Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Sklu_2411.838238219130.0
ABR058C3503698711e-115
Kwal_26.82193914028551e-112
Scas_576.54074157207e-92
KLLA0E07733g4693976919e-87
CAGL0M07590g4564015498e-66
YMR021C (MAC1)4171985145e-61
Scas_668.16291401491e-10
CAGL0L09339g877401315e-08
Scas_710.11743661298e-08
YPR008W (HAA1)694401291e-07
AEL295C544401281e-07
KLLA0A03047g567401281e-07
YGL166W (CUP2)225401241e-07
Kwal_14.1543599401262e-07
CAGL0I04180g265391143e-06
YPR066W (UBA3)29989691.2
Scas_567.749396637.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Sklu_2411.8
         (382 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Sklu_2411.8 YMR021C, Contig c2411 15729-16877                         741   0.0  
ABR058C [649] [Homologous to ScYMR021C (MAC1) - SH] (501771..502...   340   e-115
Kwal_26.8219                                                          333   e-112
Scas_576.5                                                            281   7e-92
KLLA0E07733g 694992..696401 weakly similar to sp|P35192 Saccharo...   270   9e-87
CAGL0M07590g 758940..760310 weakly similar to sp|P35192 Saccharo...   216   8e-66
YMR021C (MAC1) [3985] chr13 complement(317164..318417) Transcrip...   202   5e-61
Scas_668.16                                                            62   1e-10
CAGL0L09339g 1012259..1014892 some similarities with sp|Q12753 S...    55   5e-08
Scas_710.11                                                            54   8e-08
YPR008W (HAA1) [5444] chr16 (573013..575097) Nuclear protein tha...    54   1e-07
AEL295C [2210] [Homologous to ScYPR008W (HAA1) - SH; ScYGL166W (...    54   1e-07
KLLA0A03047g 269553..271256 some similarities with sp|Q12753 Sac...    54   1e-07
YGL166W (CUP2) [1824] chr7 (191133..191810) Copper-dependent tra...    52   1e-07
Kwal_14.1543                                                           53   2e-07
CAGL0I04180g 367258..368055 sp|P41772 Candida glabrata metal-act...    49   3e-06
YPR066W (UBA3) [5494] chr16 (681208..682107) Rub1-activating enz...    31   1.2  
Scas_567.7                                                             29   7.9  

>Sklu_2411.8 YMR021C, Contig c2411 15729-16877
          Length = 382

 Score =  741 bits (1913), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 371/382 (97%), Positives = 371/382 (97%)

Query: 1   MIIFDGDKYSCVACIRGHRSSTCKHSDRMLVKVRTRGRPSPMDVRKVIMVDTDSQVEPPV 60
           MIIFDGDKYSCVACIRGHRSSTCKHSDRMLVKVRTRGRPSPMDVRKVIMVDTDSQVEPPV
Sbjct: 1   MIIFDGDKYSCVACIRGHRSSTCKHSDRMLVKVRTRGRPSPMDVRKVIMVDTDSQVEPPV 60

Query: 61  HTPEDSNPCCQRSNANSKSCNKMNKQPILFLRAMRTQKALLVDGMLKIMVEDNESVSIDS 120
           HTPEDSNPCCQRSNANSKSCNKMNKQPILFLRAMRTQKALLVDGMLKIMVEDNESVSIDS
Sbjct: 61  HTPEDSNPCCQRSNANSKSCNKMNKQPILFLRAMRTQKALLVDGMLKIMVEDNESVSIDS 120

Query: 121 KKKFKLVSEREYMLKHSNNRMPDCCSCKSXXXXXXXXXXXQRTASFQSVKTFHNGNDVLS 180
           KKKFKLVSEREYMLKHSNNRMPDCCSCKS           QRTASFQSVKTFHNGNDVLS
Sbjct: 121 KKKFKLVSEREYMLKHSNNRMPDCCSCKSEEAELPENELEQRTASFQSVKTFHNGNDVLS 180

Query: 181 TTATPPPPITDENQMVELLTHKGVYLSTQCSCEDDNCQCDNCLIHRKEEELNKYIRQSGI 240
           TTATPPPPITDENQMVELLTHKGVYLSTQCSCEDDNCQCDNCLIHRKEEELNKYIRQSGI
Sbjct: 181 TTATPPPPITDENQMVELLTHKGVYLSTQCSCEDDNCQCDNCLIHRKEEELNKYIRQSGI 240

Query: 241 PLTNLGNGRVTDDENGHGNGSIKTISCSTESVCRCPPQDCICPHCLDHPGEIISMSNLLL 300
           PLTNLGNGRVTDDENGHGNGSIKTISCSTESVCRCPPQDCICPHCLDHPGEIISMSNLLL
Sbjct: 241 PLTNLGNGRVTDDENGHGNGSIKTISCSTESVCRCPPQDCICPHCLDHPGEIISMSNLLL 300

Query: 301 HGVLNTQLKRKTIIKYRNKLIPSKYWWDFIKLQIPLMSRRQLESLDLLRWFDSIVEAYGS 360
           HGVLNTQLKRKTIIKYRNKLIPSKYWWDFIKLQIPLMSRRQLESLDLLRWFDSIVEAYGS
Sbjct: 301 HGVLNTQLKRKTIIKYRNKLIPSKYWWDFIKLQIPLMSRRQLESLDLLRWFDSIVEAYGS 360

Query: 361 FLLEDHGDDMINLHEIEMMLDL 382
           FLLEDHGDDMINLHEIEMMLDL
Sbjct: 361 FLLEDHGDDMINLHEIEMMLDL 382

>ABR058C [649] [Homologous to ScYMR021C (MAC1) - SH]
           (501771..502826) [1056 bp, 351 aa]
          Length = 350

 Score =  340 bits (871), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 186/369 (50%), Positives = 238/369 (64%), Gaps = 44/369 (11%)

Query: 1   MIIFDGDKYSCVACIRGHRSSTCKHSDRMLVKVRTRGRPSPMDVRKVIMVDTDSQVEPPV 60
           MIIFDG+KYSC ACIRGHRS+TCKHSDRMLVKVRTRGRPSPMD+RKVI+VD  SQV  P+
Sbjct: 1   MIIFDGEKYSCAACIRGHRSTTCKHSDRMLVKVRTRGRPSPMDIRKVILVDAGSQV--PM 58

Query: 61  HTPEDSNPCCQRSNANSKSCNKMNKQPILFLRAMRTQKALLVDGMLKIMVEDNESVSIDS 120
              ED+  CC       K+C KM++QPILFL+A++TQKALLVDG LKIM+ED  + S   
Sbjct: 59  ED-EDTEECCD----GGKTCGKMDRQPILFLKALKTQKALLVDGALKIMIEDRAN-SDGV 112

Query: 121 KKKFKLVSEREYMLKHSNN-RMPDCCSCKSXXXXXXXXXXXQRTASFQSVKTFHNGNDVL 179
            K+FK V+E+E++L++++  +  D C C                   Q  K    G    
Sbjct: 113 DKRFKFVTEKEFLLQNADMLKARDGCGC-------------------QRPKRARVG---C 150

Query: 180 STTATPPPPITDENQMVELLTHKGVYLSTQCSCEDDNCQCDNCLIHRKEEELNKYIRQSG 239
           ST A  P         VE  T+KGVYLSTQCSC+D  CQC NCLIHRKEEEL+++IRQSG
Sbjct: 151 STGAGSP-------HAVEPYTYKGVYLSTQCSCDDSACQCANCLIHRKEEELDQFIRQSG 203

Query: 240 IPLTNLGNGRVTDDENGHGNGSIKT------ISCSTESVCRCPPQDCICPHCLDHPGEII 293
           +PLT++        E G   G   +       + +  + C C P  C+C  C  H  E++
Sbjct: 204 VPLTSVDLEDRKPAEAGACCGDRASGLLGYDYAANERTSCACSPVSCMCKDCEIHAEEVV 263

Query: 294 SMSNLLLHGVLNTQLKRKTIIKYRNKLIPSKYWWDFIKLQIPLMSRRQLESLDLLRWFDS 353
           SM+ LLLHG+LNT LKRK  I+Y+ KLI SK+WWD + LQ  +    QLE+LDLL+WFD+
Sbjct: 264 SMNRLLLHGILNTPLKRKMSIQYKGKLINSKFWWDILYLQCAVAREPQLEALDLLQWFDN 323

Query: 354 IVEAYGSFL 362
           I+E +G+ L
Sbjct: 324 IIETHGAAL 332

>Kwal_26.8219
          Length = 391

 Score =  333 bits (855), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 180/402 (44%), Positives = 242/402 (60%), Gaps = 35/402 (8%)

Query: 1   MIIFDGDKYSCVACIRGHRSSTCKHSDRMLVKVRTRGRPSPMDVRKVIMVDTDSQVEPPV 60
           MIIFDG+KYSCV+CIRGHRSSTCKHS+RMLVKVRTRGRPS   VRKVI+VD  SQV    
Sbjct: 1   MIIFDGEKYSCVSCIRGHRSSTCKHSNRMLVKVRTRGRPSAQTVRKVILVDASSQVNSSP 60

Query: 61  HTPED-SNPCCQRSNANSKSCNKMNKQPILFLRAMRTQKALLVDGMLKIMVEDNESVSID 119
           HT ED        S++ S+SC KMNKQPILFLR M TQKALLVDG LKIM+ED +     
Sbjct: 61  HTEEDDQGQSPCCSSSASRSCTKMNKQPILFLRTMSTQKALLVDGALKIMIEDTDPAF-- 118

Query: 120 SKKKFKLVSEREYMLKH---------------SNNRMPDCCSCKSXXXXXXXXXXXQRTA 164
              K+K VSER+Y+L H               + N + +  S  +            +  
Sbjct: 119 -HGKYKFVSERDYLLNHLQIPLDDYSQETNGLAKNSVKEPSSLGNLLQSDTLLSNESQKH 177

Query: 165 SFQSVKTFHNGNDVLSTTATPPPPITD------ENQMVELLTHKGVYLSTQCSCEDDNCQ 218
            +  +K           T      I+          MVEL THKGVYLSTQCSC++ NC 
Sbjct: 178 EYPDIKFEEQNRPSFLPTGKHTEQISTLDSEAHNTSMVELFTHKGVYLSTQCSCDEGNCS 237

Query: 219 CDNCLIHRKEEELNKYIRQSGIPLTNLGNGRVTDDENGHGNGSIKTISCSTESVCRCPPQ 278
           C NCLIHRKEEEL  YI+QSG+PL+ +GNGR+T         +          VC+   +
Sbjct: 238 CVNCLIHRKEEELESYIQQSGVPLSTIGNGRITFPIEQSSKDAF---------VCKYSAE 288

Query: 279 DCICPHCLDHPGEIISMSNLLLHGVLNTQLKRKTIIKYRNKLIPSKYWWDFIKLQIPLMS 338
           +C    CL HP EI+S++++ ++G++N  +KRK++IK+++KLIPSK+WW  +K ++P M 
Sbjct: 289 ECPIQDCLLHPAEILSLNHIFIYGLINVPIKRKSVIKFKHKLIPSKFWWHLLKEELPNMP 348

Query: 339 RRQLESLDLLRWFDSIVEAYGSFLLEDHGDDMINLHEIEMML 380
             Q  S D+ +WF+ I+E + +  + +  D  +NLH++ MM+
Sbjct: 349 HEQSASFDIFQWFEHIIETFNA-EIPNESDGSVNLHDMSMMM 389

>Scas_576.5
          Length = 407

 Score =  281 bits (720), Expect = 7e-92,   Method: Compositional matrix adjust.
 Identities = 164/415 (39%), Positives = 235/415 (56%), Gaps = 53/415 (12%)

Query: 1   MIIFDGDKYSCVACIRGHRSSTCKHSDRMLVKVRTRGRPSPMDVRKVIMVDTDSQVEP-- 58
           MII+  +KY+C +CIRGHRSSTCKH++RMLVKVRTRGRPSP ++R VIMVD+ S+++   
Sbjct: 1   MIIYASEKYACASCIRGHRSSTCKHTNRMLVKVRTRGRPSPTEIRDVIMVDSSSRIDAKS 60

Query: 59  PVHTPEDSNPCCQRSNANSKSCNKMNKQPILFLRAMRTQKALLVDGMLKIMVEDN----- 113
             H+    +   +  ++NS S N M +QP+LF+R   ++KA L++G L+I+V+D+     
Sbjct: 61  SCHSSNHQSKLAEGDDSNSCSQN-MERQPVLFVRVKDSKKARLLNGKLQILVDDSADSNE 119

Query: 114 --ESVSIDSKKKFKLVSEREYMLKHSNNRM------------PDCCSCKSXXXXXXXXXX 159
              SVS       K + E EY+ + S +               + C C            
Sbjct: 120 KGSSVSSKDNGNSKFIPEVEYLKQLSGSSSGSGSNSLGSTPNSNTC-CHHHTTCASMAAA 178

Query: 160 XQRTASFQSVKTFHNGNDVLSTTATP-------------------PPPITDENQMVELLT 200
                S QS+ + ++ N   ST  T                       +  +  +V+L T
Sbjct: 179 ATANTSTQSLLSKNDNNMTTSTNMTEDNNLDIGKIEESLNSMEYFEQVLDSKTPLVDLFT 238

Query: 201 HKGVYLSTQCSCEDDNCQCDNCLIHRKEEELNKYIRQSGIPLTNLGNGRVTDDENGHGNG 260
           HKGVYLS+ CSCED NC C NCLIHR E+ELN YIRQSGIPLTN+G     ++       
Sbjct: 239 HKGVYLSSACSCEDGNCPCLNCLIHRNEDELNSYIRQSGIPLTNVGEAEYKNE------- 291

Query: 261 SIKTISCSTESVCRCPPQDCICPHCLDHPGEIISMSNLLLHGVLNTQLKRKTIIKYRNKL 320
               + C+T S C C   DC+C  C+ HP EIIS+  +LL+G+L+  L+RKT+IK++NKL
Sbjct: 292 ---LMECTT-SNCACTAVDCLCQDCIVHPTEIISIDKILLNGLLHMTLRRKTVIKFKNKL 347

Query: 321 IPSKYWWDFIKLQIPLMSRRQLESLDLLRWFDSIVEAYGSFLLEDHGDDMINLHE 375
           IPS+YWWDF+  +   +    LES+D++ WFDS++  Y   LL+    +  N H+
Sbjct: 348 IPSQYWWDFLIGKTVKLQEGDLESIDIIGWFDSLINKYPMELLDASDMESNNYHQ 402

>KLLA0E07733g 694992..696401 weakly similar to sp|P35192
           Saccharomyces cerevisiae YMR021c MAC1 metal binding
           activator singleton, start by similarity
          Length = 469

 Score =  270 bits (691), Expect = 9e-87,   Method: Compositional matrix adjust.
 Identities = 162/397 (40%), Positives = 239/397 (60%), Gaps = 34/397 (8%)

Query: 1   MIIFDGDKYSCVACIRGHRSSTCKHSDRMLVKVRTRGRPSPMDVRKVIMVDTDSQVEPPV 60
           MIIF+G+KYSCV+CIRGHRSS+CKHS+RMLVKVRTRGRPSP+D+RKVI+VD  S+VE   
Sbjct: 1   MIIFNGEKYSCVSCIRGHRSSSCKHSERMLVKVRTRGRPSPLDIRKVILVDRASRVEEVD 60

Query: 61  HTPEDSNPCCQRSNANSKSCNKMNKQPILFLRAMRTQKALLVDGMLKIMVEDNES----- 115
            + +D+      +   S+ C  MNKQP+LFLRA+ T+KALL++G LKIMV          
Sbjct: 61  GSGQDNG-----AGDESQLCCGMNKQPVLFLRAIATKKALLINGDLKIMVTSESGTPDYE 115

Query: 116 VSIDSKKKFKLVSEREYMLKHSNNRMPDCCSCKSXXXXXXXXXXXQRTASFQSVK----- 170
           V+       K V+E E++L H +   P C SC S             T + ++       
Sbjct: 116 VARKVSDDNKFVTEHEFLLNHVS--PPPCKSCNSTVKRENESHSLDATNTTENYAKRVKF 173

Query: 171 -----TFHNGNDVLST----TATPPPPITDENQMVELLTHKGVYLSTQCSCEDDNCQCDN 221
                T  + +++LS             T ++ +VEL T  G YLST     ++NCQC+N
Sbjct: 174 ERQDMTNLSNHELLSAGDNVQLNSVGNSTFQDSVVELFTQNGAYLST-TCSCNENCQCNN 232

Query: 222 CLIHRKEEELNKYIRQSGIPLTNLGNGRVTDDENGHGNGSIKTISCSTE-----SVCRCP 276
           CLIHR+E EL +Y+ +   P+ NLG+ ++   ++     S       T+     ++C C 
Sbjct: 233 CLIHREEAELERYLTELNQPMINLGSAQILTADSSQVEPSKDFFHGETDDQNMSTLCLCE 292

Query: 277 PQDCICPHCLDHPGEIISMSNLLLHGVLNTQLKRKTIIKYRNKLIPSKYWWDFIKLQIPL 336
           P  C C +C  HP E++++S LLL+GVLN + K+K +IKYRNK+I SKYWW ++ ++IP 
Sbjct: 293 PDFCTCFNCEAHPDEVVTLSELLLYGVLNYKWKKKMVIKYRNKVIHSKYWWHYLTVEIPS 352

Query: 337 MSRRQLESLDLLRWFDSIVEAYGSFLLEDHGDDMINL 373
           M+ +QL SLDL+ WFD+++ ++ + L E   +D+++ 
Sbjct: 353 MNEKQLRSLDLMEWFDNLISSHSAELPE--ANDLVHF 387

>CAGL0M07590g 758940..760310 weakly similar to sp|P35192
           Saccharomyces cerevisiae YMR021c metal binding
           activator, start by similarity
          Length = 456

 Score =  216 bits (549), Expect = 8e-66,   Method: Compositional matrix adjust.
 Identities = 144/401 (35%), Positives = 203/401 (50%), Gaps = 53/401 (13%)

Query: 1   MIIFDGDKYSCVACIRGHRSSTCKHSDRMLVKVRTRGRPSPMDVRKVIMV---------- 50
           MIIF  DKY+CV CIRGHRSS C H+ RMLVKVR RGR   +DVR  I+V          
Sbjct: 1   MIIFKNDKYACVKCIRGHRSSLCVHTGRMLVKVRNRGRKKGIDVRDAIVVGDIHRKRSCE 60

Query: 51  -------DTDSQVEPPVHTPEDSNPCCQRSNANSKSCNKMNKQPILFLRAMRTQKALLVD 103
                  D   Q   P    + S P    S  NS +C  MNKQPILF+RA +  KA L+ 
Sbjct: 61  CASGHAGDDSKQYGAP--NADVSRP--HESGLNS-TCVGMNKQPILFVRAKKVLKAQLIG 115

Query: 104 G-----------MLKIMVEDNESVSIDSK-KKFKLVSEREYMLKHSN--NRMPDCCSCKS 149
           G            L++   D+E+V+  +   K +++      +   N  + M      K+
Sbjct: 116 GELKEMSEVDMSRLEVDTSDDETVATTTTVPKVEILDNNVLNVTQGNIDDDMVLVDDTKN 175

Query: 150 XXXXXXXXXXXQRTASFQSVKTF--------HNGNDVLSTTATPPPPITDENQMVELLTH 201
                      ++ +S     T         H  + + +TT T     T++    +LLT 
Sbjct: 176 FAGASIGELIDEQLSSINVEPTGSHCCGSQPHGIDPMKTTTVTAAATETEKYPFFQLLTK 235

Query: 202 KGVYLSTQCSCEDDNCQCDNCLIHRKEEELNKYIRQSGIPLTNLGNGRVTDDENGHGNGS 261
           +GVYLSTQCSC   NC C NCLIHR EEE+N YI  SG+PLTNL +              
Sbjct: 236 RGVYLSTQCSCSAANCACSNCLIHRTEEEINNYIEASGVPLTNLDSSTSL-----QATPE 290

Query: 262 IKTISCSTESVCRCPPQDCICPHCLDHPGEIISMSNLLLHGVLNTQLKRKTIIKYRNKLI 321
           I+    S    C C P++C C  C  H  E++    +++HG++NT+L +KT+I+YR KLI
Sbjct: 291 IE----SPRPSCMCKPEECTCDGCDIHTIEVVPFQRIVIHGLINTRLTKKTLIQYRKKLI 346

Query: 322 PSKYWWDFIKLQIPLMSRRQLESLDLLRWFDSIVEAYGSFL 362
             KYWWD+  + IP +     + LD++ +FD+I++ +G  L
Sbjct: 347 GQKYWWDYCMVYIPCLRCNNFDGLDIVGFFDNIIKEHGHEL 387

>YMR021C (MAC1) [3985] chr13 complement(317164..318417)
           Transcription factor involved in induction of genes
           required for the reduction and utilization of iron and
           copper [1254 bp, 417 aa]
          Length = 417

 Score =  202 bits (514), Expect = 5e-61,   Method: Compositional matrix adjust.
 Identities = 97/198 (48%), Positives = 126/198 (63%), Gaps = 8/198 (4%)

Query: 168 SVKTFHNGNDVL---STTATPPPPITDENQMVELLTHKGVYLSTQCSCEDDNCQCDNCLI 224
           SV   H+ ++ L   STT    P  +D    VE+LTHKG++LSTQCSCED++C C NCLI
Sbjct: 219 SVPGAHDSSETLTPQSTTTIAAPHSSDVASKVEVLTHKGIFLSTQCSCEDESCPCVNCLI 278

Query: 225 HRKEEELNKYIRQSGIPLTNLGNGRVTDDENGHGNGSIKTISCSTESVCRCPPQDCICPH 284
           HR EEELN YI+QSG+PLTN+G  ++TD    +    +    C T+  C CPP +C C  
Sbjct: 279 HRSEEELNSYIQQSGVPLTNIGEAQITDKMMDY----LDDCKC-TDKECICPPDNCTCDG 333

Query: 285 CLDHPGEIISMSNLLLHGVLNTQLKRKTIIKYRNKLIPSKYWWDFIKLQIPLMSRRQLES 344
           C  H   II       +G+LN +L RKT IK++ KL+PSKYWWDF+KLQ+PLM+  QLE 
Sbjct: 334 CFSHSTNIIPFEKFFFYGILNARLTRKTQIKFKGKLVPSKYWWDFLKLQVPLMTDAQLEL 393

Query: 345 LDLLRWFDSIVEAYGSFL 362
           LD+  WF  +V  Y   L
Sbjct: 394 LDIHAWFQKLVSNYAPHL 411

 Score =  127 bits (320), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 64/143 (44%), Positives = 92/143 (64%), Gaps = 16/143 (11%)

Query: 1   MIIFDGDKYSCVACIRGHRSSTCKHSDRMLVKVRTRGRPSPMDVRKVIMVDTDSQVEPPV 60
           MIIF+G+KY+C +CIRGHRSSTC+HS RML+KVRTRGRPSPM +R  I+VD+ SQ     
Sbjct: 1   MIIFNGNKYACASCIRGHRSSTCRHSHRMLIKVRTRGRPSPMAIRDAILVDSTSQSTEYE 60

Query: 61  HTPEDSNPCCQRSNANSKSCNKMNKQPILFLRAMRTQKALLVDGMLKIMVEDN------E 114
           +  +    C          C+ MN+QPILF+RA   +KA +++G L I++E+       +
Sbjct: 61  NGAQIEGDC----------CSAMNQQPILFVRASAVRKARMINGKLHILMEEGFTAHEPK 110

Query: 115 SVSIDSKKKFKLVSEREYMLKHS 137
            +S  +    K ++E E++ KHS
Sbjct: 111 DISTFTDDGNKYITETEFLRKHS 133

>Scas_668.16
          Length = 291

 Score = 62.0 bits (149), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 32/40 (80%)

Query: 1  MIIFDGDKYSCVACIRGHRSSTCKHSDRMLVKVRTRGRPS 40
          MI+ +G+KY+C  CIRGHRSS+C H DR L K++ +GRPS
Sbjct: 1  MIMLNGEKYACDLCIRGHRSSSCNHRDRQLTKLKPKGRPS 40

>CAGL0L09339g 1012259..1014892 some similarities with sp|Q12753
          Saccharomyces cerevisiae YPR008w, hypothetical start
          Length = 877

 Score = 55.1 bits (131), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 21/40 (52%), Positives = 31/40 (77%)

Query: 1  MIIFDGDKYSCVACIRGHRSSTCKHSDRMLVKVRTRGRPS 40
          M++ +G KY+C  CIRGHR +TC HSD+ L+ ++ +GRPS
Sbjct: 1  MVLINGVKYACERCIRGHRVTTCNHSDQPLMMIKPKGRPS 40

>Scas_710.11
          Length = 743

 Score = 54.3 bits (129), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 25/66 (37%), Positives = 39/66 (59%), Gaps = 11/66 (16%)

Query: 1  MIIFDGDKYSCVACIRGHRSSTCKHSDRMLVKVRTRGRPSPM-----DVRKVIMVDTDSQ 55
          M++ +G KY+C  CIRGHR +TC H+D+ L+ ++ +GRPS       ++RK      +  
Sbjct: 1  MVLINGVKYACERCIRGHRVTTCNHTDQPLMMIKPKGRPSTTCSYCKEIRK------NKN 54

Query: 56 VEPPVH 61
            PP H
Sbjct: 55 AHPPGH 60

>YPR008W (HAA1) [5444] chr16 (573013..575097) Nuclear protein that
          activates transcription of several genes including TPO2
          and YRO2, has homology to the copper-activated
          transcription factor Ace1p [2085 bp, 694 aa]
          Length = 694

 Score = 54.3 bits (129), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 20/40 (50%), Positives = 31/40 (77%)

Query: 1  MIIFDGDKYSCVACIRGHRSSTCKHSDRMLVKVRTRGRPS 40
          M++ +G KY+C  CIRGHR +TC H+D+ L+ ++ +GRPS
Sbjct: 1  MVLINGIKYACERCIRGHRVTTCNHTDQPLMMIKPKGRPS 40

>AEL295C [2210] [Homologous to ScYPR008W (HAA1) - SH; ScYGL166W
          (CUP2) - SH] (88054..89688) [1635 bp, 544 aa]
          Length = 544

 Score = 53.9 bits (128), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 20/40 (50%), Positives = 31/40 (77%)

Query: 1  MIIFDGDKYSCVACIRGHRSSTCKHSDRMLVKVRTRGRPS 40
          M++ +G KY+C  CIRGHR +TC H+D+ L+ ++ +GRPS
Sbjct: 1  MVLLNGVKYACERCIRGHRVTTCNHTDQPLMMIKPKGRPS 40

>KLLA0A03047g 269553..271256 some similarities with sp|Q12753
          Saccharomyces cerevisiae YPR008w, hypothetical start
          Length = 567

 Score = 53.9 bits (128), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 20/40 (50%), Positives = 30/40 (75%)

Query: 1  MIIFDGDKYSCVACIRGHRSSTCKHSDRMLVKVRTRGRPS 40
          M++ +G KY+C  CIRGHR +TC H+D+ L  ++ +GRPS
Sbjct: 1  MVLINGVKYACERCIRGHRVTTCNHTDQPLTMIKPKGRPS 40

>YGL166W (CUP2) [1824] chr7 (191133..191810) Copper-dependent
          transcription factor responsible for induction of
          CUP1A, CUP1B, CRS5, and SOD1 [678 bp, 225 aa]
          Length = 225

 Score = 52.4 bits (124), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 20/40 (50%), Positives = 29/40 (72%)

Query: 1  MIIFDGDKYSCVACIRGHRSSTCKHSDRMLVKVRTRGRPS 40
          M++ +G KY+C  CIRGHR++ C H+D  L  +R +GRPS
Sbjct: 1  MVVINGVKYACETCIRGHRAAQCTHTDGPLQMIRRKGRPS 40

>Kwal_14.1543
          Length = 599

 Score = 53.1 bits (126), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 20/40 (50%), Positives = 31/40 (77%)

Query: 1  MIIFDGDKYSCVACIRGHRSSTCKHSDRMLVKVRTRGRPS 40
          M++ +G KY+C  CIRGHR +TC H+D+ L+ ++ +GRPS
Sbjct: 1  MVLVNGIKYACERCIRGHRVTTCNHTDQPLMMIKPKGRPS 40

>CAGL0I04180g 367258..368055 sp|P41772 Candida glabrata
          metal-activated transcriptional activator, identified
          start
          Length = 265

 Score = 48.5 bits (114), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 17/39 (43%), Positives = 30/39 (76%)

Query: 1  MIIFDGDKYSCVACIRGHRSSTCKHSDRMLVKVRTRGRP 39
          M++ +G KY+C +CI+ H+++ C+H+DR L  ++ RGRP
Sbjct: 1  MVVINGVKYACDSCIKSHKAAQCEHNDRPLKILKPRGRP 39

>YPR066W (UBA3) [5494] chr16 (681208..682107) Rub1-activating
           enzyme, similar to ubiquitin-activating E1-like proteins
           [900 bp, 299 aa]
          Length = 299

 Score = 31.2 bits (69), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 23/89 (25%), Positives = 42/89 (47%), Gaps = 8/89 (8%)

Query: 69  CCQRSNANSKSCNKMNKQPIL-----FLRAMRTQKALLVDGMLKIMVE-DNESVSIDSKK 122
           CC+R+   S S  K++   IL      + ++ T  A++       MV+  N+ + +++  
Sbjct: 207 CCERAAQFSISTEKLSTSFILGIIKSIIPSVSTTNAMVAATCCTQMVKIYNDLIDLENGN 266

Query: 123 KFKLV--SEREYMLKHSNNRMPDCCSCKS 149
            F L+  SE  +M      R+PDC  C +
Sbjct: 267 NFTLINCSEGCFMYSFKFERLPDCTVCSN 295

>Scas_567.7
          Length = 493

 Score = 28.9 bits (63), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 25/96 (26%), Positives = 40/96 (41%), Gaps = 8/96 (8%)

Query: 272 VCRCPPQDCICPHCLDH---PGEIISMSNLLLHGVLNTQLKRKTIIKY--RNKLIPSKYW 326
           +   P +    P  +D      E I M+ L L   LN + K + +  Y  +N +     W
Sbjct: 236 IAFIPDEYWEYPDFVDQDKAEEEKIKMAGLPLGDSLNFRFKSRYMAGYFAKNPVFDEFDW 295

Query: 327 WDFIKLQIPLMSRRQLESLDLLRWFDSIVEAYGSFL 362
             + ++Q P M  R     D +RW     +AYG F+
Sbjct: 296 --YWRIQ-PNMELRCNVDYDAIRWLQDHEKAYGFFI 328

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.320    0.134    0.416 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 12,817,742
Number of extensions: 546583
Number of successful extensions: 1537
Number of sequences better than 10.0: 24
Number of HSP's gapped: 1527
Number of HSP's successfully gapped: 30
Length of query: 382
Length of database: 16,596,109
Length adjustment: 103
Effective length of query: 279
Effective length of database: 13,030,455
Effective search space: 3635496945
Effective search space used: 3635496945
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 62 (28.5 bits)