKVVFEFDKCCWST 300
             +VTVPQS+LELSL  E   GRIEF PPLN +I  +F + HY +LGK+ FEFDKC W T
Sbjct: 249 CAIVTVPQSVLELSLKPERVPGRIEFRPPLNDNITSAFERAHYASLGKIFFEFDKCTWDT 308

Query: 301 ERAKILSMGKTPEGFARKVRNATDFCALVKELDKDTSYELGNDPWDFPLYFVNLAKTTGV 360
           +R ++    K P+ F+ +VR A D   L++     T  +LG D +DFP  F N+    G+
Sbjct: 309 QRPRVAIAAKVPDDFSAQVRKAQDLQELLRSASAQTEVKLGQDCFDFPQEFQNMVALAGI 368

Query: 361 PSFVMLMQEPLTGYVESLEDKRHVYEYFKPILESLFKVLGSDAPICDFEKGIDDARENV- 419
           P+ +   Q PLT +VE L  K+ + +YFKP +    + LGS    C F+ G    +++  
Sbjct: 369 PTLIAFTQTPLTEHVERL-SKQEIVDYFKPAIVVALRALGSKEE-CLFDLGNTQPQDDSH 426

Query: 420 --PILKNVFTTNWTREPYSLGAYSACFPNDDPMDFILALEKGQDSHIRFAGEHTVMDGAG 477
             PILKNV    W+++ YS G+Y+    +DD +   +AL  GQDS IRFAGEHTVM+G G
Sbjct: 427 PGPILKNVIFNPWSQDTYSRGSYTGSHVDDDQLPLTVALNNGQDSRIRFAGEHTVMEGNG 486

Query: 478 CVYGAWESGKREASYI 493
           C YGAWESG+REA Y+
Sbjct: 487 CTYGAWESGRREAEYV 502

>KLLA0E07744g complement(696382..697983) similar to sp|P50264
           Saccharomyces cerevisiae YMR020w FMS1 suppressor of
           fenpropimorph resistance mutation FEN2 singleton, start
           by similarity
          Length = 533

 Score =  431 bits (1107), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 229/502 (45%), Positives = 322/502 (64%), Gaps = 21/502 (4%)

Query: 6   SVVXXXXXXXXXXXXSDLYAKNCHSCVVLESRDRIGGRLHTVEGYDGRKYDLGASWHHDT 65
           SV+            SDL      S + +ESRDR+GGRL+T +G +G KYD+G SWHHDT
Sbjct: 37  SVIVIGAGISGLKATSDLVKSGIESVICIESRDRVGGRLNTRQGRNG-KYDIGGSWHHDT 95

Query: 66  LMNGXXXXXXXXXXXXRTPFVFDDDDLILFTENGKRLDHDPKLILEVLKEELDRFIELQF 125
           L NG            R  FVFDD+D     +  K+L       LE L  E ++++E+++
Sbjct: 96  LSNGLFMEEMSLPESERAGFVFDDEDRACLVD--KKLGVLEVDQLECLAYEFEKWVEMRY 153

Query: 126 FESLDVKDISYFQIILKYLYQRRDFLSDEQLKHLPQLARYLELWHGIDWKTLSGKYAHID 185
           ++SLDV+D+SYFQ+ +++ + R++FL+DEQL HLPQL RY+ELWHG+DW  LSGK++ I+
Sbjct: 154 YDSLDVEDVSYFQLCIEFCFSRKEFLTDEQLYHLPQLLRYMELWHGVDWYALSGKWSGIE 213

Query: 186 HQGRNAMVLHYSSIVKRVASSFPKEWLKLSTEVCEVRR-EGKKVCVKTFEETYVCDYVVV 244
           H GRNA+VLHY  I+ R+++   K+ + LS  V  +++    K  V T +  Y+CDY +V
Sbjct: 214 HNGRNALVLHYDKILARISNPV-KDKIHLSESVNLIKKLSNGKYQVNTDKGKYLCDYCIV 272

Query: 245 TVPQSILELSLHKE------ARTGRIEFCPPLNKDIVESF-GKVHYGTLGKVVFEFDKCC 297
           TVPQS+L +S  +E       R  RI F PPLN DI E+   K  +G+LGKV+FEFD   
Sbjct: 273 TVPQSVLAISCEQEENEFSHMRKARIGFEPPLNGDIFEAITTKASFGSLGKVIFEFDSIK 332

Query: 298 WSTERAKILSMGKTPEGFARKVRNATDFCALVKELDKDT--SYELGNDPWDFPLYFVNLA 355
           WS    +IL++ + P  F   +R+A D   L+K++++    S+E   D W  P  F+NLA
Sbjct: 333 WSKTSGRILTVHEQPTDFVESIRSAKDLKTLLKDIEQKLPRSHE---DSWKNPTCFLNLA 389

Query: 356 KTTGVPSFVMLMQEPLTGYVESLEDKRHVYEYFKPILESLFKVLGSDAPICDFEKGIDDA 415
           K T   SFV L+Q+P+T Y+E+L     V E+F+P+L  L   LGS   I D    + ++
Sbjct: 390 KHTDTASFVALIQQPVTEYIETLT-TEEVEEFFRPVLNKLLNSLGSSDYISDLNDEVKES 448

Query: 416 RENVPILKNVFTTNWTREPYSLGAYSACFPNDDPMDFILALEKGQDSHIRFAGEHTVMDG 475
           +   PILKN+ T+NW+ +P+SLGAYSAC P DDPMD ++AL  GQ  ++RFAGEHT+MDG
Sbjct: 449 K--TPILKNILTSNWSSDPFSLGAYSACQPGDDPMDLVIALNVGQ-GNLRFAGEHTIMDG 505

Query: 476 AGCVYGAWESGKREASYISKRL 497
           AGC YGAWESGKREA+YI ++L
Sbjct: 506 AGCAYGAWESGKREANYIIEKL 527

>CAGL0M07612g complement(760610..762355) similar to sp|P50264
           Saccharomyces cerevisiae YMR020w FMS1 suppressor of
           fenpropimorph resistance mutation FEN2, hypothetical
           start
          Length = 581

 Score =  380 bits (975), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 218/573 (38%), Positives = 298/573 (52%), Gaps = 108/573 (18%)

Query: 21  SDLYAKNCHSCVVLESRDRIGGRLHTVEGYDGRKYDLGASWHHDTLMN------------ 68
           + +  ++  SC+V+ESRDRIGGRL TV GY+G +YDLGASWHHDTL N            
Sbjct: 20  ASVLTQSGKSCLVIESRDRIGGRLCTVTGYNGARYDLGASWHHDTLTNRLFAEEVQLAAV 79

Query: 69  ------------------------GXXXXXXXXXXXXRTPFVFDDDD-LILFTENGKRLD 103
                                                  PFVFDDDD LI+    G   D
Sbjct: 80  DGADSTPQMFSGGATHCSASSASSASSASTGGNSAGVYAPFVFDDDDPLIVDKIRGSLGD 139

Query: 104 HDPKLILEVLKEELDRFIELQFF-----------------ESLDVKDISYFQIILKYLYQ 146
               + + ++ +E+++FIEL F                  E     D+  F ++L YL Q
Sbjct: 140 ----VTIRLIADEIEKFIELYFHSEYTAELSDDNDSQHSHEGFPRADMPLFDMLLMYLQQ 195

Query: 147 RRDFLSDEQLKHLPQLARYLELWHGIDWKTLSGKYAHIDHQGRNAMVLHYSSIVKRVASS 206
           R  FL+D+Q+ +  Q ARY+ELWHG+ W  LS + +   HQGRNA V++Y +I  R+   
Sbjct: 196 RAPFLTDDQMWYGIQYARYMELWHGVSWYQLSSRDSFFGHQGRNAFVMNYDTIYNRIHGQ 255

Query: 207 FPKEW--LKLSTEVCEVRREGKKVCVKTF--------------------EETYVCDYVVV 244
              E   ++L++ V ++   G    V                       + T  C YV+V
Sbjct: 256 IRTELGTVQLNSTVTKIENAGAHTTVSYTTSSASGAEDTQHGQHGAAGQQHTVQCSYVIV 315

Query: 245 TVPQSILELSLHKEARTGRIEFCPPLNKDIVESFGKVHYGTLGKVVFEFDKCCWSTERAK 304
           T+PQS+L          G +EF PPL   I  +  K+H+G+LGKVVFEF++CCW    AK
Sbjct: 316 TIPQSLLS--------EGAVEFKPPLVPQISAALQKMHFGSLGKVVFEFEECCWDLHTAK 367

Query: 305 ILSMGKTPE-------GFARKVRNATDFCAL-VKELDKDTSYELGNDP-----WDFPLYF 351
           I+++               RK     ++ A  ++ L +D    LG+D      W+ PL F
Sbjct: 368 IVAVAHAAADTRAEFTALLRKESREKNYTAQRLQALVQDVKQLLGDDAVRHDCWNQPLLF 427

Query: 352 VNLAKTTGVPSFVMLMQEPLTGYVESLEDKRHVYEYFKPILESLFKVLGSDAPIC---DF 408
           VN+AKTTGVPS +MLM  PLT Y+ESL D   VYE+FKP+L  +  V  +   I    D 
Sbjct: 428 VNMAKTTGVPSLMMLMAPPLTHYIESLHDSHQVYEFFKPVLSQIMSVCNAPGHIINGLDI 487

Query: 409 EKGIDDARENV----PILKNVFTTNWTREPYSLGAYSACFPNDDPMDFILALEKGQDSHI 464
             G+     NV    PIL+NV  T+WT +PYS GAYSAC+  DD +D  LA+  GQ S +
Sbjct: 488 AGGVAGDDANVSDKGPILRNVIVTDWTNDPYSKGAYSACYAGDDALDMFLAMSNGQSSRV 547

Query: 465 RFAGEHTVMDGAGCVYGAWESGKREASYISKRL 497
           RFAGEHT++DGAGC YGAWESG+REA+YI K++
Sbjct: 548 RFAGEHTILDGAGCAYGAWESGEREANYILKQM 580

>KLLA0F13090g 1209397..1210491 no similarity, hypothetical start
          Length = 364

 Score = 31.6 bits (70), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 24/74 (32%), Positives = 34/74 (45%), Gaps = 4/74 (5%)

Query: 376 ESLEDKRHVYEYFKPILESLFKVLGSDAPICDFEKGIDDARENVPILKNVFTTNWTREPY 435
           + +++K    EYFK   E    +   D  + D+E    D +  V I + VF+T   R  Y
Sbjct: 153 QDIQNKHMTAEYFKICAEIYEFIALLDGKVLDYEHA-HDVKTTVIIPQTVFSTYMIRH-Y 210

Query: 436 SLGAYSACFPNDDP 449
            L A    FP DDP
Sbjct: 211 MLAA--VHFPFDDP 222

>AGR202W [4513] [Homologous to ScYPL085W (SEC16) - SH]
           complement(1132110..1138928) [6819 bp, 2272 aa]
          Length = 2272

 Score = 30.8 bits (68), Expect = 2.9,   Method: Composition-based stats.
 Identities = 22/77 (28%), Positives = 31/77 (40%), Gaps = 9/77 (11%)

Query: 418 NVPILKNVFTTNWTREPYSLGAYSACFPNDDPMDFILALEKGQDSHIRFAGE-------- 469
           NVP+     +T  T E Y+  + S     DD  DF+  L  G D   + A +        
Sbjct: 386 NVPVESQAHSTTHTPEEYAADSNSLFALEDDGGDFLAELSNGHDVSSQSAADMLPIDDNV 445

Query: 470 -HTVMDGAGCVYGAWES 485
             T  DGA  + G  E+
Sbjct: 446 PRTTFDGADALAGPAET 462

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.321    0.139    0.430 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 16,644,637
Number of extensions: 751183
Number of successful extensions: 1713
Number of sequences better than 10.0: 11
Number of HSP's gapped: 1727
Number of HSP's successfully gapped: 12
Length of query: 497
Length of database: 16,596,109
Length adjustment: 106
Effective length of query: 391
Effective length of database: 12,926,601
Effective search space: 5054300991
Effective search space used: 5054300991
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 64 (29.3 bits)