Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Sklu_2411.1168768735730.0
Scas_709.5175973214370.0
YMR019W (STB4)94966514230.0
Kwal_26.820065259113231e-175
Kwal_23.65375523872183e-18
Scas_720.588904681562e-10
Sklu_1993.28233931454e-09
CAGL0F09229g835561444e-09
YIL130W964401411e-08
Scas_662.8906501401e-08
YOR380W (RDR1)5463741345e-08
Kwal_23.4754812371346e-08
CAGL0F02519g832351331e-07
CAGL0G08844g847371311e-07
KLLA0F04609g916371302e-07
CAGL0A00451g1107731302e-07
KLLA0A09119g1082741266e-07
KLLA0A02585g370731238e-07
Scas_702.7d978561241e-06
AER183C879421241e-06
Scas_518.5919511241e-06
Scas_680.257381981241e-06
YGL013C (PDR1)1068691232e-06
Kwal_47.17506924451222e-06
KLLA0C10923g7751121212e-06
KLLA0C03201g650361203e-06
KLLA0C19228g591481203e-06
Kwal_26.70146544151203e-06
AER370W801371203e-06
YGR288W (MAL13)473331184e-06
CAGL0L03377g1209511204e-06
Scas_638.141043341186e-06
CAGL0M11440g5752051168e-06
Sklu_2082.182701049e-06
Scas_663.12944671169e-06
CAGL0J07150g1022481169e-06
Sklu_2434.10983521161e-05
Scas_556.61022571151e-05
CAGL0L01903g1287451142e-05
CAGL0I07755g1053621142e-05
Kwal_26.7095838551132e-05
ADR403C970461132e-05
ADR405C807711123e-05
KLLA0A03443g975691123e-05
Scas_702.71113381123e-05
YER184C794471123e-05
CAGL0M12298g994921114e-05
YBR297W (MAL33)468831104e-05
Scas_637.7998551114e-05
Sklu_2335.6940591114e-05
YLR098C (CHA4)6482231105e-05
KLLA0F09559g658571105e-05
YOR363C (PIP2)996601105e-05
KLLA0C14212g1040521105e-05
Kwal_8.580638671095e-05
YBL005W (PDR3)976361096e-05
Kwal_56.226058654141097e-05
CAGL0F07909g1049421098e-05
Scas_234.1337571078e-05
Scas_669.8637381089e-05
YJL206C758501079e-05
YKR064W863531071e-04
Sklu_2191.2718501061e-04
YKL222C705741062e-04
Scas_564.9*609991042e-04
YNR063W607451042e-04
AGL361C696361042e-04
YOL089C (HAL9)1030641043e-04
Scas_573.41478621043e-04
YLR256W (HAP1)1502561033e-04
Scas_542.8902301033e-04
CAGL0L04400g987401033e-04
YFL052W465521024e-04
CAGL0B03421g1355411034e-04
YOR337W (TEA1)7592281024e-04
CAGL0F07865g844481024e-04
KLLA0F02387g7272141024e-04
KLLA0E02618g1109481024e-04
KLLA0F25630g1007481024e-04
KLLA0F10835g756571025e-04
YPR196W470591015e-04
KLLA0F02750g1148401025e-04
AFL200W596561015e-04
AFR096W852331015e-04
CAGL0A00583g646421016e-04
Sklu_2064.2922761016e-04
YAL051W (OAF1)1062571017e-04
AGL083W856431007e-04
AFR117C1152351007e-04
KLLA0E18194g865421008e-04
Kwal_56.23058775681008e-04
Kwal_55.21884882541008e-04
Scas_625.51141421009e-04
Kwal_23.312278876999e-04
Kwal_26.680594460999e-04
Kwal_23.642573542990.001
KLLA0D01452g144548990.001
Kwal_14.91582257990.001
Sklu_2384.683145980.001
AGR061C61233980.001
KLLA0A04169g77535980.001
CAGL0K05841g137272990.001
YLR451W (LEU3)88647980.001
ACL195C10965900.001
Kwal_34.1575162838970.001
CAGL0H00396g94037980.001
Sklu_1622.277867970.001
YPL248C (GAL4)88145970.002
KLLA0C18953g70337970.002
KLLA0C17050g95538970.002
Scas_630.1470157970.002
CAGL0D02904g88740970.002
YLR228C (ECM22)81457970.002
KLLA0D05038g67342960.002
KLLA0F22990g125341970.002
KLLA0A09251g688230960.002
Kwal_23.351457931960.002
Scas_449.1636198950.002
AGL233C87240960.002
AGL091W86658960.002
YCR106W (RDS1)83244950.003
Sklu_2296.691956950.003
Kwal_14.77866581940.003
Scas_699.793543950.003
YOR162C (YRR1)81068940.003
YBR150C (TBS1)109440950.003
Sklu_2297.545498930.004
KLLA0F19602g60338940.004
Scas_679.2677552940.004
KLLA0D10153g65539930.004
YKL015W (PUT3)97938930.005
KLLA0D00484g100434930.005
ACR028C60136930.005
YKL038W (RGT1)117041930.005
CAGL0E05434g816229930.005
ADR365W701130930.005
CAGL0L09691g82454930.005
YLR266C (PDR8)701155920.006
Kwal_47.1768185437920.006
Scas_590.2117230920.007
KLLA0F14322g71751910.007
Scas_700.4040738900.008
Sklu_2321.3906127910.008
KLLA0D12672g86545910.009
ABR174W86443910.009
Scas_661.2374179910.009
CAGL0M03025g125467910.009
Kwal_47.1693966943900.010
Kwal_55.2072282751910.010
YDR213W (UPC2)91335910.010
YDR034C (LYS14)79048900.010
KLLA0F00572g59735900.010
YOR172W (YRM1)78646900.011
Scas_691.3290640900.012
CAGL0C01199g92263900.012
Scas_688.1776932900.013
Kwal_47.1756562841890.013
ABL121C128542900.013
YJL089W (SIP4)82960890.013
CAGL0K11902g83138890.015
Scas_715.3111556890.015
KLLA0A03421g88040890.016
Scas_696.44116434890.017
ACL096W83548890.017
YLL054C76967880.018
Scas_526.3110931880.018
Sklu_2376.692235880.019
Kwal_27.10232120948880.019
Scas_711.3193234880.020
KLLA0D10593g92546880.020
CAGL0A04455g109836880.020
KLLA0C04620g126931880.021
KLLA0E14036g67883870.023
YPL133C (RDS2)44654870.023
ACR107W38435860.024
Scas_721.9486948870.025
YMR280C (CAT8)143333870.026
KLLA0A06039g65750860.030
CAGL0H06875g70253860.032
KLLA0A01804g94576860.033
YHR178W (STB5)74379860.034
CAGL0G09757g142331860.034
Scas_674.12*90940850.039
YMR168C (CEP3)60829850.043
KLLA0F04213g76838850.045
YHR056C (RSC30)88341850.045
Sklu_2023.3658201850.046
YLR278C134131850.047
AFR171W61250850.047
YIR023W (DAL81)970184850.047
Kwal_23.4370692441840.050
CAGL0I02552g1005200850.050
Scas_659.1075745840.053
Scas_597.254051840.055
Kwal_26.673267635840.055
YBR033W91947840.058
Kwal_56.2456675538840.059
ACL058W81737840.061
Kwal_33.1393479764840.062
AAL175W88357840.063
CAGL0M02651g46262830.064
Kwal_56.2467064342830.066
CAGL0F07755g61132830.069
Kwal_27.968884155830.070
Kwal_23.2905881102830.072
CAGL0L04576g86569830.079
ADR199C94448830.081
KLLA0F22880g116455830.086
AGL099C74735820.089
AFL160C64848820.097
Scas_610.980939820.10
YLR014C (PPR1)90434820.10
KLLA0D00396g36142810.10
Scas_626.683936820.11
KLLA0E19701g68139810.12
Kwal_26.866235538800.12
Kwal_47.1723394847810.12
ACL093C1010201820.12
KLLA0D10197g85638810.13
Scas_709.65*65142810.14
KLLA0F18084g86033810.14
AGR280C110631810.14
YJL103C61834800.14
YDR303C (RSC3)88539810.15
KLLA0D12650g65141800.15
AAL057C80967800.16
ABL099W80038800.19
Kwal_23.317861159790.20
CAGL0M05907g89141790.21
YBL066C (SEF1)105764790.22
Kwal_26.810997042790.22
YML099C (ARG81)88042790.22
YDR421W (ARO80)95078790.22
YIL136W (OM45)39335780.23
Scas_657.385640790.24
KLLA0C08657g72261780.26
KLLA0F10417g50785780.27
Sklu_1373.260835780.28
Kwal_23.652959861780.31
Kwal_47.1808974554770.39
Kwal_14.81956831770.41
Scas_685.2277761770.41
CAGL0L03674g62924770.42
KLLA0D11286g67841760.46
Kwal_23.401662839760.48
CAGL0D03850g83438760.51
Sklu_2268.287541760.51
Scas_588.1183539760.52
Sklu_2397.884836760.52
KLLA0A10329g63942750.58
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Sklu_2411.11
         (687 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Sklu_2411.11 YMR019W, Contig c2411 20506-22569 reverse complement    1380   0.0  
Scas_709.51                                                           558   0.0  
YMR019W (STB4) [3983] chr13 (312155..315004) Sin3p-binding prote...   552   0.0  
Kwal_26.8200                                                          514   e-175
Kwal_23.6537                                                           89   3e-18
Scas_720.58                                                            65   2e-10
Sklu_1993.2 YIL130W, Contig c1993 2139-4610 reverse complement         60   4e-09
CAGL0F09229g complement(908186..910693) weakly similar to sp|P39...    60   4e-09
YIL130W (YIL130W) [2546] chr9 (102782..105676) Protein that cont...    59   1e-08
Scas_662.8                                                             59   1e-08
YOR380W (RDR1) [5153] chr15 (1051286..1052926) Protein with simi...    56   5e-08
Kwal_23.4754                                                           56   6e-08
CAGL0F02519g 245120..247618 weakly similar to sp|P39529 Saccharo...    56   1e-07
CAGL0G08844g complement(846590..849133) similar to sp|P40467 Sac...    55   1e-07
KLLA0F04609g complement(451579..454329) similar to sp|P40467 Sac...    55   2e-07
CAGL0A00451g 47557..50880 similar to sp|P12383 Saccharomyces cer...    55   2e-07
KLLA0A09119g complement(797533..800781) weakly similar to sp|P12...    53   6e-07
KLLA0A02585g complement(226562..227674) some similarities with c...    52   8e-07
Scas_702.7d                                                            52   1e-06
AER183C [2685] [Homologous to ScYOL089C (HAL9) - NSH] (975879..9...    52   1e-06
Scas_518.5                                                             52   1e-06
Scas_680.25                                                            52   1e-06
YGL013C (PDR1) [1960] chr7 complement(469095..472301) Zinc-finge...    52   2e-06
Kwal_47.17506                                                          52   2e-06
KLLA0C10923g complement(939148..941475) similar to sp|P07272 Sac...    51   2e-06
KLLA0C03201g complement(286973..288925) similar to sp|P39529 Sac...    51   3e-06
KLLA0C19228g 1713787..1715562 similar to sp|P53749 Saccharomyces...    51   3e-06
Kwal_26.7014                                                           51   3e-06
AER370W [2871] [Homologous to ScYIL130W (GIN1) - SH] complement(...    51   3e-06
YGR288W (MAL13) [2233] chr7 (1070298..1071719) Maltose pathway r...    50   4e-06
CAGL0L03377g complement(382932..386561) some similarities with s...    51   4e-06
Scas_638.14                                                            50   6e-06
CAGL0M11440g complement(1125748..1127475) similar to sp|P43634 S...    49   8e-06
Sklu_2082.1 YER184C, Contig c2082 2025-2273                            45   9e-06
Scas_663.12                                                            49   9e-06
CAGL0J07150g complement(686734..689802) similar to sp|P39720 Sac...    49   9e-06
Sklu_2434.10 YAL051W, Contig c2434 22765-25716                         49   1e-05
Scas_556.6                                                             49   1e-05
CAGL0L01903g 218703..222566 similar to sp|P32862 Saccharomyces c...    49   2e-05
CAGL0I07755g complement(745315..748476) similar to tr|Q12180 Sac...    49   2e-05
Kwal_26.7095                                                           48   2e-05
ADR403C [2143] [Homologous to ScYAL051W (OAF1) - SH; ScYOR363C (...    48   2e-05
ADR405C [2145] [Homologous to ScYAL051W (OAF1) - SH; ScYOR363C (...    48   3e-05
KLLA0A03443g 311628..314555 weakly similar to sp|P39720 Saccharo...    48   3e-05
Scas_702.7                                                             48   3e-05
YER184C (YER184C) [1612] chr5 complement(556291..558675) Protein...    48   3e-05
CAGL0M12298g complement(1225753..1228737) similar to sp|P39720 S...    47   4e-05
YBR297W (MAL33) [474] chr2 (800479..801885) Maltose fermentation...    47   4e-05
Scas_637.7                                                             47   4e-05
Sklu_2335.6 YBL005W, Contig c2335 10191-13013                          47   4e-05
YLR098C (CHA4) [3513] chr12 complement(337528..339474) Zinc-fing...    47   5e-05
KLLA0F09559g complement(876719..878695) some similarities with s...    47   5e-05
YOR363C (PIP2) [5140] chr15 complement(1020218..1023208) Transcr...    47   5e-05
KLLA0C14212g complement(1229219..1232341) some similarities with...    47   5e-05
Kwal_8.580                                                             47   5e-05
YBL005W (PDR3) [189] chr2 (217435..220365) Zinc-finger transcrip...    47   6e-05
Kwal_56.22605                                                          47   7e-05
CAGL0F07909g 776659..779808 some similarities with tr|Q12180 Sac...    47   8e-05
Scas_234.1                                                             46   8e-05
Scas_669.8                                                             46   9e-05
YJL206C (YJL206C) [2722] chr10 complement(47659..49935) Protein ...    46   9e-05
YKR064W (YKR064W) [3315] chr11 (562189..564780) Protein with sim...    46   1e-04
Sklu_2191.2 YKL222C, Contig c2191 6517-8673 reverse complement         45   1e-04
YKL222C (YKL222C) [3053] chr11 complement(3504..5621) Protein wi...    45   2e-04
Scas_564.9*                                                            45   2e-04
YNR063W (YNR063W) [4646] chr14 (746940..748763) Protein with sim...    45   2e-04
AGL361C [3951] [Homologous to NOHBY] (24101..26191) [2091 bp, 69...    45   2e-04
YOL089C (HAL9) [4731] chr15 complement(150397..153489) Protein i...    45   3e-04
Scas_573.4                                                             45   3e-04
YLR256W (HAP1) [3650] chr12 (646417..650925) Transcription facto...    44   3e-04
Scas_542.8                                                             44   3e-04
CAGL0L04400g complement(511762..514725) similar to tr|Q12340 Sac...    44   3e-04
YFL052W (YFL052W) [1632] chr6 (28232..29629) Protein with strong...    44   4e-04
CAGL0B03421g complement(336071..340138) similar to sp|P12351 Sac...    44   4e-04
YOR337W (TEA1) [5116] chr15 (954339..956618) Ty1 enhancer activa...    44   4e-04
CAGL0F07865g complement(768270..770804) similar to tr|Q12151 Sac...    44   4e-04
KLLA0F02387g complement(213669..215852) similar to sp|P47988 Sac...    44   4e-04
KLLA0E02618g 244696..248025 no similarity, hypothetical start          44   4e-04
KLLA0F25630g 2378464..2381487 some similarities with sp|P32862 S...    44   4e-04
KLLA0F10835g 997512..999782 no similarity, hypothetical start          44   5e-04
YPR196W (YPR196W) [5609] chr16 (931370..932782) Positive regulat...    44   5e-04
KLLA0F02750g complement(250368..253814) some similarities with s...    44   5e-04
AFL200W [2995] [Homologous to ScYMR168C (CEP3) - SH] complement(...    44   5e-04
AFR096W [3288] [Homologous to ScYJL089W (SIP4) - SH] complement(...    44   5e-04
CAGL0A00583g 65286..67226 weakly similar to sp|Q06149 Saccharomy...    44   6e-04
Sklu_2064.2 , Contig c2064 873-3641                                    44   6e-04
YAL051W (OAF1) [17] chr1 (48565..51753) Transcription factor req...    44   7e-04
AGL083W [4228] [Homologous to ScYKL038W (RGT1) - SH; ScYBR033W (...    43   7e-04
AFR117C [3309] [Homologous to ScYLR256W (HAP1) - SH] (646832..65...    43   7e-04
KLLA0E18194g 1613115..1615712 similar to sp|P25502 Saccharomyces...    43   8e-04
Kwal_56.23058                                                          43   8e-04
Kwal_55.21884                                                          43   8e-04
Scas_625.5                                                             43   9e-04
Kwal_23.3122                                                           43   9e-04
Kwal_26.6805                                                           43   9e-04
Kwal_23.6425                                                           43   0.001
KLLA0D01452g 124018..128355 gi|3228691|gb|AAC23607.1 Kluyveromyc...    43   0.001
Kwal_14.915                                                            43   0.001
Sklu_2384.6 YKL015W, Contig c2384 10929-13424                          42   0.001
AGR061C [4371] [Homologous to ScYLR098C (CHA4) - SH] (831058..83...    42   0.001
KLLA0A04169g complement(376273..378600) similar to sgd|S0004218 ...    42   0.001
CAGL0K05841g 572315..576433 similar to sp|P12351 Saccharomyces c...    43   0.001
YLR451W (LEU3) [3825] chr12 (1036089..1038749) Transcription fac...    42   0.001
ACL195C [854] [Homologous to NOHBY] (19204..19533) [330 bp, 109 aa]    39   0.001
Kwal_34.15751                                                          42   0.001
CAGL0H00396g complement(37005..39827) similar to sp|P08638 Sacch...    42   0.001
Sklu_1622.2 YDR034C, Contig c1622 1522-3858                            42   0.001
YPL248C (GAL4) [5202] chr16 complement(79711..82356) Transcripti...    42   0.002
KLLA0C18953g 1682246..1684357 weakly similar to sp|P36598|Q9UTJ9...    42   0.002
KLLA0C17050g 1490472..1493339 some similarities with ca|CA3454|I...    42   0.002
Scas_630.14                                                            42   0.002
CAGL0D02904g complement(302952..305615) similar to sp|P07272 Sac...    42   0.002
YLR228C (ECM22) [3628] chr12 complement(600021..602465) Sterol r...    42   0.002
KLLA0D05038g 433653..435674 weakly similar to sp|P40971 Saccharo...    42   0.002
KLLA0F22990g 2134385..2138146 similar to sp|P12351 Saccharomyces...    42   0.002
KLLA0A09251g 808253..810319 some similarities with sp|P38699 Sac...    42   0.002
Kwal_23.3514                                                           42   0.002
Scas_449.1                                                             41   0.002
AGL233C [4079] [Homologous to ScYKL222C - NSH; ScYOR172W - NSH] ...    42   0.002
AGL091W [4220] [Homologous to ScYLR228C (ECM22) - SH; ScYDR213W ...    42   0.002
YCR106W (RDS1) [627] chr3 (310954..313452) Protein with similari...    41   0.003
Sklu_2296.6 YJL089W, Contig c2296 12179-14938 reverse complement       41   0.003
Kwal_14.778                                                            41   0.003
Scas_699.7                                                             41   0.003
YOR162C (YRR1) [4961] chr15 complement(639560..641992) Transcrip...    41   0.003
YBR150C (TBS1) [335] chr2 complement(541165..544449) Protein wit...    41   0.003
Sklu_2297.5 YLR098C, Contig c2297 8133-9497                            40   0.004
KLLA0F19602g complement(1814949..1816760) similar to sp|P43634 S...    41   0.004
Scas_679.26                                                            41   0.004
KLLA0D10153g 858016..859983 weakly similar to sp|P35995 Saccharo...    40   0.004
YKL015W (PUT3) [3241] chr11 (408187..411126) Transcription facto...    40   0.005
KLLA0D00484g 44879..47893 no similarity, hypothetical start            40   0.005
ACR028C [1076] [Homologous to NOHBY] (408701..410506) [1806 bp, ...    40   0.005
YKL038W (RGT1) [3220] chr11 (365248..368760) Protein involved in...    40   0.005
CAGL0E05434g 532577..535027 similar to sp|P47988 Saccharomyces c...    40   0.005
ADR365W [2106] [Homologous to ScYOR337W (TEA1) - SH] complement(...    40   0.005
CAGL0L09691g complement(1039799..1042273) some similarities with...    40   0.005
YLR266C (PDR8) [3660] chr12 complement(675621..677726) Zn[2]-Cys...    40   0.006
Kwal_47.17681                                                          40   0.006
Scas_590.2                                                             40   0.007
KLLA0F14322g 1328925..1331078 gi|32440908|emb|CAE00852.1 Kluyver...    40   0.007
Scas_700.40                                                            39   0.008
Sklu_2321.3 YLR014C, Contig c2321 8747-11467                           40   0.008
KLLA0D12672g complement(1076011..1078608) gi|125903|sp|P08657|LA...    40   0.009
ABR174W [767] [Homologous to ScYLR451W (LEU3) - SH] complement(7...    40   0.009
Scas_661.23                                                            40   0.009
CAGL0M03025g complement(341849..345613) similar to sp|P39113 Sac...    40   0.009
Kwal_47.16939                                                          39   0.010
Kwal_55.20722                                                          40   0.010
YDR213W (UPC2) [1051] chr4 (889744..892485) Sterol regulatory el...    40   0.010
YDR034C (LYS14) [885] chr4 complement(509732..512104) Transcript...    39   0.010
KLLA0F00572g complement(42710..44503) some similarities with ca|...    39   0.010
YOR172W (YRM1) [4969] chr15 (654210..656570) Protein with simila...    39   0.011
Scas_691.32                                                            39   0.012
CAGL0C01199g complement(121944..124712) similar to tr|Q12151 Sac...    39   0.012
Scas_688.17                                                            39   0.013
Kwal_47.17565                                                          39   0.013
ABL121C [471] [Homologous to ScYMR280C (CAT8) - SH] (170784..174...    39   0.013
YJL089W (SIP4) [2826] chr10 (265842..268331) Transcriptional act...    39   0.013
CAGL0K11902g complement(1148381..1150876) similar to sp|P40971 S...    39   0.015
Scas_715.3                                                             39   0.015
KLLA0A03421g 308414..311056 weakly similar to sp|P39720 Saccharo...    39   0.016
Scas_696.44                                                            39   0.017
ACL096W [953] [Homologous to ScYKL015W (PUT3) - SH] complement(1...    39   0.017
YLL054C (YLL054C) [3369] chr12 complement(32894..35203) Protein ...    39   0.018
Scas_526.3                                                             39   0.018
Sklu_2376.6 , Contig c2376 12573-15341 reverse complement              39   0.019
Kwal_27.10232                                                          39   0.019
Scas_711.31                                                            39   0.020
KLLA0D10593g complement(900326..903103) similar to sp|P08638 Sac...    39   0.020
CAGL0A04455g 432854..436150 similar to sp|P34228 Saccharomyces c...    39   0.020
KLLA0C04620g complement(422705..426514) weakly similar to sp|Q05...    39   0.021
KLLA0E14036g complement(1239566..1241602) some similarities with...    38   0.023
YPL133C (RDS2) [5312] chr16 complement(299887..301227) Protein w...    38   0.023
ACR107W [1154] [Homologous to ScYPL133C - SH] complement(544402....    38   0.024
Scas_721.94                                                            38   0.025
YMR280C (CAT8) [4234] chr13 complement(827027..831328) Transcrip...    38   0.026
KLLA0A06039g 557368..559341 weakly similar to sp|P36023 Saccharo...    38   0.030
CAGL0H06875g complement(682518..684626) some similarities with s...    38   0.032
KLLA0A01804g complement(159689..162526) similar to sgd|S0002829 ...    38   0.033
YHR178W (STB5) [2464] chr8 (459297..461528) Probable transcripti...    38   0.034
CAGL0G09757g 930351..934622 some similarities with sp|Q05854 Sac...    38   0.034
Scas_674.12*                                                           37   0.039
YMR168C (CEP3) [4123] chr13 complement(597331..599157) Component...    37   0.043
KLLA0F04213g 400673..402979 similar to sp|P40971 Saccharomyces c...    37   0.045
YHR056C (RSC30) [2344] chr8 complement(215184..217835) Component...    37   0.045
Sklu_2023.3 YHR178W, Contig c2023 2677-4653 reverse complement         37   0.046
YLR278C (YLR278C) [3671] chr12 complement(700001..704026) Protei...    37   0.047
AFR171W [3363] [Homologous to NOHBY] complement(752592..754430) ...    37   0.047
YIR023W (DAL81) [2687] chr9 (399774..402686) Transcriptional act...    37   0.047
Kwal_23.4370                                                           37   0.050
CAGL0I02552g 227257..230274 weakly similar to sp|P38699 Saccharo...    37   0.050
Scas_659.10                                                            37   0.053
Scas_597.2                                                             37   0.055
Kwal_26.6732                                                           37   0.055
YBR033W (YBR033W) [224] chr2 (301906..304665) Protein with simil...    37   0.058
Kwal_56.24566                                                          37   0.059
ACL058W [991] [Homologous to NOHBY] complement(261723..264176) [...    37   0.061
Kwal_33.13934                                                          37   0.062
AAL175W [12] [Homologous to ScYML099C (ARG81) - NSH] complement(...    37   0.063
CAGL0M02651g complement(304583..305971) similar to sp|P19541 Sac...    37   0.064
Kwal_56.24670                                                          37   0.066
CAGL0F07755g complement(755947..757782) similar to sp|P40969 Sac...    37   0.069
Kwal_27.9688                                                           37   0.070
Kwal_23.2905                                                           37   0.072
CAGL0L04576g 526960..529557 similar to tr|Q12340 Saccharomyces c...    37   0.079
ADR199C [1940] [Homologous to ScYDR421W (ARO80) - SH] (1048530.....    37   0.081
KLLA0F22880g 2123577..2127071 some similarities with ca|CA3639|I...    37   0.086
AGL099C [4213] [Homologous to ScYDR207C (UME6) - SH] (516587..51...    36   0.089
AFL160C [3035] [Homologous to ScYPL248C (GAL4) - SH] (130842..13...    36   0.097
Scas_610.9                                                             36   0.10 
YLR014C (PPR1) [3432] chr12 complement(172267..174981) Transcrip...    36   0.10 
KLLA0D00396g complement(36277..37362) some similarities with ca|...    36   0.10 
Scas_626.6                                                             36   0.11 
KLLA0E19701g complement(1739869..1741914) some similarities with...    36   0.12 
Kwal_26.8662                                                           35   0.12 
Kwal_47.17233                                                          36   0.12 
ACL093C [956] [Homologous to ScYIR023W (DAL81) - SH] (178239..18...    36   0.12 
KLLA0D10197g complement(861726..864296) similar to sp|P05085 Sac...    36   0.13 
Scas_709.65*                                                           36   0.14 
KLLA0F18084g complement(1652031..1654613) no similarity, hypothe...    36   0.14 
AGR280C [4591] [Homologous to ScYLR278C - SH] (1266918..1270238)...    36   0.14 
YJL103C (YJL103C) [2812] chr10 complement(228942..230798) Protei...    35   0.14 
YDR303C (RSC3) [1131] chr4 complement(1068721..1071378) Componen...    36   0.15 
KLLA0D12650g complement(1073580..1075535) weakly similar to ca|C...    35   0.15 
AAL057C [130] [Homologous to ScYDR303C (RSC3) - SH; ScYHR056C (R...    35   0.16 
ABL099W [493] [Homologous to ScYDR034C (LYS14) - SH] complement(...    35   0.19 
Kwal_23.3178                                                           35   0.20 
CAGL0M05907g 622029..624704 similar to sp|P36023 Saccharomyces c...    35   0.21 
YBL066C (SEF1) [131] chr2 complement(96906..100079) Protein with...    35   0.22 
Kwal_26.8109                                                           35   0.22 
YML099C (ARG81) [3872] chr13 complement(74398..77040) Component ...    35   0.22 
YDR421W (ARO80) [1245] chr4 (1312028..1314880) Positive transcri...    35   0.22 
YIL136W (OM45) [2540] chr9 (93619..94800) Protein of the outer m...    35   0.23 
Scas_657.3                                                             35   0.24 
KLLA0C08657g 757100..759268 some similarities with ca|CA3551|IPF...    35   0.26 
KLLA0F10417g 961004..962527 similar to sp|P38140 Saccharomyces c...    35   0.27 
Sklu_1373.2 YDR207C, Contig c1373 1069-2895                            35   0.28 
Kwal_23.6529                                                           35   0.31 
Kwal_47.18089                                                          34   0.39 
Kwal_14.819                                                            34   0.41 
Scas_685.22                                                            34   0.41 
CAGL0L03674g 420574..422463 some similarities with sp|P42950 Sac...    34   0.42 
KLLA0D11286g complement(964642..966678) no similarity, hypotheti...    34   0.46 
Kwal_23.4016                                                           34   0.48 
CAGL0D03850g 384689..387193 weakly similar to sp|Q06639 Saccharo...    34   0.51 
Sklu_2268.2 YKR064W, Contig c2268 4260-6887 reverse complement         34   0.51 
Scas_588.11                                                            34   0.52 
Sklu_2397.8 YML099C, Contig c2397 9784-12330                           34   0.52 
KLLA0A10329g 903873..905792 some similarities with ca|CA6113|IPF...    33   0.58 
Kwal_55.20674                                                          33   0.58 
Scas_540.3                                                             34   0.59 
KLLA0F02299g 205549..208167 no similarity, hypothetical start          33   0.62 
YMR139W (RIM11) [4096] chr13 (546124..547236) Member of the GSK3...    33   0.64 
Scas_521.2                                                             33   0.67 
KLLA0C16489g 1444456..1446642 some similarities with ca|CA2184|I...    33   0.68 
ACR241C [1288] [Homologous to ScYKR064W - SH] (784358..786745) [...    33   0.72 
Sklu_1973.1 YDR303C, Contig c1973 815-3148 reverse complement          33   0.83 
Sklu_1042.2 YGL162W, Contig c1042 1296-2192 reverse complement         33   0.91 
Scas_711.18                                                            33   0.94 
AFL031W [3162] [Homologous to ScYBR239C - SH] complement(376161....    33   1.00 
KLLA0D07029g 602763..604367 some similarities with sp|P19541 Sac...    33   1.2  
Sklu_2207.4 YJL103C, Contig c2207 6715-8313 reverse complement         33   1.2  
Kwal_55.20839                                                          32   1.4  
AFR081C [3273] [Homologous to ScYJL103C - SH] (574366..575814) [...    32   1.4  
KLLA0F10373g 957948..958994 some similarities with sp|P38141 Sac...    32   1.4  
KLLA0F20680g 1924148..1926511 weakly similar to sp|P39001 Saccha...    32   1.5  
Scas_717.33                                                            32   1.6  
Kwal_14.931                                                            32   1.8  
Kwal_14.2619                                                           32   1.8  
Kwal_14.1636                                                           32   1.8  
CAGL0F06743g 661325..663730 similar to sp|P21657 Saccharomyces c...    32   1.9  
KLLA0D09977g complement(841852..843756) weakly similar to sp|P40...    32   1.9  
KLLA0E18260g complement(1622300..1625701) some similarities with...    32   2.6  
Kwal_26.7448                                                           32   2.8  
YJL222W (VTH2) [2709] chr10 (11475..16124) Protein with similari...    32   3.2  
YNR065C (YNR065C) [4648] chr14 complement(750347..753697) Protei...    31   3.2  
YIL173W (VTH1) [2505] chr9 (11492..16141) Protein with strong si...    32   3.2  
ADR404C [2144] [Homologous to ScYAL051W (OAF1) - SH; ScYOR363C (...    31   3.5  
CAGL0L09383g 1018859..1019959 some similarities with sp|P53032 S...    31   3.5  
CAGL0F05357g 541830..543635 some similarities with sp|P39001 Sac...    31   3.7  
YDR207C (UME6) [1046] chr4 complement(865005..867515) Global tra...    31   3.8  
KLLA0E20405g <1805948..1809364 gi|3024604|sp|P87164|SEF1_KLULA K...    31   4.2  
CAGL0F03025g 295783..298569 similar to sp|Q04052 Saccharomyces c...    31   4.2  
KLLA0F13904g complement(1287758..1289497) some similarities with...    31   4.4  
Scas_596.4                                                             31   4.6  
Sklu_2301.1 , Contig c2301 1246-2795 reverse complement                30   5.1  
AGR369W [4680] [Homologous to ScYBL066C (SEF1) - SH] complement(...    31   5.2  
KLLA0A03399g 305616..308153 weakly similar to sp|P39720 Saccharo...    30   5.8  
AFL033W [3160] [Homologous to ScYBR240C (THI2) - SH] complement(...    30   6.6  
CAGL0L11198g 1191755..1194280 similar to sp|P07271 Saccharomyces...    30   6.7  
Scas_623.11                                                            30   7.6  
KLLA0A03091g 276333..277484 some similarities with sgd|S0006213 ...    30   8.4  
Kwal_27.10852                                                          30   9.6  

>Sklu_2411.11 YMR019W, Contig c2411 20506-22569 reverse complement
          Length = 687

 Score = 1380 bits (3573), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 668/687 (97%), Positives = 668/687 (97%)

Query: 1   MDPSKYNDPSLYGKDNGSKQRLRVRKACEICKKRKIKCDGHQPCTSCTKNSVQCVYKFTD 60
           MDPSKYNDPSLYGKDNGSKQRLRVRKACEICKKRKIKCDGHQPCTSCTKNSVQCVYKFTD
Sbjct: 1   MDPSKYNDPSLYGKDNGSKQRLRVRKACEICKKRKIKCDGHQPCTSCTKNSVQCVYKFTD 60

Query: 61  TASPISKPKPGRSLDKESIANALLQLESSLLAKIDSKXXXXXXXXXXNLVHFSSSLPSPW 120
           TASPISKPKPGRSLDKESIANALLQLESSLLAKIDSK          NLVHFSSSLPSPW
Sbjct: 61  TASPISKPKPGRSLDKESIANALLQLESSLLAKIDSKPTPTPTPTPPNLVHFSSSLPSPW 120

Query: 121 QTFSLDKYRFHRRYQNLLPYYLGQSLMQSLPPQTIQHHNLKTPRVQNYGWNMSGGHYLKN 180
           QTFSLDKYRFHRRYQNLLPYYLGQSLMQSLPPQTIQHHNLKTPRVQNYGWNMSGGHYLKN
Sbjct: 121 QTFSLDKYRFHRRYQNLLPYYLGQSLMQSLPPQTIQHHNLKTPRVQNYGWNMSGGHYLKN 180

Query: 181 GSDSSLDIINFDDPVQLDIVNKLLRFYFDHLNPVFSIVHEQVFLQQFNTGFLNKRRNSSK 240
           GSDSSLDIINFDDPVQLDIVNKLLRFYFDHLNPVFSIVHEQVFLQQFNTGFLNKRRNSSK
Sbjct: 181 GSDSSLDIINFDDPVQLDIVNKLLRFYFDHLNPVFSIVHEQVFLQQFNTGFLNKRRNSSK 240

Query: 241 LFISMLYLILATSLRFYEGYSQSQPVAFSQHQLDWLFKTNSSLEERLFHFAHEIVSRLSF 300
           LFISMLYLILATSLRFYEGYSQSQPVAFSQHQLDWLFKTNSSLEERLFHFAHEIVSRLSF
Sbjct: 241 LFISMLYLILATSLRFYEGYSQSQPVAFSQHQLDWLFKTNSSLEERLFHFAHEIVSRLSF 300

Query: 301 EWESFELIQSWLLIAFYLRTCHRQTSCWNALGSAIRMCKGMALYLNRFPQRHTLYEETKV 360
           EWESFELIQSWLLIAFYLRTCHRQTSCWNALGSAIRMCKGMALYLNRFPQRHTLYEETKV
Sbjct: 301 EWESFELIQSWLLIAFYLRTCHRQTSCWNALGSAIRMCKGMALYLNRFPQRHTLYEETKV 360

Query: 361 KNCFWSCFIMDKVISFQMGRYPDLSLPAEQMPPPDRNPDGWFHEETIQMYRLSLIISDCQ 420
           KNCFWSCFIMDKVISFQMGRYPDLSLPAEQMPPPDRNPDGWFHEETIQMYRLSLIISDCQ
Sbjct: 361 KNCFWSCFIMDKVISFQMGRYPDLSLPAEQMPPPDRNPDGWFHEETIQMYRLSLIISDCQ 420

Query: 421 KRDGEDLSVNEVQILKQRLTNWFRFFTPHETLYSKQVLFTYLDISLTLGIRGLFQLINPP 480
           KRDGEDLSVNEVQILKQRLTNWFRFFTPHETLYSKQVLFTYLDISLTLGIRGLFQLINPP
Sbjct: 421 KRDGEDLSVNEVQILKQRLTNWFRFFTPHETLYSKQVLFTYLDISLTLGIRGLFQLINPP 480

Query: 481 VITDVTPPAXXXXXXXXXANSRTFLDSLETVEKSNELFIPWWLNLSLLFAVSVSCITVLH 540
           VITDVTPPA         ANSRTFLDSLETVEKSNELFIPWWLNLSLLFAVSVSCITVLH
Sbjct: 481 VITDVTPPALLLDLSSLLANSRTFLDSLETVEKSNELFIPWWLNLSLLFAVSVSCITVLH 540

Query: 541 AGLKLQQAQSLLRQSFSIWNSLVSLHAKNPPEMAKECLWCLKMLNHMSCLRLQTSMQNLR 600
           AGLKLQQAQSLLRQSFSIWNSLVSLHAKNPPEMAKECLWCLKMLNHMSCLRLQTSMQNLR
Sbjct: 541 AGLKLQQAQSLLRQSFSIWNSLVSLHAKNPPEMAKECLWCLKMLNHMSCLRLQTSMQNLR 600

Query: 601 QIFGIDHGDSSLNKNRFAQFGKAGDNEEDNDVELGQEDAHTKDVSVSATTSSPMLNPPTF 660
           QIFGIDHGDSSLNKNRFAQFGKAGDNEEDNDVELGQEDAHTKDVSVSATTSSPMLNPPTF
Sbjct: 601 QIFGIDHGDSSLNKNRFAQFGKAGDNEEDNDVELGQEDAHTKDVSVSATTSSPMLNPPTF 660

Query: 661 ETLLQDDDLFANLQWFDQWVDDYSLQQ 687
           ETLLQDDDLFANLQWFDQWVDDYSLQQ
Sbjct: 661 ETLLQDDDLFANLQWFDQWVDDYSLQQ 687

>Scas_709.51
          Length = 759

 Score =  558 bits (1437), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 313/732 (42%), Positives = 413/732 (56%), Gaps = 73/732 (9%)

Query: 19  KQRLRVRKACEICKKRKIKCDGHQPCTSCTKNSVQCVYKFTDTASPISKPKPGRSLDK-E 77
           KQR+RV++AC ICK+RK+KCDG++PC +C K  + C Y  +   +      P   +D  E
Sbjct: 25  KQRIRVQRACNICKRRKVKCDGNKPCLNCIKKEIDCEYNNSSNTTKKEPNDPPADIDAAE 84

Query: 78  SIANALLQLESSLLAKIDSKXXXXXXXXXXNLV---------------------HFSSSL 116
           S   +   L    L K  S+                                    +   
Sbjct: 85  SSTMSPPNLLHPQLNKEQSEDNMAVLLLDLAKKLKQKKNIKDTTSLGNDDTIPPRVTKDT 144

Query: 117 PSPWQTFSLDKYRFHRRYQNLLPYYLGQSLMQSLPPQTIQHHNLKTPRVQNYGWNMSGGH 176
            SPWQ+FS DKYRFHRRYQN+LP   G+SL+ +LPPQ IQ +NL+TPR+QNY WNMSGGH
Sbjct: 145 NSPWQSFSYDKYRFHRRYQNVLPNKFGKSLLSALPPQLIQENNLETPRIQNYAWNMSGGH 204

Query: 177 YLK----NGSDSSLDIINFDDPVQLDIVNKLLRFYFDHLNPVFSIVHEQVFLQQFNTGFL 232
           YLK    + ++SSL   NFD+P+ L  V KLL FYF  +N  + I+HE++F  QFN GFL
Sbjct: 205 YLKFEQMHENNSSLLFFNFDNPLHLSTVTKLLTFYFKQINKPYGIIHEEMFWNQFNNGFL 264

Query: 233 NKRR---NSSKLFISMLYLILATSLRFYEGYSQSQPVAFSQHQLDWLFKTNSSL--EERL 287
            + +    S+KLF SMLYL+L  S+RFYEG   S        Q   L      L  EE +
Sbjct: 265 QQGKQNNKSAKLFTSMLYLVLTISIRFYEGLPASSLDQLFTPQEQELVHRQRILRNEEYM 324

Query: 288 FHFAHEIVSRLSFEWESFELIQSWLLIAFYLRTCHRQTSCWNALGSAIRMCKGMALYLNR 347
           F  A+ IVS+L+FEWESFELIQSWLLIAFYLRTC+RQ SCWNAL  AI MC GM+LYLNR
Sbjct: 325 FGHAYSIVSKLTFEWESFELIQSWLLIAFYLRTCYRQISCWNALSRAINMCNGMSLYLNR 384

Query: 348 FPQRHTLYEETKVKNCFWSCFIMDKVISFQMGRYPDLSLPAEQMPPPDRNPDGWFHEETI 407
           FP+ H+ Y+E K  +CFWSCFIMDK+ISFQ+GR   LS+P   M  P  NPD WFH+ETI
Sbjct: 385 FPEVHSTYDEVKAWHCFWSCFIMDKLISFQLGRLYQLSMPVTNMNQP-TNPDTWFHDETI 443

Query: 408 QMYRLSLIISDCQKRDGEDLSVNEVQILKQRLTNWFRFFTP-------------HETLYS 454
           Q+++LS I+ D QK++ ++L + E   L+  +  W   F               ++ LY 
Sbjct: 444 QLFQLSKIVMDFQKKEAQELDIQESLQLRGEMDKWLDNFMKSQEDNSSSSLLFTNQPLYQ 503

Query: 455 KQVLFTYLDISLTLGIRGLFQLINPPVITDVTPPAXXXXXXXXXANSRTFLDSLETVEKS 514
            Q   +YLDI +T  +R LF LINPP  T                + +  LD L  +   
Sbjct: 504 LQPFLSYLDIRVTFELRYLFCLINPPSYTSPLSYTFPIDIPSLIKHCQLSLDLLTGINSK 563

Query: 515 NELFIPWWLNLSLLFAVSVSCITVLHAGLKLQQAQSLLRQSFSIWNSLVSLHAKNPPEMA 574
           +  F+PWWLNLS LF++ +  + ++HAG++     ++L +S  +W SL +   KNPP M 
Sbjct: 564 DFFFVPWWLNLSQLFSIGLVSVVLIHAGIETVAMTTILDKSMKLWQSLETASPKNPPVML 623

Query: 575 KECLWCLKMLNHMSCLRLQTSMQNLRQIFGIDHGDSSLNKNRFAQFGKAGDNEEDNDVEL 634
            +CLWC++MLN M C+RL  S      I G   GD+S NKN+F+QFGK G+NE++ D+  
Sbjct: 624 PQCLWCIRMLNQMCCIRLSLSQSKFASIVGEHGGDNSHNKNKFSQFGKVGENEDETDIVE 683

Query: 635 --------------GQEDAHTKDV-------SVSATTSSPMLN-----PPTFETL--LQD 666
                             A   D+       ++S TT     N      P  E L    D
Sbjct: 684 PSLTSQKPTGYNLENNGSARLSDILIKDNEETLSYTTRDSSENIVSSLTPVGEQLSLDDD 743

Query: 667 DDLFANLQWFDQ 678
           DDLFANLQWFDQ
Sbjct: 744 DDLFANLQWFDQ 755

>YMR019W (STB4) [3983] chr13 (312155..315004) Sin3p-binding protein,
           contains a Zn[2]-Cys[6] fungal-type binuclear cluster
           domain in the N-terminal region [2850 bp, 949 aa]
          Length = 949

 Score =  552 bits (1423), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 300/665 (45%), Positives = 389/665 (58%), Gaps = 82/665 (12%)

Query: 94  IDSKXXXXXXXXXXNLVHFSSSLPSPWQTFSLDKYRFHRRYQNLLPYYLGQSLMQSLPPQ 153
           I+SK          N V  +    SPWQTFSLDKYRFHRRYQN+LPYYLG S+++ L PQ
Sbjct: 284 INSKENKIINSQITNTV--NDHFESPWQTFSLDKYRFHRRYQNILPYYLGVSILKDLSPQ 341

Query: 154 TIQHHNLKTPRVQNYGWNMSGGHYLKNGSD---------SSLDIINFDDPVQLDIVNKLL 204
           TI++  LK PRVQNYGWN+SGGHYLK   D               +FDDPV L ++NKLL
Sbjct: 342 TIEYAKLKRPRVQNYGWNLSGGHYLKYKGDFRSQEKNIRHESKFFDFDDPVHLSLINKLL 401

Query: 205 RFYFDHLNPVFSIVHEQVFLQQFNTGFL--NKRRNSS-KLFISMLYLILATSLRFYEGY- 260
           R+YFD +NPVFSI+HE  F QQ+N  FL   K+ NSS  LF SMLYLIL+T+LRF EG+ 
Sbjct: 402 RYYFDEINPVFSIIHEATFWQQYNNKFLRQGKQNNSSANLFTSMLYLILSTTLRFREGHL 461

Query: 261 -SQSQPVAFSQHQLDWLFKTNS------SLEERLFHFAHEIVSRLSFEWESFELIQSWLL 313
             Q     +S   L+  F+  S      S+EE LF +A+ I++ L+FEWESFELIQSWLL
Sbjct: 462 DGQKGQGTYSNTSLNITFEEKSILIKKPSIEENLFKYAYLIINTLTFEWESFELIQSWLL 521

Query: 314 IAFYLRTCHRQTSCWNALGSAIRMCKGMALYLNRFPQRHTLYEETKVKNCFWSCFIMDKV 373
           I FY RTC+RQT+CWNAL  A+ MC GM+LYLN+FP+ H+ Y+E+K  +CFW CFIMDK+
Sbjct: 522 ITFYFRTCYRQTACWNALSQAVNMCNGMSLYLNKFPEIHSTYDESKAWHCFWCCFIMDKL 581

Query: 374 ISFQMGRYPDLSLPAEQMPPPD---------RNPDGWFHEETIQMYRLSLIISDCQKRDG 424
           ISFQMGR+  LSLPA +M             +  D WFHEET QM  LS+I++   KRD 
Sbjct: 582 ISFQMGRFYQLSLPASEMCEQMNLVKSKKFLQEEDDWFHEETFQMLDLSIIVTQFLKRDA 641

Query: 425 EDLSVNEVQILKQRLTNWFRFFT----------PHETLYSKQVLFTYLDISLTLGIRGLF 474
           +DL++NE   L+ +L  W+  F            +   Y  Q   TYLDI LT  +R LF
Sbjct: 642 QDLNLNETVQLRSQLGQWYDTFIVGSQTNAYDDNYRYFYQVQPFMTYLDIRLTFEVRQLF 701

Query: 475 QLINPPVITDVTPPAXXXXXXXXXANSRTFLDSLETVEKSNELFIPWWLNLSLLFAVSVS 534
            LI P    +              ++ +  +++L  + +SN  F+PWWLNLS LF V++ 
Sbjct: 702 CLIAPSSTANNKSLEYVVDTELLISHCQMAIENLAEITRSNLFFVPWWLNLSQLFTVNLI 761

Query: 535 CITVLHAGLKLQQAQSLLRQSFSIWNSLVSLHAKNPPEMAKECLWCLKMLNHMSCLRLQT 594
           CI  LHAG+ + Q +++++    IW +L     KN P M  ECLWCLKMLNHM C+RL+ 
Sbjct: 762 CIIYLHAGIAVTQNKAIMQSCQEIWRTLECSKPKNRPSMLPECLWCLKMLNHMFCIRLRD 821

Query: 595 SMQNLRQIFGIDHGDSSLNKNRFAQFGKAGDNEEDNDVELG---------QEDAHTK--- 642
           S   L    G DHGD + N+N+F QF K GDN+ D +V+ G         QE+ H     
Sbjct: 822 SALQLEATLGTDHGDDTPNRNKFEQFKKVGDNDADVEVDAGEREENADERQENPHNNSKR 881

Query: 643 -------------DVSVSATTSSPMLNPPTFETL----------------LQDDDLFANL 673
                        D S++ +  S + N  T   L                + DDDLF+NL
Sbjct: 882 VPLATRSHNTTNFDGSIAISPESAVANLGTDTGLPSDVLDTVSKIGNSPNVFDDDLFSNL 941

Query: 674 QWFDQ 678
            WFDQ
Sbjct: 942 LWFDQ 946

 Score = 68.9 bits (167), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 29/49 (59%), Positives = 38/49 (77%), Gaps = 1/49 (2%)

Query: 13  GKDNGSKQRLRVRKACEICKKRKIKCDGHQPCTSCTKNSVQCVYKFTDT 61
            K+NG K RLRV+KACE+CKKRK+KCDG+ PC +C+K+  +C Y F  T
Sbjct: 73  SKENG-KGRLRVQKACELCKKRKVKCDGNNPCLNCSKHQKECRYDFKAT 120

>Kwal_26.8200
          Length = 652

 Score =  514 bits (1323), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 257/591 (43%), Positives = 370/591 (62%), Gaps = 44/591 (7%)

Query: 118 SPWQTFSLDKYRFHRRYQNLLPYYLGQSLMQSLPPQTIQHHNLKTPRVQNYGWNMSGGHY 177
           SPWQ +SL KYRFHRR+ NL+PYYLG++L  SLPP  ++ H L+ PR+Q YGWNMSGGHY
Sbjct: 81  SPWQRYSLGKYRFHRRHHNLVPYYLGKALSASLPPALVRKHALRAPRLQYYGWNMSGGHY 140

Query: 178 LKNGS------DSSLDIINFDDPVQLDIVNKLLRFYFDHLNPVFSIVHEQVFLQQFNTGF 231
           LK GS      D+     +F   +Q  IV KL  F+F H+N   SIVHEQVF QQF +G 
Sbjct: 141 LKLGSSATHFHDTRSWRWDFTQDLQRGIVEKLATFFFQHVNRFVSIVHEQVFWQQFRSGL 200

Query: 232 LNK--RRNSSKLFISMLYLILATSLRFYEGYS-----QSQPVAFSQHQLDWL-FKTNSSL 283
           LN   +   + LF ++L L++  +LRF +  +      ++    ++ ++ W+  + +  L
Sbjct: 201 LNPGPKLGPTDLFEAILNLMVVIALRFTDTGATGDDRAAKNTVLTKDEVTWIDAQHHPRL 260

Query: 284 EERLFHFAHEIVSRLSFEWESFELIQSWLLIAFYLRTCHRQTSCWNALGSAIRMCKGMAL 343
           E+ LF  A+ +V+ LSFEWESFELIQ+WLLI  YLRTCHRQ SCW AL  A++MC GM+L
Sbjct: 261 EDALFEHAYTVVAHLSFEWESFELIQAWLLITVYLRTCHRQVSCWQALSRAVQMCNGMSL 320

Query: 344 YLNRFPQRHTLYEETKVKNCFWSCFIMDKVISFQMGRYPDLSLPAEQMPPPDRNPDGWFH 403
           +L++FP+  T Y+E + +NC+W+ F++D+++SFQ GR+P+L++P  +M  PD  PD W  
Sbjct: 321 FLDKFPENSTAYDECRARNCYWTTFVLDRLVSFQTGRFPELAMPGPEMVSPDVAPDSWLS 380

Query: 404 EETIQMYRLSLIISDCQKRDGEDLSVNEVQILKQRLTNWFRFFTP---HETLYSKQVLFT 460
            E+I +Y+L+L+++ CQKR G+DL++ E   +  +L+ WF    P   +  L ++QV  T
Sbjct: 381 SESIALYKLALLMTRCQKRYGQDLTILETNDMTAQLSQWFHENAPSLDYNHLCARQVFLT 440

Query: 461 YLDISLTLGIRGLFQLIN-----PPVITDVTPPAXXXXXXXXXANSRTFLDSLETVEKSN 515
           YLD+ + L IRGL+QL++     PP +     P          +     L   E++ +  
Sbjct: 441 YLDVRIALEIRGLYQLLDLDGDIPPQVPTSAIPLNATSLIDLVSQ---ILGHFESIVEEG 497

Query: 516 ELFIPWWLNLSLLFAVSVSCITVLHAGLKLQQAQSLLRQSFSIWNSLVSLHAKNPPEMAK 575
           + F PWWLNLSLLF  S+ C+T++  GL+L +A+ LL +SF IW+ +      NPPEMA 
Sbjct: 498 KFFQPWWLNLSLLFTSSIICLTLIQGGLQLARARVLLEKSFKIWHYIEDARPPNPPEMAA 557

Query: 576 ECLWCLKMLNHMSCLRLQTSMQNLRQIFGIDHGDSSLNKNRFAQFGKAGDNEEDNDVELG 635
           ECLWCLKMLNHM C RL++  + L    G+DH D S+N N+F QFGK         VE G
Sbjct: 558 ECLWCLKMLNHMFCQRLKSCAKRLESSIGLDHVDDSVNDNKFRQFGK---------VERG 608

Query: 636 QEDAHTKDVSVSATTSSPMLNPPTFETLLQDDDLFANLQWFDQWVDDYSLQ 686
            +          A +S+P L+   F     +D+L A+LQWFDQW+D  +L+
Sbjct: 609 SD----------ANSSAPELDNSPFSQAHGEDNLLAHLQWFDQWLDVNNLE 649

>Kwal_23.6537
          Length = 552

 Score = 88.6 bits (218), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 92/387 (23%), Positives = 158/387 (40%), Gaps = 83/387 (21%)

Query: 13  GKDNGSKQRLRVRKACEICKKRKIKCDGHQPCTSCTKNSVQCVYKFTDTASPIS----KP 68
           G D    +RLRVRKAC  C++RK KCD   PC  CT     C Y   D   P+S    +P
Sbjct: 5   GADVPRNKRLRVRKACLPCRQRKRKCDSGFPCGMCTSYGYNCQYD--DVDGPLSFYEKRP 62

Query: 69  KPGRSLDKESIANALLQLESSLLAKIDSKXXXXXXXXXXNLVHFSSSLPSPWQTFSLDKY 128
            P +S    +I    ++  S L                       S   S    F   K 
Sbjct: 63  SPKQSTSPSTIQKKEVERPSML-----------------------SPCSSERGIFDPSKS 99

Query: 129 RFHRRYQNL-LPYYLGQSLMQSLPPQTIQHHNLKTPRVQNYGWNMSGGHYLKNGSDSSLD 187
           R+   +  +  P YLG  L QS+ P          P + ++ WN   G   +  S S  D
Sbjct: 100 RYMSLHSAVAFPRYLGLEL-QSVNP----------PHLHSFAWNC--GIRPEENSTSHPD 146

Query: 188 IINFDDPVQLDIVNKLLRFYFDHLNPVFSIVHEQVFLQQFNTGFLNKRRNSSKLFISMLY 247
           + N    +  D  N+    YF+ ++P+F I+    F Q  ++ +   R  S+  F +++ 
Sbjct: 147 LANI---ISKDDCNRFTDVYFEVVHPMFDIIDPSQFRQSLDSYWGGARNVSA--FDAVIG 201

Query: 248 LILATSLRFYEGYSQSQPVAFSQHQLDWLFKTNSSLEERLFHFAHEIVSRLSFEWE-SFE 306
            ++A    F   +  ++       +LD            +  +A +I+   +F  + S E
Sbjct: 202 GVVALGSFFSRNFGHAR-------ELD------------IVQYAKDILEDPTFSSQPSIE 242

Query: 307 LIQSWLLIAFYLRTCHRQTSCWNALGSAIRMCKGMALY--LNRF-----------PQRHT 353
            I +W+L + YLR   R    W A    + + +  AL+  +++            P+ ++
Sbjct: 243 QISAWVLRSIYLRATARPHVAWLASCMTMHLVEATALHHEVDKVELATRNDAPLPPRANS 302

Query: 354 LYEETKVKNCFWSCFIMDKVISFQMGR 380
           + E  + +  FW  + ++ +IS++ GR
Sbjct: 303 VCE--RARRLFWCAWCINTIISYEYGR 327

>Scas_720.58
          Length = 890

 Score = 64.7 bits (156), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 98/468 (20%), Positives = 186/468 (39%), Gaps = 109/468 (23%)

Query: 24  VRKACEICKKRKIKCDGHQP-CTSCTKNSVQCVYKFTDTASPISKPKPGRSLDK-ESIAN 81
           + +AC+ C+ +K+KC    P C+ C KN ++C+Y      SP+++    ++ +K E +  
Sbjct: 16  IEQACDNCRLKKLKCSKETPKCSKCLKNGMKCLYSPKVKRSPLTRVHLTQTENKLEKLER 75

Query: 82  ALLQL-----ESSLLAKIDSKXXXXX---XXXXXNLVHFSSSLPSPWQTFSLDKYRFHRR 133
             ++L       +L+  +DSK              +VH   S      T+++ K +    
Sbjct: 76  LFIELFPDENVENLIHVMDSKDVMKLRDLKLKMAQIVHSEESNQKSKSTYNVTKKK---- 131

Query: 134 YQNLLPYYLGQSLMQSLPPQT--IQHHNLKTPRVQNYGWN---------------MSG-- 174
              ++P    + +   +P +T  I  H+L    +  + WN               ++G  
Sbjct: 132 ---IIP---NEPIGNEIPMRTGYIHQHSLPKEPLYGFDWNEEDNESMTTVDGMCLLNGDL 185

Query: 175 ---GHYLKNGSDSSLDIINFDD------------PV-------QLDIVNKLLRFYFDHLN 212
              G++  +   S L  + FD             PV          + +K ++ YFD+ +
Sbjct: 186 DNKGYFGADSQISQLRSVGFDSNNFLSQITRRPAPVIDSYTMSSRTMTSKFIQSYFDNFH 245

Query: 213 PVFSIVHEQVFLQQFNTGFLNKRRNSSKLFISMLYLILATSLRFYEGYSQSQPVAFSQHQ 272
             + IV +  FL+ +N G      N  +++  +L ++LA      +G             
Sbjct: 246 IYYPIVKKDFFLRIYNNGNHLTGPNDKQVWQLLLNIVLAIGAWCVDG------------- 292

Query: 273 LDWLFKTNSSLEERLFHF--AHEIVSRLSFEWESFELIQSWLLIAFYLRTCHRQTSCWNA 330
                    + E  LF++  A   ++   FE  S  L+  + L++ Y +   +  S +  
Sbjct: 293 --------DATEIDLFYYQSAKSHLTGKLFESGSTRLVVCFFLLSKYAQWRQKSNSAYQY 344

Query: 331 LGSAIRMCKGMALYLNRFPQRHTLYEETKV---KNCFWSCFIMDKVISFQMGRYPDLSLP 387
           +G ++R+   + LY    P  +T+ ++  +   +  +WS F  D  IS   GR    SLP
Sbjct: 345 IGHSLRLATSLGLY-KELP--NTIQDKLAIEQRRRTWWSIFNQDFKISLLFGRPLQCSLP 401

Query: 388 AEQ----MPPPDRNPDGWFH-------------EETIQMYRLSLIISD 418
            E+    +P P    D  FH             +ETI M +L  +  D
Sbjct: 402 FEEITINLPTPIN--DDKFHFLTNANNTIPTIYDETIHMVKLYRLFYD 447

>Sklu_1993.2 YIL130W, Contig c1993 2139-4610 reverse complement
          Length = 823

 Score = 60.5 bits (145), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 82/393 (20%), Positives = 148/393 (37%), Gaps = 79/393 (20%)

Query: 20  QRLRVRKACEICKKRKIKCDGHQPCTSCTKNSVQCVY----KFTDTASP--ISKPKPGRS 73
           +R RV +AC+ C+K+K+KCDG QPC  CT  S +C Y    K   + +P  I+  KP ++
Sbjct: 7   KRRRVTRACDECRKKKVKCDGQQPCIHCTVYSYECTYNQPTKRGGSCAPQTITVRKPAKT 66

Query: 74  LDKESIANALLQLESSLLAKIDSKXXXXXXXXXXNLVHFSSSLPSPWQTFSLDKYRFHRR 133
                      QL++++     SK              F    P      SLD   F + 
Sbjct: 67  AK---------QLQATI-----SKYRTL----------FQEVFPGLPDIDSLDVQTFTQI 102

Query: 134 YQNLLPYYLGQSLMQSLPPQTIQHHNLKTPRVQNYGWNMSGGHYLK---------NGSDS 184
           Y N                    +H+LK   V  Y      G             + S +
Sbjct: 103 YHNF----------------NRDNHHLKD-TVTEYNLISHNGEAAATTVTTTSTPDVSSA 145

Query: 185 SLDIINFDDPVQLD-------------IVNKLLRFYFDHLNPVFSIVHEQVFLQQFNTGF 231
           +  I N D  +Q +             I  + ++  + H   +F   H   F++  +  +
Sbjct: 146 AEAIENVDGSIQSNEGREIKILLPPKHIALRFIKNTWQHCCVLFRFYHRPSFIKNLDQLY 205

Query: 232 LNKRRNSSKL---FISMLYLILATSLRFYEGYSQSQPVAFSQHQLDWLFKTNSSLEERLF 288
               +N +     F+ + Y ++A    F +    S  +A    Q D   K       + F
Sbjct: 206 ETDPQNYTDEQMNFLPLCYAVMAVGALFSKSMMDSNDIANEDSQPDQFLKDEGY---KYF 262

Query: 289 HFAHEIVSRLSFEWESFELIQSWLLIAFYLRTCHRQTSCWNALGSAIR--MCKGMALYLN 346
             A +++   +        IQ+ +++  +L+   R ++C+  +G A+R  + +G+   L 
Sbjct: 263 IAARKLIDITN--ARDLNSIQTIVMLFIFLQCSARLSTCYAYIGVAMRSALREGLHRNLT 320

Query: 347 RFPQRHTLYEETKVKNCFWSCFIMDKVISFQMG 379
                 T  E    K  F++ + MD  ++  +G
Sbjct: 321 MGAPGFTPIEIEMRKRLFFTIYKMDIYLNTMLG 353

>CAGL0F09229g complement(908186..910693) weakly similar to
          sp|P39961 Saccharomyces cerevisiae YER184c,
          hypothetical start
          Length = 835

 Score = 60.1 bits (144), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 33/56 (58%), Gaps = 7/56 (12%)

Query: 1  MDPSKYNDPSLYGKDNGSKQRLRVRKACEICKKRKIKCDGHQPCTSCTKNSVQCVY 56
          M P       L GKD       RV +AC++C+KRK+KCDG QPC+SC   S  C+Y
Sbjct: 1  MAPPLAKKAKLAGKD-------RVIRACDVCRKRKVKCDGDQPCSSCMTASTVCIY 49

>YIL130W (YIL130W) [2546] chr9 (102782..105676) Protein that
          contains a Zn[2]-Cys[6] fungal-type binuclear cluster
          domain in the N-terminal region, putative transcription
          factor [2895 bp, 964 aa]
          Length = 964

 Score = 58.9 bits (141), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 22/40 (55%), Positives = 29/40 (72%)

Query: 18 SKQRLRVRKACEICKKRKIKCDGHQPCTSCTKNSVQCVYK 57
          S +R RV +AC+ C+K+K+KCDG QPC  CT  S +C YK
Sbjct: 11 SVKRRRVTRACDECRKKKVKCDGQQPCIHCTVYSYECTYK 50

>Scas_662.8
          Length = 906

 Score = 58.5 bits (140), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 33/50 (66%)

Query: 7  NDPSLYGKDNGSKQRLRVRKACEICKKRKIKCDGHQPCTSCTKNSVQCVY 56
          N+PS    ++   +R RV +AC+ C+K+K+KCDG QPC  CT  S +C Y
Sbjct: 16 NEPSPRQTEHQIVKRRRVTRACDECRKKKVKCDGQQPCIHCTVYSYECTY 65

>YOR380W (RDR1) [5153] chr15 (1051286..1052926) Protein with
           similarity to transcription factors, has Zn[2]-Cys[6]
           fungal-type binuclear cluster domain in the N-terminal
           region [1641 bp, 546 aa]
          Length = 546

 Score = 56.2 bits (134), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 78/374 (20%), Positives = 139/374 (37%), Gaps = 66/374 (17%)

Query: 20  QRLRVRKACEICKKRKIKCDGHQPCTSCTKNSVQCVY--KFTDTASPISKPKPGRSLDKE 77
           +R RVRKAC  C++RK KC+G  PC  C      C Y      +ASP  +     S D E
Sbjct: 12  KRQRVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHYIDGRVPSASPQVQQVGETSPDTE 71

Query: 78  SIANALLQLESSLLAKIDSKXXXXXXXXXXNLVHFSSSLPSPWQTFSLDKYRFHRRYQNL 137
           S    L  +          +          N+   S ++  P       K R+  ++  +
Sbjct: 72  SRPFVLPGIH---------RNEQPQPINTQNVT--SQNIVDP------TKSRYTIQHSAV 114

Query: 138 -LPYYLGQSLMQSLPPQTIQHHNLKTPRVQNYGWNMSGGHYLKNGSDSSLDIINFDDPVQ 196
             P  LG  L  + P           PR+ ++ W+  G    +N +   L      D V 
Sbjct: 115 AFPRCLGLELRSTNP-----------PRLHSFAWH-CGIRPEENPNSHVL----LSDLVT 158

Query: 197 LDIVNKLLRFYFDHLNPVFSIVHEQVFLQQFNTGFLNKRRNSSKLFISMLYLILATSLRF 256
            +   ++ + YF  ++P+F +V+ +   +     +    +      +    + L +   F
Sbjct: 159 KEEYYRISKVYFSVVHPIFDVVNPEQLAKNVEKYWDGDVKTLEYGAVIAGVIALGS---F 215

Query: 257 YEGYSQSQPVAFSQHQLDWLFKTNSSLEERLFHFAHEIVSRLSFEWESFELIQSWLLIAF 316
           + G S   P      ++D +      L++  F       SR+     + E + +W+L   
Sbjct: 216 FMG-SLGHP-----REMDIVQYAKGILDDPTF-------SRIP----TVEQVSAWVLRTI 258

Query: 317 YLRTCHRQTSCWNALGSAIRMCKGMALY----------LNRFPQRHTLYEETKVKNCFWS 366
           YLR   R    W A    I + + + L+           N  P + T       +  FW 
Sbjct: 259 YLRATSRPHVAWLASCVTIHLSEAIGLHHEIDREDIAISNNVPPKRTTVVSEHTRRLFWC 318

Query: 367 CFIMDKVISFQMGR 380
            + ++ ++S+  GR
Sbjct: 319 AWSINTILSYDYGR 332

>Kwal_23.4754
          Length = 812

 Score = 56.2 bits (134), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 20/37 (54%), Positives = 27/37 (72%)

Query: 20 QRLRVRKACEICKKRKIKCDGHQPCTSCTKNSVQCVY 56
          +R RV +AC+ C+K+K+KCDG QPC  CT  S +C Y
Sbjct: 7  KRRRVTRACDECRKKKVKCDGQQPCIHCTVYSYECTY 43

>CAGL0F02519g 245120..247618 weakly similar to sp|P39529
          Saccharomyces cerevisiae YJL206c, hypothetical start
          Length = 832

 Score = 55.8 bits (133), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 19/35 (54%), Positives = 27/35 (77%)

Query: 23 RVRKACEICKKRKIKCDGHQPCTSCTKNSVQCVYK 57
          R+ +AC++CKKRK KC G  PC SC K ++QC+Y+
Sbjct: 31 RLSRACDLCKKRKTKCQGGNPCQSCRKANIQCIYR 65

>CAGL0G08844g complement(846590..849133) similar to sp|P40467
          Saccharomyces cerevisiae YIL130w, hypothetical start
          Length = 847

 Score = 55.1 bits (131), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 19/37 (51%), Positives = 28/37 (75%)

Query: 20 QRLRVRKACEICKKRKIKCDGHQPCTSCTKNSVQCVY 56
          +R +V +AC+ C+K+K+KCDG+QPC  CT  S +C Y
Sbjct: 12 KRRKVTRACDDCRKKKVKCDGNQPCIHCTVYSYECTY 48

>KLLA0F04609g complement(451579..454329) similar to sp|P40467
          Saccharomyces cerevisiae YIL130w, start by similarity
          Length = 916

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 19/37 (51%), Positives = 27/37 (72%)

Query: 20 QRLRVRKACEICKKRKIKCDGHQPCTSCTKNSVQCVY 56
          +R RV +AC+ C+K+K+KCDG QPC  CT  + +C Y
Sbjct: 6  KRRRVTRACDECRKKKVKCDGKQPCIHCTVYNYECTY 42

>CAGL0A00451g 47557..50880 similar to sp|P12383 Saccharomyces
          cerevisiae YGL013c PDR1 transcription factor,
          hypothetical start
          Length = 1107

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 23/73 (31%), Positives = 39/73 (53%)

Query: 1  MDPSKYNDPSLYGKDNGSKQRLRVRKACEICKKRKIKCDGHQPCTSCTKNSVQCVYKFTD 60
          ++ +  ++P        S +R +V KAC+ C++RKIKC+G +PC SCT    +C Y    
Sbjct: 4  LETTSKSNPGEVKAQKPSTRRTKVGKACDSCRRRKIKCNGLKPCPSCTIYGCECTYTDAK 63

Query: 61 TASPISKPKPGRS 73
          +   +     G+S
Sbjct: 64 STKNLKSNDAGKS 76

>KLLA0A09119g complement(797533..800781) weakly similar to sp|P12383
           Saccharomyces cerevisiae YGL013c PDR1 transcription
           factor, start by similarity
          Length = 1082

 Score = 53.1 bits (126), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 27/74 (36%), Positives = 38/74 (51%), Gaps = 2/74 (2%)

Query: 16  NGS-KQRLRVRKACEICKKRKIKCDGHQPCTSCTKNSVQCVYKFTDTASPISKPKPGRSL 74
           NG+ K R +V +AC+ C+K+KIKC G  PC SC     +CVY          K K  +S 
Sbjct: 42  NGTGKPRRKVSRACDSCRKKKIKCSGTLPCKSCETYGCECVYSHAPYGVAKGKKKTAKS- 100

Query: 75  DKESIANALLQLES 88
           D  +     L ++S
Sbjct: 101 DSSAFTKEKLSVQS 114

>KLLA0A02585g complement(226562..227674) some similarities with
          ca|CA5890|CaFCR1 Candida albicans Zinc cluster
          transcription factor, hypothetical start
          Length = 370

 Score = 52.0 bits (123), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 28/73 (38%), Positives = 42/73 (57%), Gaps = 4/73 (5%)

Query: 21 RLRVRKACEICKKRKIKCDGHQPCTSCTKNSVQCVYKFTDTASPISKPKPGRSLDKESIA 80
          + RV KAC+ C+K K KCDG +PC+ C K +  C Y  ++     SK K  +  ++E + 
Sbjct: 15 KRRVSKACDACRKSKTKCDGERPCSRCLKENKLCTYSNSNIGYAESKCK--KLYNQEYV- 71

Query: 81 NALLQLESSLLAK 93
            LL+  +SLL K
Sbjct: 72 -DLLETRNSLLTK 83

>Scas_702.7d
          Length = 978

 Score = 52.4 bits (124), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 23/56 (41%), Positives = 34/56 (60%), Gaps = 3/56 (5%)

Query: 16 NGSKQRLRVRKACEICKKRKIKCDGHQPCTSCTKNSVQCVYKFTDTASPI---SKP 68
          NG  ++LR  +AC  C++RKIKC G QPC +C      CV++  +  +P+   SKP
Sbjct: 6  NGKIKKLRSSRACSNCRRRKIKCSGIQPCPNCEIYGCLCVFEPVNGMTPMNFSSKP 61

>AER183C [2685] [Homologous to ScYOL089C (HAL9) - NSH]
           (975879..978518) [2640 bp, 879 aa]
          Length = 879

 Score = 52.4 bits (124), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 18/42 (42%), Positives = 29/42 (69%)

Query: 15  DNGSKQRLRVRKACEICKKRKIKCDGHQPCTSCTKNSVQCVY 56
           +  +  R RV KAC+IC+ +KI+C+G +PC +C K ++ C Y
Sbjct: 68  ETKTVMRKRVSKACDICRAKKIRCNGEEPCVNCEKFNLGCTY 109

 Score = 31.6 bits (70), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 19/74 (25%), Positives = 36/74 (48%), Gaps = 1/74 (1%)

Query: 308 IQSWLLIAFYLRTCHRQTSCWNALGSAIRMCKGMALYLNR-FPQRHTLYEETKVKNCFWS 366
           +Q+ +L++ YL       + +  L  AIR+ + + L+    +     + E  +  N +W 
Sbjct: 382 MQAIILLSVYLENSPVPQTTYLQLSFAIRLGQTLGLHQRESYMHIKDIAERNRRLNVWWW 441

Query: 367 CFIMDKVISFQMGR 380
           C+  DKV+S   GR
Sbjct: 442 CYRYDKVLSVCTGR 455

>Scas_518.5
          Length = 919

 Score = 52.4 bits (124), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 32/51 (62%), Gaps = 6/51 (11%)

Query: 12  YGKDNGSKQRLRVRKACEICKKRKIKCDG----HQPCTSCTKNSVQCVYKF 58
           YG+  G + + RV KAC+ C+KRK+KC         C +CTKN V+C +KF
Sbjct: 105 YGE--GKESKKRVLKACDYCRKRKVKCGDIIAQTGKCANCTKNDVECTFKF 153

>Scas_680.25
          Length = 738

 Score = 52.4 bits (124), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 46/198 (23%), Positives = 89/198 (44%), Gaps = 29/198 (14%)

Query: 194 PVQLDIVNKLLRFYFDHLNPVFSIVHEQVFLQQFNT--GFLNKRRNSSKLFISMLYLILA 251
           P+   ++++ +  YF H + +F ++ +  FL + +T   F N   +   +F+   Y+I+A
Sbjct: 285 PIDRSLLDRFIAAYFKHNHRLFPMIDKIAFLNEVSTMTKFENIETDHDPIFVFEFYMIMA 344

Query: 252 ---TSLRFYEGYSQSQPVAFSQHQLDWLFKTNSSLEERLFHFAHEIVSRLSFEWESFELI 308
              T+LR                +   L      L E L + A +  S +  E ++ E +
Sbjct: 345 IGCTTLR----------------RAGMLNMDEEDLSEHLSYLAMKNFSHV-MELQNIETL 387

Query: 309 QSWLLIAFYLRTCHRQTSCWNALGSAIRMCKGMALYLNRF--PQRHTLYEETKVK---NC 363
           +  LL+  Y     R +S W   G  +R+   + L LNR   P++  +    +V+     
Sbjct: 388 RCLLLLGIYSFFEPRGSSSWTISGIIMRLT--IFLGLNRVLTPKKMNMMSAVEVEARNRV 445

Query: 364 FWSCFIMDKVISFQMGRY 381
           FWS +  ++++S  +GRY
Sbjct: 446 FWSAYCFERLVSTCLGRY 463

>YGL013C (PDR1) [1960] chr7 complement(469095..472301) Zinc-finger
          transcription factor, in conjunction with Pdr3p
          regulates the expression of a network of genes involved
          in multiple drug resistance [3207 bp, 1068 aa]
          Length = 1068

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 25/69 (36%), Positives = 38/69 (55%), Gaps = 6/69 (8%)

Query: 19 KQRLRVRKACEICKKRKIKCDGHQPCTSCTKNSVQCVYKFTDTASPISKPKPGRSLDKES 78
          K R +V KAC+ C+KRKIKC+G  PC SC   S +C +      + I      ++L K S
Sbjct: 37 KPRSKVSKACDNCRKRKIKCNGKFPCASCEIYSCECTFSTRQGGARI------KNLHKTS 90

Query: 79 IANALLQLE 87
          +    +Q++
Sbjct: 91 LEGTTVQVK 99

>Kwal_47.17506
          Length = 924

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 20/45 (44%), Positives = 27/45 (60%)

Query: 19 KQRLRVRKACEICKKRKIKCDGHQPCTSCTKNSVQCVYKFTDTAS 63
          K+R +V +AC  C++RKIKC G QPC +C     +C Y     AS
Sbjct: 10 KKRSKVSRACNNCRRRKIKCTGAQPCLNCQTYRCECTYSIPSPAS 54

>KLLA0C10923g complement(939148..941475) similar to sp|P07272
           Saccharomyces cerevisiae YLR014c PPR1 transcription
           factor regulating pyrimidine pathway, hypothetical start
          Length = 775

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 31/112 (27%), Positives = 51/112 (45%), Gaps = 5/112 (4%)

Query: 280 NSSLEERLFHFAHEIV--SRLSFEWESFELIQSWLLIAFYLRTCHRQTSCWNALGSAIRM 337
           N+  + RLF F  +    S  + +    E +Q  LLIA Y          W  LGSAIR+
Sbjct: 337 NTGFDHRLFKFCADQYQDSLYTSKTNRLEALQGLLLIAVYSLMRPTVPGLWYTLGSAIRL 396

Query: 338 CKGMALYLNRFPQRHTLYEETKVKNCFWSCFIMDKVISFQMGR---YPDLSL 386
           C  + L+  +  + +  +     +  FW C+ MD+ +    GR    PD+++
Sbjct: 397 CVDLGLHAEKLNKNYEPFIRDVRRRLFWCCYSMDRQVCAYFGRPVSIPDVNV 448

 Score = 34.3 bits (77), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 15/34 (44%), Positives = 19/34 (55%), Gaps = 1/34 (2%)

Query: 23 RVRKACEICKKRKIKCDGHQP-CTSCTKNSVQCV 55
          R   AC+ C+ RKIKCD   P CT C +    C+
Sbjct: 15 RSVAACKRCRIRKIKCDNKFPSCTKCIQAQEPCI 48

>KLLA0C03201g complement(286973..288925) similar to sp|P39529
          Saccharomyces cerevisiae YJL206c, start by similarity
          Length = 650

 Score = 50.8 bits (120), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 18/36 (50%), Positives = 24/36 (66%)

Query: 21 RLRVRKACEICKKRKIKCDGHQPCTSCTKNSVQCVY 56
          R +V+ AC  CK+RK++CDG  PC SC    V+C Y
Sbjct: 29 RHKVKHACSSCKERKVRCDGQSPCASCINARVKCEY 64

 Score = 31.2 bits (69), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 35/178 (19%), Positives = 71/178 (39%), Gaps = 19/178 (10%)

Query: 203 LLRFYFDHLNPVFSIVHEQVF-LQQFNTGFLNKRRNSSKLFISMLYLILATSLRFYEGYS 261
           L RFY     P F  V E ++ ++ F      KR      F+ ++Y ++A    F + Y+
Sbjct: 173 LFRFYH---RPTFIKVVESLYTVKNFEYSEKQKR------FLPLVYSVIAVGALFCKSYA 223

Query: 262 QSQPVAFSQHQLDWLFKTNSSLEERLFHFAHEIVSRLSFEWESFELIQSWLLIAFYLRTC 321
           ++        Q+   F+     +E   +F            +  E +Q+  ++  +L+  
Sbjct: 224 ETT----DHKQMMEFFQ-----DEGHKYFIEAKCLLDPINSQDVESLQAIFMLTIFLQCS 274

Query: 322 HRQTSCWNALGSAIRMCKGMALYLNRFPQRHTLYEETKVKNCFWSCFIMDKVISFQMG 379
              +S +  +G A+R       +     Q   L E+  +K  FW+ +  D  ++  +G
Sbjct: 275 ANLSSGYTYIGIALRTAIKQNFHRKTSLQNLNLLEQETIKKLFWTIYKTDIYMNCILG 332

>KLLA0C19228g 1713787..1715562 similar to sp|P53749 Saccharomyces
          cerevisiae YNR063w singleton, hypothetical start
          Length = 591

 Score = 50.8 bits (120), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 24/48 (50%), Positives = 30/48 (62%), Gaps = 1/48 (2%)

Query: 27 ACEICKKRKIKCDGHQPCTSCTKNSVQCVYKFTDTASPISKPKPGRSL 74
          AC  CKKRK KCDG +PC  CTK +V+C+Y  TD      K K G ++
Sbjct: 2  ACLECKKRKQKCDGQKPCRRCTKLNVKCIYG-TDRRKDKRKIKDGSNM 48

>Kwal_26.7014
          Length = 654

 Score = 50.8 bits (120), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 85/415 (20%), Positives = 139/415 (33%), Gaps = 75/415 (18%)

Query: 23  RVRKACEICKKRKIKCDGHQPCTSCTKNSVQCVYKFTDTASPISKPKPGRSLD------- 75
           R R AC  C++R+ KC+   PC SC K  V C     D           +SL+       
Sbjct: 30  RKRLACSNCRRRRKKCNMEYPCASCVKLKVDCNVNMEDMRKKRYAASYVKSLEAHVAYLE 89

Query: 76  -----------------KESIANALLQLESSLLAKIDSKXXXXXXXXXXNLVHFSSSLPS 118
                            ++ +  +L + + +L A++ S           ++ H       
Sbjct: 90  MKLKKLVEKVTKNDDSTEDGVTMSLAKSKDNLEARLGSHVSVEASSGQSDVDHDERLSER 149

Query: 119 PWQTFSLDKYRFHRRYQNLL-----PYYLGQSLMQSLPPQTIQHHNLKTPRVQNYGWNMS 173
           P    + D  R  R  +  +       Y  Q    +LP Q  +  +LKT  +        
Sbjct: 150 PSGDMNNDILRKKRFVKGSIYPEGPASYKPQKRDTALPTQQQRIADLKTTVIV------- 202

Query: 174 GGHYLKNGSDSSLDIINFDDPVQLDIVNKLLRFYFDHLNPVFSIVHEQVFLQQFNTGFLN 233
                   S  S + +N D     DI+  L  FY       F  +H + FL  F     +
Sbjct: 203 ------RKSQGSSETLNTDQ----DILKSLSTFYVWLYPGHFIFMHRESFLYGFFNNSED 252

Query: 234 KRRNSSKLFISMLYLILATSLRFYEGYSQSQPVAFSQHQLDWLFKTNSSLEERLFHFAHE 293
              NS      +++ + A         SQ  PV                L +  +  A E
Sbjct: 253 NYDNSQYCSEELVFAVAAVG-------SQLDPVL-------------RPLSKGYYQKAKE 292

Query: 294 IVSRLSFEWESFELI---QSWLLIAFYLRTCHRQTSCWNALGSAIRMCKGMA------LY 344
            + ++ F+  S   I   Q+ L +AFY          W   G A+R+   M       ++
Sbjct: 293 KLLKIVFDEHSIAKITTVQALLCLAFYELGNGNNQLAWYFSGLAMRVGYDMGFQLDPKVW 352

Query: 345 LNRFPQRHTLYEETKVKNCFWSCFIMDKVISFQMGRYPDLSLPAEQMPPPDRNPD 399
           +       +  E       +W C+I D  I   +GR   LS+    +P  D  P+
Sbjct: 353 VTDSSSELSQSELEIRSRIYWGCYIADHFICLLLGRASTLSVSNSTVPESDELPE 407

>AER370W [2871] [Homologous to ScYIL130W (GIN1) - SH]
          complement(1320487..1322892) [2406 bp, 801 aa]
          Length = 801

 Score = 50.8 bits (120), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 18/37 (48%), Positives = 25/37 (67%)

Query: 20 QRLRVRKACEICKKRKIKCDGHQPCTSCTKNSVQCVY 56
          +R RV +AC+ C+K+K+KCD   PC  CT  S +C Y
Sbjct: 10 KRRRVTRACDECRKKKVKCDSRHPCIHCTVYSYECTY 46

>YGR288W (MAL13) [2233] chr7 (1070298..1071719) Maltose pathway
          regulatory protein, contains a Zn[2]-Cys[6] fungal-type
          binuclear cluster domain [1422 bp, 473 aa]
          Length = 473

 Score = 50.1 bits (118), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 26/33 (78%)

Query: 24 VRKACEICKKRKIKCDGHQPCTSCTKNSVQCVY 56
           ++AC+ C+ R++KCDG +PC+SC +NS+ C Y
Sbjct: 9  AKQACDCCRIRRVKCDGKRPCSSCLQNSLDCTY 41

>CAGL0L03377g complement(382932..386561) some similarities with
          sp|P46954 Saccharomyces cerevisiae YJL089w SIP4
          interacts with SNF1 protein kinase, hypothetical start
          Length = 1209

 Score = 50.8 bits (120), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 31/51 (60%)

Query: 5  KYNDPSLYGKDNGSKQRLRVRKACEICKKRKIKCDGHQPCTSCTKNSVQCV 55
          KY  P   G+   ++ + R  +AC+ C+ +KIKCDG QPC++C K    CV
Sbjct: 6  KYGKPQPPGELVLTRTKKRHSQACDRCRSKKIKCDGLQPCSNCAKIGYNCV 56

>Scas_638.14
          Length = 1043

 Score = 50.1 bits (118), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 18/34 (52%), Positives = 23/34 (67%)

Query: 23 RVRKACEICKKRKIKCDGHQPCTSCTKNSVQCVY 56
          +V KAC+ C+KRKIKC G QPC +C      C+Y
Sbjct: 43 KVSKACDNCRKRKIKCTGKQPCATCEAYQCPCIY 76

>CAGL0M11440g complement(1125748..1127475) similar to sp|P43634
           Saccharomyces cerevisiae YLR098c CHA4 transcription
           factor, hypothetical start
          Length = 575

 Score = 49.3 bits (116), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 51/205 (24%), Positives = 86/205 (41%), Gaps = 16/205 (7%)

Query: 202 KLLRFYFDHLNPV-FSIVHEQVFLQQFNTGFLNKRRNSSKLFISMLYLILATSLRFYEGY 260
           K L  +F  L P  F  +H + FL  F   F  K    S+    ++Y I A   +  +  
Sbjct: 142 KGLSLFFKWLYPGHFMFIHRETFLNSFFGDFNTKSYYCSE---ELVYAIFALGAQIAD-- 196

Query: 261 SQSQPVAFSQHQLDWLFKTNSSLEERLFHFAHEIVSRLSFEWESFELIQSWLLIAFYLRT 320
            +S  VA      ++  ++ S +  ++F   +E ++  S       +IQ+ L +AFY   
Sbjct: 197 -RSDDVA--NMGAEYYRRSKSMVLTKIFQL-NEDLNDESTSSSKLAIIQTLLCLAFYDIG 252

Query: 321 CHRQTSCWNALGSAIRMCKGMALYLNRFPQRHTLYEE-----TKVKN-CFWSCFIMDKVI 374
                  W   G A R+   + L+LN     H   +E      +V++  +W C+I D +I
Sbjct: 253 HGDNPMAWYLSGLAFRISYEIGLHLNPEAWAHVYEDELSGVDIEVRSRVYWGCYIADHLI 312

Query: 375 SFQMGRYPDLSLPAEQMPPPDRNPD 399
           +   GR   L L    +P  D  P+
Sbjct: 313 TLLFGRTTILKLSNSTVPETDELPE 337

>Sklu_2082.1 YER184C, Contig c2082 2025-2273
          Length = 82

 Score = 44.7 bits (104), Expect = 9e-06,   Method: Composition-based stats.
 Identities = 26/70 (37%), Positives = 35/70 (50%), Gaps = 4/70 (5%)

Query: 19 KQRLRVRKACEICKKRKIKCDGHQPCTSCTKNSVQCVYKFTDTASPISKPKPGRSLDKES 78
          +Q  +V KAC  C+KRKIKC G   C+SC     +C Y   D    +      RS  K S
Sbjct: 7  RQPYKVSKACNECRKRKIKCTGTFSCSSCVIYGSKCGY---DQDGAVRSRTTERSFYKNS 63

Query: 79 IANALLQLES 88
            N L+++ S
Sbjct: 64 REN-LMKIRS 72

>Scas_663.12
          Length = 944

 Score = 49.3 bits (116), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 23/67 (34%), Positives = 37/67 (55%), Gaps = 3/67 (4%)

Query: 1  MDPSKYNDPSLYGKDN--GSKQRLRVRKACEICKKRKIKCDGHQP-CTSCTKNSVQCVYK 57
          M P     PS    D+    K+R R+   C+ C++ K+KCD  +P C+ C+K+ ++CVY 
Sbjct: 11 MSPKGPQSPSKSINDSQVTKKKRYRLSFVCQGCRRSKVKCDQEKPVCSRCSKHDLECVYD 70

Query: 58 FTDTASP 64
           T   +P
Sbjct: 71 VTKQHAP 77

>CAGL0J07150g complement(686734..689802) similar to sp|P39720
          Saccharomyces cerevisiae YAL051w OAF1 peroxisome
          proliferating transcription factor or sp|P52960
          Saccharomyces cerevisiae YOR363c PIP2, hypothetical
          start
          Length = 1022

 Score = 49.3 bits (116), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 20/48 (41%), Positives = 30/48 (62%), Gaps = 1/48 (2%)

Query: 18 SKQRLRVRKACEICKKRKIKCDGHQP-CTSCTKNSVQCVYKFTDTASP 64
          SK+R R+   C+ C+K K KCD  +P C+ C K+ ++CVY  T   +P
Sbjct: 13 SKKRNRLSFVCQGCRKAKTKCDKEKPACSRCLKHGIRCVYDLTSQKAP 60

>Sklu_2434.10 YAL051W, Contig c2434 22765-25716
          Length = 983

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 30/52 (57%), Gaps = 1/52 (1%)

Query: 14 KDNGSKQRLRVRKACEICKKRKIKCDGHQP-CTSCTKNSVQCVYKFTDTASP 64
          +++ S +R R+   C+ C+K K KCD  +P CT C KN ++CVY       P
Sbjct: 14 QNSHSSKRNRISFVCKACRKSKTKCDREKPSCTRCIKNGIECVYDIEQQTQP 65

>Scas_556.6
          Length = 1022

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 30/57 (52%), Gaps = 1/57 (1%)

Query: 9  PSLYGKDNGSKQRLRVRKACEICKKRKIKCDGHQP-CTSCTKNSVQCVYKFTDTASP 64
          P+  G +   K+R R+   C+ C+K K KCD  +P CT C K ++ CVY       P
Sbjct: 27 PAAGGSNRQIKKRNRISFVCQECRKAKTKCDKEKPACTRCVKQNLACVYDVAKQPPP 83

>CAGL0L01903g 218703..222566 similar to sp|P32862 Saccharomyces
          cerevisiae YKL038w RGT1, hypothetical start
          Length = 1287

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 19/45 (42%), Positives = 30/45 (66%), Gaps = 3/45 (6%)

Query: 16 NGSKQRLRVRKACEICKKRKIKCDGHQP---CTSCTKNSVQCVYK 57
          N  K+R  V +AC+ C+++KIKCD +Q    CTSC +N  +C ++
Sbjct: 4  NNDKKRTNVSRACDQCRRKKIKCDRNQERNICTSCQRNGERCKFE 48

>CAGL0I07755g complement(745315..748476) similar to tr|Q12180
           Saccharomyces cerevisiae YOL089c HAL9, hypothetical
           start
          Length = 1053

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 32/62 (51%), Gaps = 4/62 (6%)

Query: 19  KQRLRVRKACEICKKRKIKCDGHQP----CTSCTKNSVQCVYKFTDTASPISKPKPGRSL 74
           K++ R  KACE C+KRK KCD   P    C++C+K  V C++    T         G  +
Sbjct: 169 KEKRRAAKACEYCRKRKTKCDEVSPYTNKCSNCSKAGVDCIFITEPTKKKRKSSSEGTKV 228

Query: 75  DK 76
           +K
Sbjct: 229 NK 230

>Kwal_26.7095
          Length = 838

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 24/55 (43%), Positives = 30/55 (54%), Gaps = 2/55 (3%)

Query: 19 KQRLRVRKACEICKKRKIKCDGHQP-CTSCTKNSVQCVYKFTDTASPISK-PKPG 71
          K R+R    C  CKKRKIKCD  +P C  C+K  ++CVY F +        P PG
Sbjct: 21 KSRMRQSFVCRNCKKRKIKCDKARPSCGRCSKLELECVYDFQENKDGRRGLPGPG 75

>ADR403C [2143] [Homologous to ScYAL051W (OAF1) - SH; ScYOR363C
          (PIP2) - SH] (1429118..1432030) [2913 bp, 970 aa]
          Length = 970

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 19/46 (41%), Positives = 28/46 (60%), Gaps = 1/46 (2%)

Query: 20 QRLRVRKACEICKKRKIKCDGHQP-CTSCTKNSVQCVYKFTDTASP 64
          +R R+   C+ C+K K KCD  +P C+ C KN+V+CVY      +P
Sbjct: 24 KRNRISFVCQACRKSKTKCDREKPRCSRCAKNNVKCVYDIEKQRAP 69

>ADR405C [2145] [Homologous to ScYAL051W (OAF1) - SH; ScYOR363C
          (PIP2) - SH] (1435705..1438128) [2424 bp, 807 aa]
          Length = 807

 Score = 47.8 bits (112), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 35/71 (49%), Gaps = 2/71 (2%)

Query: 4  SKYNDPSLYGKDNGSK-QRLRVRKACEICKKRKIKCDGHQP-CTSCTKNSVQCVYKFTDT 61
          S   D  + GK   +K +R ++   C+ C++ K KCD  +P CT C KN   CVY     
Sbjct: 14 SSRRDEGVSGKVTKTKGRRNKLSFVCQSCRRSKTKCDKVKPSCTRCVKNGSVCVYDVETQ 73

Query: 62 ASPISKPKPGR 72
            P S+ K  R
Sbjct: 74 TKPKSRSKDSR 84

>KLLA0A03443g 311628..314555 weakly similar to sp|P39720
          Saccharomyces cerevisiae YAL051w OAF1 peroxisome
          proliferating transcription factor, start by similarity
          Length = 975

 Score = 47.8 bits (112), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 24/69 (34%), Positives = 36/69 (52%), Gaps = 8/69 (11%)

Query: 16 NGSKQRLRVRKACEICKKRKIKCDGHQP-CTSCTKNSVQCVYKFTDTASPISKPKPGRSL 74
          NG+ +R R+   C+ C+K K KCD  +P C  C K  ++CVY        + + KP R  
Sbjct: 23 NGACKRQRISFVCQACRKNKTKCDREKPRCGRCVKYHLKCVYD-------VEQQKPPRVP 75

Query: 75 DKESIANAL 83
           K++I   L
Sbjct: 76 SKDAIIKRL 84

>Scas_702.7
          Length = 1113

 Score = 47.8 bits (112), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 25/38 (65%)

Query: 19 KQRLRVRKACEICKKRKIKCDGHQPCTSCTKNSVQCVY 56
          + R +V KAC  C++RKIKC G  PC++C     +C++
Sbjct: 28 RPRKKVSKACANCRRRKIKCTGTYPCSNCAAYQCECIF 65

>YER184C (YER184C) [1612] chr5 complement(556291..558675) Protein
          with similarity to transcription factors, has
          Zn[2]-Cys[6] fungal-type binuclear cluster domain in
          the N-terminal region [2385 bp, 794 aa]
          Length = 794

 Score = 47.8 bits (112), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 29/47 (61%)

Query: 11 LYGKDNGSKQRLRVRKACEICKKRKIKCDGHQPCTSCTKNSVQCVYK 57
          +  K   +KQ+ RV KAC+ C ++KIKC+  +PC  C  +  +C Y+
Sbjct: 1  MAAKRGLAKQKSRVTKACDRCHRKKIKCNSKKPCFGCIGSQSKCTYR 47

>CAGL0M12298g complement(1225753..1228737) similar to sp|P39720
           Saccharomyces cerevisiae YAL051w OAF1 peroxisome
           proliferating transcription factor or sp|P52960
           Saccharomyces cerevisiae YOR363c PIP2, hypothetical
           start
          Length = 994

 Score = 47.4 bits (111), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 26/92 (28%), Positives = 47/92 (51%), Gaps = 8/92 (8%)

Query: 13  GKDNGSKQRLRVRKACEICKKRKIKCDGHQP-CTSCTKNSVQCVYKFTDTASP------I 65
           G    +++R R+   C+ C++ K +CD  +P CT C K  ++CVY     ++P       
Sbjct: 12  GNAARTRKRNRISFVCQACRRSKTRCDKEKPICTRCKKLKLECVYDMAKQSAPRIPSKDA 71

Query: 66  SKPKPGRSLDK-ESIANALLQLESSLLAKIDS 96
           +  + GR +D  ++ A  L+Q + S+    DS
Sbjct: 72  TIARLGRDVDYWKNKAMKLMQEQESMPVNKDS 103

>YBR297W (MAL33) [474] chr2 (800479..801885) Maltose fermentation
          regulatory protein, has a Zn[2]-Cys[6] fungal-type
          binuclear cluster domain [1407 bp, 468 aa]
          Length = 468

 Score = 47.0 bits (110), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 27/83 (32%), Positives = 42/83 (50%), Gaps = 14/83 (16%)

Query: 24 VRKACEICKKRKIKCDGHQPCTSCTKNSVQCVYKFTDTASPI----SKPKPGRSLD---- 75
          V+ AC+ C+ R++KCDG +PC+ C +++  C Y+      P+    SKP   RSL     
Sbjct: 4  VKYACDYCRVRRVKCDGKKPCSRCIEHNFDCTYQ-----QPLKKRGSKPIGTRSLKYIPK 58

Query: 76 -KESIANALLQLESSLLAKIDSK 97
           K  I N      + +L K+  K
Sbjct: 59 AKMFIDNKSCTAAAEILMKVPKK 81

>Scas_637.7
          Length = 998

 Score = 47.4 bits (111), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 31/55 (56%), Gaps = 4/55 (7%)

Query: 7   NDPSLYGKDNGSKQRLRVRKACEICKKRKIKCDGHQP----CTSCTKNSVQCVYK 57
           N P ++     +  + RV KAC+ C+KRKIKCD   P    C++C K +  C +K
Sbjct: 85  NQPMVHKPTKITSGKKRVSKACDHCRKRKIKCDKVDPSTGKCSNCLKYNANCTFK 139

>Sklu_2335.6 YBL005W, Contig c2335 10191-13013
          Length = 940

 Score = 47.4 bits (111), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 33/59 (55%), Gaps = 3/59 (5%)

Query: 18 SKQRLRVRKACEICKKRKIKCDGHQPCTSCTKNSVQCVYKF--TDTASPISKPKPGRSL 74
          +K   +V +AC+ C++RKIKC G QPC++C      C Y     +   P + P P +SL
Sbjct: 18 TKSSSKVSRACDNCRRRKIKCTGKQPCSNCQAYQCHCEYSIRRGNGIIPATTP-PKKSL 75

>YLR098C (CHA4) [3513] chr12 complement(337528..339474) Zinc-finger
           protein required for transcriptional activation of CHA1,
           has a Zn[2]-Cys[6] fungal-type binuclear cluster domain
           [1947 bp, 648 aa]
          Length = 648

 Score = 47.0 bits (110), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 54/223 (24%), Positives = 89/223 (39%), Gaps = 41/223 (18%)

Query: 258 EGYSQSQPVAFSQHQLDWLFKTNSSLE-----ERLFHFAHEIVSRLSFEWE--------- 303
           + Y  S+ + F+   L  L    S  E     E  +  A  IV +  F+ E         
Sbjct: 245 KSYYCSEELVFAIAALGSLISYKSETELFQQSEVFYQRAKTIVLKKIFQLEDSSLAESSS 304

Query: 304 --SFELIQSWLLIAFYLRTCHRQTSCWNALGSAIRMCKGMALYLNRFPQRHTLYEETKVK 361
                +IQ+ L +AFY          W   G A R+   + L+LN     +   +E  + 
Sbjct: 305 SSKLAIIQTLLCLAFYDIGSGENPMAWYLSGLAFRIAHEIGLHLNPEAWSNVYEDELSIM 364

Query: 362 N------CFWSCFIMDKVISFQMGRYPDLSLPAEQMPPPDRNPDGWFHEETIQ--MYRLS 413
           +       +W C+I D +I+   GR   L L    +P  D  P+    E  I+  +Y   
Sbjct: 365 DFEVRSRIYWGCYIADHLIAILFGRSTSLRLSNSTVPETDELPE---IETGIEEYIYDPK 421

Query: 414 LIISDCQKRDGEDLSVNEVQ--ILKQRLTNWF--RFFTPHETL 452
           +I+S          + N ++  I+  R+T  F  + F+P+ETL
Sbjct: 422 VILS----------TANPLKKLIVLSRITEIFASKIFSPNETL 454

 Score = 36.2 bits (82), Expect = 0.084,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 30/52 (57%), Gaps = 1/52 (1%)

Query: 10 SLYGKDNGSKQRLRVRK-ACEICKKRKIKCDGHQPCTSCTKNSVQCVYKFTD 60
          S+   D  +    R RK AC+ C++R+ KC+  +PC++C K   +CV+   D
Sbjct: 25 SVTDNDQNNNNVPRKRKLACQNCRRRRRKCNMEKPCSNCIKFRTECVFTQQD 76

>KLLA0F09559g complement(876719..878695) some similarities with
           sgd|S0005698 Saccharomyces cerevisiae YOR172w,
           hypothetical start
          Length = 658

 Score = 47.0 bits (110), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 33/57 (57%), Gaps = 2/57 (3%)

Query: 2   DPSKYNDPSLYGKDNGSKQRLRVRKACEICKKRKIKCDGHQP-CTSCTKNSV-QCVY 56
           D   Y+D +    +   ++R +V K+C  C+KRK+KCD  +P CT C    + +CVY
Sbjct: 64  DEEHYSDKNASTSNGKVRKRRKVIKSCTFCRKRKLKCDRKRPMCTGCKMRGLSECVY 120

>YOR363C (PIP2) [5140] chr15 complement(1020218..1023208)
          Transcription factor required for induction of
          peroxisomal proteins in response to oleic acid [2991
          bp, 996 aa]
          Length = 996

 Score = 47.0 bits (110), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 32/60 (53%), Gaps = 1/60 (1%)

Query: 6  YNDPSLYGKDNGSKQRLRVRKACEICKKRKIKCDGHQP-CTSCTKNSVQCVYKFTDTASP 64
          + D S    +   K+R R+   C+ C+K K KCD  +P C  CTK ++ C+Y     A+P
Sbjct: 3  FTDESSPAMNRVGKKRNRLSFVCQACRKAKTKCDQEKPRCGRCTKQNLFCIYDVARQAAP 62

>KLLA0C14212g complement(1229219..1232341) some similarities with
           sp|P25611 Saccharomyces cerevisiae YCR106w, hypothetical
           start
          Length = 1040

 Score = 47.0 bits (110), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 28/52 (53%), Gaps = 4/52 (7%)

Query: 13  GKDNGSKQRL----RVRKACEICKKRKIKCDGHQPCTSCTKNSVQCVYKFTD 60
            K+N   +R+    RV   C  C++RK +CD   PC+ C   S +CVY  ++
Sbjct: 56  NKNNAGNKRVMKRNRVSYVCYACRRRKTRCDRGNPCSKCVALSTECVYSISE 107

>Kwal_8.580
          Length = 638

 Score = 46.6 bits (109), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 23/67 (34%), Positives = 35/67 (52%), Gaps = 2/67 (2%)

Query: 13 GKDNGSKQRLRVRKACEICKKRKIKCDGHQP-CTSC-TKNSVQCVYKFTDTASPISKPKP 70
          G    S++   V KAC+ C+ RK KC G  P C +C T  +++C Y   D     +K   
Sbjct: 2  GTKRASQRSPYVSKACDNCRLRKAKCSGDLPVCRNCSTAGTIKCTYSLADKRRKTNKDSK 61

Query: 71 GRSLDKE 77
           RSL+++
Sbjct: 62 ARSLERD 68

>YBL005W (PDR3) [189] chr2 (217435..220365) Zinc-finger
          transcription factor, in conjunction with Pdr1p
          regulates the expression of a network of genes involved
          in multiple drug resistance [2931 bp, 976 aa]
          Length = 976

 Score = 46.6 bits (109), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 18/36 (50%), Positives = 22/36 (61%)

Query: 21 RLRVRKACEICKKRKIKCDGHQPCTSCTKNSVQCVY 56
          R +V  AC  C+KRKIKC G  PCT+C      CV+
Sbjct: 8  RSKVSTACVNCRKRKIKCTGKYPCTNCISYDCTCVF 43

>Kwal_56.22605
          Length = 865

 Score = 46.6 bits (109), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 94/414 (22%), Positives = 153/414 (36%), Gaps = 62/414 (14%)

Query: 16  NGSKQRLRVRKACEICKKRKIKCDGHQP----CTSCTKNSVQCVYKFTDTASPISKPKPG 71
           +G K R RV KAC+ C+KRKIKC    P    C +C K +  C ++  D    IS+ +  
Sbjct: 17  SGGKFRKRVPKACDHCRKRKIKCGPVNPITGTCENCNKFNTSCTFRHHDE---ISRHRKF 73

Query: 72  RSLDKESIANALLQLESSLLAKIDSKXXXXXXXXXXNLVHFSSSLPSPWQTFSLDKYRFH 131
             L + S     ++  ++ L+   S            L      L S  Q    +   + 
Sbjct: 74  TDLKRASDNEPKVKKAAAELSPETSSMEQKLEKLESQLAGL-YELISRQQAVKSESLHYT 132

Query: 132 RRYQNLLPYYLGQSLMQSLPPQTIQHHNLKTP------RVQNYGWNMSGGHYLKNGSDS- 184
           R  +       G   M   P Q     +L T       R Q   + +SGG  L + S + 
Sbjct: 133 RSQRT-----SGTPDMSPAPKQKRYFTSLLTKRRVAWLRKQAETFRISGGVELGDESSNW 187

Query: 185 SL-------------------DIINFDDPV------QLDI------VNKLLRFYFDH-LN 212
           SL                    II+F +P       QL        V+ +L  Y D  L+
Sbjct: 188 SLCPLTDVFFIASRWYVAQIKKIIDFSNPFNPLNTPQLYAFPPEHQVDSILSVYRDRILD 247

Query: 213 PVFSIVHEQVFLQQFNTGFLNKRRNSSKLFISMLYLILATSLRFYEGYSQSQPVAFSQHQ 272
             FSIV  +      N  F N++ + S+L   +L +     + +    + S P   SQ  
Sbjct: 248 TGFSIVCGEEVQTLLNRYFSNEKLSHSELM--LLDMTFCIGICYSHLGTSSVPTETSQE- 304

Query: 273 LDWLFKTNSSLEERLFHFAHEIVSRLSFEWESFELIQSWLLIAFYLRTCHRQTSCWNALG 332
                   S+L   +   A     ++S   E    IQ+ L++   + +       +N   
Sbjct: 305 -------FSALGSHMLLNAMYQYHKVSLLSEGLRSIQALLMLFQQVNSKISNEVAYNIFC 357

Query: 333 SAIRMCKGMALYLNRFPQRHTLYEETKVKNCFWSCFIMDKVISFQMGRYPDLSL 386
            A R  + M L      Q  +  E +K    ++SC ++D  +S    R P +++
Sbjct: 358 IAQRFAQDMGLNRREAYQGLSFKEASKRLRIWYSCLMIDAQLSLVFCREPLINM 411

>CAGL0F07909g 776659..779808 some similarities with tr|Q12180
          Saccharomyces cerevisiae YOL089c HAL9 or sp|P38114
          Saccharomyces cerevisiae YBR150c TBS1, hypothetical
          start
          Length = 1049

 Score = 46.6 bits (109), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 19/42 (45%), Positives = 27/42 (64%), Gaps = 4/42 (9%)

Query: 21 RLRVRKACEICKKRKIKCDGHQP----CTSCTKNSVQCVYKF 58
          + R  KAC+ C+KRKI+CD   P    C++C K  V+C +KF
Sbjct: 34 KRRSTKACDHCRKRKIRCDEVNPVTNKCSNCVKFKVECTFKF 75

>Scas_234.1
          Length = 337

 Score = 45.8 bits (107), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 24/57 (42%), Positives = 34/57 (59%), Gaps = 4/57 (7%)

Query: 9  PSLYGKDNGSKQRLRVRKACEICKKRKIKCDGHQPCTSCTK--NSVQCVYKFTDTAS 63
          P+ Y   N SK+R R    C  CKKRK KCD  +PC++C +  +  +C+Y  +DT S
Sbjct: 15 PTEYNSQN-SKKRNRPTVVCTNCKKRKSKCDRGRPCSTCARLGDGDRCIY-VSDTGS 69

>Scas_669.8
          Length = 637

 Score = 46.2 bits (108), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 18/38 (47%), Positives = 26/38 (68%), Gaps = 1/38 (2%)

Query: 16 NGSKQRLRVRKACEICKKRKIKCDGHQPCTSCTKNSVQ 53
          NG ++R +   AC +CKKRK+KCD   PCTSC +  ++
Sbjct: 5  NGGERR-KTPYACNVCKKRKVKCDKLIPCTSCIQKGLE 41

>YJL206C (YJL206C) [2722] chr10 complement(47659..49935) Protein
          with weak similarity to Put3p and other transcription
          factors, has a Zn[2]-Cys[6] fungal-type binuclear
          cluster domain in the N-terminal region [2277 bp, 758
          aa]
          Length = 758

 Score = 45.8 bits (107), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 29/50 (58%), Gaps = 4/50 (8%)

Query: 11 LYGKDNGSKQ----RLRVRKACEICKKRKIKCDGHQPCTSCTKNSVQCVY 56
          +  +D G+ +    + R  +AC  C+KRK++C G+ PC  C  NS +C Y
Sbjct: 26 VLSRDAGTNELKPTKGRAHRACIACRKRKVRCSGNIPCRLCQTNSYECKY 75

>YKR064W (YKR064W) [3315] chr11 (562189..564780) Protein with
          similarity to transcription factors, has Zn[2]-Cys[6]
          fungal-type binuclear cluster domain in the N-terminal
          region [2592 bp, 863 aa]
          Length = 863

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 29/53 (54%), Gaps = 2/53 (3%)

Query: 18 SKQRLRVRKACEICKKRKIKCDGHQPCTSCTK--NSVQCVYKFTDTASPISKP 68
          +K+R R+   C  CKKRK KCD  +PC +C +  +   CVY    +  P S P
Sbjct: 9  TKKRHRITVVCTNCKKRKSKCDRTKPCGTCVRLGDVDSCVYLTDSSGQPESSP 61

>Sklu_2191.2 YKL222C, Contig c2191 6517-8673 reverse complement
          Length = 718

 Score = 45.4 bits (106), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 33/50 (66%), Gaps = 4/50 (8%)

Query: 19 KQRLRVRKACEICKKRKIKCDGHQP-CTSC-TKNSVQCVY--KFTDTASP 64
          ++R +V K+C  C+KRK+KCD  +P C++C  +N  +CVY  KFT    P
Sbjct: 10 RKRRKVIKSCLFCRKRKLKCDHKKPKCSTCAARNLPECVYVEKFTHEIDP 59

>YKL222C (YKL222C) [3053] chr11 complement(3504..5621) Protein
          with similarity to transcription factors, has
          Zn[2]-Cys[6] fungal-type binuclear cluster domain in
          the N-terminal region [2118 bp, 705 aa]
          Length = 705

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 27/74 (36%), Positives = 39/74 (52%), Gaps = 2/74 (2%)

Query: 19 KQRLRVRKACEICKKRKIKCDGHQP-CTSC-TKNSVQCVYKFTDTASPISKPKPGRSLDK 76
          + R +  K+C  C+ RK+KCD  +P C SC ++N  QC YK   +A      K  R   K
Sbjct: 15 QSRRKPAKSCHFCRVRKLKCDRVRPFCGSCSSRNRKQCEYKENTSAMEDQLRKKYRRCSK 74

Query: 77 ESIANALLQLESSL 90
            +A  + +LES L
Sbjct: 75 LEMARRIEELESQL 88

>Scas_564.9*
          Length = 609

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 29/99 (29%), Positives = 44/99 (44%), Gaps = 6/99 (6%)

Query: 307 LIQSWLLIAFYLRTCHRQTSCWNALGSAIRMCKGMALYLNRFPQRHTLYEE-----TKVK 361
           +IQ+ L +AFY          W   G A R+   + L+LN     H   +E     TKV+
Sbjct: 264 IIQTLLCLAFYDIGIGENPMAWYLSGLAFRIAHEIGLHLNPEAWSHVYEDELSVIDTKVR 323

Query: 362 N-CFWSCFIMDKVISFQMGRYPDLSLPAEQMPPPDRNPD 399
           +  +W  +I D +I+   GR   L L    +P  D  P+
Sbjct: 324 SRIYWGSYIADHLIAILFGRSTTLRLSNSTVPETDELPN 362

 Score = 36.6 bits (83), Expect = 0.081,   Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 20/38 (52%)

Query: 23 RVRKACEICKKRKIKCDGHQPCTSCTKNSVQCVYKFTD 60
          R+RK  +   K + KCD   PC +C K   +CVY   D
Sbjct: 6  RLRKILKKLAKIRRKCDTGSPCANCMKFETECVYTGHD 43

>YNR063W (YNR063W) [4646] chr14 (746940..748763) Protein with
          similarity to transcription factors, has Zn[2]-Cys[6]
          fungal-type binuclear cluster domain in the N-terminal
          region [1824 bp, 607 aa]
          Length = 607

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 18/45 (40%), Positives = 28/45 (62%), Gaps = 3/45 (6%)

Query: 15 DNGSKQRLR-VRKACEICKKRKIKCDGHQPCTSCTKNSV--QCVY 56
          D     R R +  AC +C+KRK+KCDG++PC  C + +   +C+Y
Sbjct: 2  DRSKDARKRSISLACTVCRKRKLKCDGNKPCGRCIRLNTPKECIY 46

>AGL361C [3951] [Homologous to NOHBY] (24101..26191) [2091 bp, 696
          aa]
          Length = 696

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 18/36 (50%), Positives = 23/36 (63%), Gaps = 1/36 (2%)

Query: 25 RKACEICKKRKIKCDGHQP-CTSCTKNSVQCVYKFT 59
          RK C  CKK  IKCD  QP CT+C K ++ C Y+ +
Sbjct: 58 RKGCSQCKKSHIKCDKVQPLCTTCAKKNILCTYELS 93

>YOL089C (HAL9) [4731] chr15 complement(150397..153489) Protein
           involved in salt tolerance, has similarity to
           transcription factors, contains a Zn[2]-Cys[6]
           fungal-type binuclear cluster domain in the N-terminal
           region [3093 bp, 1030 aa]
          Length = 1030

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 24/64 (37%), Positives = 36/64 (56%), Gaps = 8/64 (12%)

Query: 1   MDPSKYNDPSLYGKDNGSKQRLRVRKACEICKKRKIKCDG----HQPCTSCTKNSVQCVY 56
           M+ +  ND S  GK+     + RV KAC+ C+KRKI+CD      + C++C K  + C +
Sbjct: 113 MEHTNSNDMSGSGKN----LKKRVSKACDHCRKRKIRCDEVDQQTKKCSNCIKFQLPCTF 168

Query: 57  KFTD 60
           K  D
Sbjct: 169 KHRD 172

 Score = 34.7 bits (78), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 24/77 (31%), Positives = 38/77 (49%), Gaps = 4/77 (5%)

Query: 308 IQSWLLIAFYLRTCHRQTSCWNALGSAIRMCKGMALYLNRFPQRHTL-YEET-KVKNCFW 365
           +Q+ LL+  Y +  +        LG+AIR+   M L  NR     +L +EE  + +  +W
Sbjct: 473 LQALLLLNRYFQLTYDTELANCILGTAIRLAVDMEL--NRKSSYKSLDFEEAIRRRRMWW 530

Query: 366 SCFIMDKVISFQMGRYP 382
            CF  DK+ S  + R P
Sbjct: 531 HCFCTDKLYSLMLSRPP 547

>Scas_573.4
          Length = 1478

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 25/62 (40%), Positives = 33/62 (53%), Gaps = 8/62 (12%)

Query: 3  PSKYNDPSLYGKDNGS-----KQRLRVRKACEICKKRKIKCDGHQP-CTSCTKNSVQ--C 54
          P    D S +   NG+     ++R RV  +C IC+KRK+KCD  +P C  CTK  V   C
Sbjct: 13 PLSATDSSSHANANGTSTKVKRKRNRVPLSCTICRKRKVKCDKIRPHCQQCTKTGVAHLC 72

Query: 55 VY 56
           Y
Sbjct: 73 HY 74

>YLR256W (HAP1) [3650] chr12 (646417..650925) Transcription factor
          with heme-dependent DNA-binding activity, responsible
          for heme-dependent activation of many genes [4509 bp,
          1502 aa]
          Length = 1502

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 24/56 (42%), Positives = 32/56 (57%), Gaps = 6/56 (10%)

Query: 7  NDPSLYGKDNGSK---QRLRVRKACEICKKRKIKCDGHQP-CTSCTKNSVQ--CVY 56
          N P L+   + SK   +R R+  +C IC+KRK+KCD  +P C  CTK  V   C Y
Sbjct: 40 NSPPLHMSSDSSKIKRKRNRIPLSCTICRKRKVKCDKLRPHCQQCTKTGVAHLCHY 95

>Scas_542.8
          Length = 902

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 15/30 (50%), Positives = 20/30 (66%)

Query: 27 ACEICKKRKIKCDGHQPCTSCTKNSVQCVY 56
          AC +C+KR IKC G  PC  C K+ ++C Y
Sbjct: 28 ACILCRKRHIKCSGGNPCARCIKHDLKCEY 57

 Score = 35.4 bits (80), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 28/107 (26%), Positives = 52/107 (48%), Gaps = 12/107 (11%)

Query: 276 LFKTNSSLEERLFHFAH-EIVSRLSFEWESFELIQSWLLIAFYLRTCHRQTSCWNALGSA 334
           LFK  S +   LF   H E V++          I+  LL AFYL+      + +   G A
Sbjct: 398 LFKEASKIFNCLFSSEHLECVTKEGG-------IEVLLLYAFYLQVADCTVASYFYFGQA 450

Query: 335 IRMCKGMALYLNRFPQRHTL--YEETKVKNCFWSCFIMDKVISFQMG 379
           +R C  + ++++   QR TL  +E    +  +W+ ++ ++++S + G
Sbjct: 451 LRACLILGMHVD--AQRDTLTRFELEHHRRLWWTVYMFERMLSSKAG 495

>CAGL0L04400g complement(511762..514725) similar to tr|Q12340
          Saccharomyces cerevisiae YOR172w, hypothetical start
          Length = 987

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 18/40 (45%), Positives = 28/40 (70%), Gaps = 2/40 (5%)

Query: 19 KQRLRVRKACEICKKRKIKCDGHQP-CTSCTKNSVQ-CVY 56
          K+R +  K+C  C+KRK+KCD  +P C+SC + ++  CVY
Sbjct: 28 KKRFKPLKSCAFCRKRKLKCDKQKPRCSSCARRNLPVCVY 67

>YFL052W (YFL052W) [1632] chr6 (28232..29629) Protein with strong
          similarity to the MAL regulatory proteins Mal63p,
          Mal33p, and Mal23p, contains an N-terminal Zn[2]-Cys[6]
          fungal-type binuclear cluster domain [1398 bp, 465 aa]
          Length = 465

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 31/52 (59%), Gaps = 7/52 (13%)

Query: 23 RVRKACEICKKRKIKCDGHQPCTSCTKNSVQCVYKFTDTASPISK--PKPGR 72
          R R+AC+ C  R++KCD  +PC  C ++++QC Y       P+ K  PKP +
Sbjct: 3  RNRQACDCCCIRRVKCDRKKPCKCCLQHNLQCTY-----LRPLKKRGPKPVK 49

>CAGL0B03421g complement(336071..340138) similar to sp|P12351
          Saccharomyces cerevisiae YLR256w HAP1 transcription
          factor, hypothetical start
          Length = 1355

 Score = 44.3 bits (103), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 20/41 (48%), Positives = 26/41 (63%), Gaps = 3/41 (7%)

Query: 19 KQRLRVRKACEICKKRKIKCDGHQP-CTSCTKNSVQ--CVY 56
          K+R R+  +C IC+KRK+KCD  +P C  CTK  V   C Y
Sbjct: 14 KKRNRIPLSCTICRKRKVKCDKTRPHCNQCTKTGVAHLCHY 54

>YOR337W (TEA1) [5116] chr15 (954339..956618) Ty1 enhancer activator
           of the Gal4p-type family of DNA-binding proteins [2280
           bp, 759 aa]
          Length = 759

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 51/228 (22%), Positives = 82/228 (35%), Gaps = 28/228 (12%)

Query: 189 INFDDPVQLD----IVNKLLRFYFDHLNPVFSIVHEQVFLQQFNTGFLNKRRNSSKLFIS 244
           +N D+P  ++    I+  L  FY       F  VH + FL  F     N   +SS   + 
Sbjct: 311 LNDDNPNSINNDPRILKSLSNFYKWLYPGYFIFVHRESFLYGFFNHSKNNYEDSSYCSVE 370

Query: 245 MLYLILATSLRFYEGYSQSQPVAFSQHQLDWLFKTNSSLEERLFHFAHEIVSRLSFEWES 304
           ++Y + A   R      +   V + + +   L             F  +  +R++     
Sbjct: 371 LIYAMCAVGSRLTPDLQEYSEVYYQRSKKTLL----------QLVFDEQSTARIT----- 415

Query: 305 FELIQSWLLIAFYLRTCHRQTSCWNALGSAIRMCKGMAL-------YLNRFPQRHTLYEE 357
              +Q+   +AFY          W   G AIR+   M         Y++    + T  E 
Sbjct: 416 --TVQALFCLAFYELGKGNNQLGWYFSGLAIRVGYDMGFQLDPKVWYVDDNNLQLTQSEL 473

Query: 358 TKVKNCFWSCFIMDKVISFQMGRYPDLSLPAEQMPPPDRNPDGWFHEE 405
                 +W C+I D  I   +GR   LS+    MP  D  P+    EE
Sbjct: 474 EIRSRIYWGCYIADHFICLMLGRTSTLSVSNSTMPESDELPEVNGTEE 521

 Score = 35.4 bits (80), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 15/39 (38%), Positives = 22/39 (56%), Gaps = 2/39 (5%)

Query: 16 NGSKQRLRVRKACEICKKRKIKCDGHQPCTSCTKNSVQC 54
          NG   R R+  AC  C+ R+ KCD   PC +C++  + C
Sbjct: 60 NGGSTRKRL--ACTNCRNRRKKCDLGFPCGNCSRLELVC 96

>CAGL0F07865g complement(768270..770804) similar to tr|Q12151
          Saccharomyces cerevisiae YDR213w UPC2, start by
          similarity
          Length = 844

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 28/48 (58%), Gaps = 7/48 (14%)

Query: 23 RVRKACEICKKRKIKCDGHQP-CTSCTKNSVQCVYKFTDTASPISKPK 69
          + +  C+ CK+R++KCD  +P C  C K  ++CVY      +P+  PK
Sbjct: 49 KSKNGCDHCKRRRVKCDEGKPMCDKCVKMKLECVY------TPVQPPK 90

>KLLA0F02387g complement(213669..215852) similar to sp|P47988
           Saccharomyces cerevisiae YOR337w TEA1 TY1 enhancer
           activator, start by similarity
          Length = 727

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 50/214 (23%), Positives = 78/214 (36%), Gaps = 33/214 (15%)

Query: 199 IVNKLLRFYFDHLNPVFSIVHEQVFLQQFNTGFLNKRRNSSKLFISMLYLILATSLRFYE 258
           I+  L  FY       F  VH + FL  F         NS      ++Y + A   R   
Sbjct: 262 IIQSLSNFYKWLYPGNFIFVHRESFLYGFFNHTDETYDNSQHCSEELIYAVAAIGSR--- 318

Query: 259 GYSQSQPVAFSQHQLDWLFKTNSSLEERLFHFAHEIVSRLSFEWESFELI---QSWLLIA 315
                            L K    L E+ +  A   + ++ FE +S   I   Q+ L +A
Sbjct: 319 -----------------LSKDLHHLSEKYYQIAKTRLLKIVFEEQSIAKITTVQALLCLA 361

Query: 316 FYLRTCHRQTSCWNALGSAIRMCKGMALYLN--------RFPQRHTLYE-ETKVKN-CFW 365
           FY          W   G AIR+   M   L+           +   L + E ++++  +W
Sbjct: 362 FYELGNGENQLAWYFSGLAIRVGYDMGFQLDPKVWITDDSINENQDLSDSELEIRSRIYW 421

Query: 366 SCFIMDKVISFQMGRYPDLSLPAEQMPPPDRNPD 399
            C+I D  I   +GR P L++    +P  D  P+
Sbjct: 422 GCYIADHFICLILGRAPSLTVSNSTVPESDELPE 455

 Score = 33.9 bits (76), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 12/30 (40%), Positives = 17/30 (56%)

Query: 25 RKACEICKKRKIKCDGHQPCTSCTKNSVQC 54
          R AC  C++R+ KCD   PC  C +  + C
Sbjct: 38 RLACANCRRRRKKCDLEYPCGRCQELGLGC 67

>KLLA0E02618g 244696..248025 no similarity, hypothetical start
          Length = 1109

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 30/48 (62%), Gaps = 9/48 (18%)

Query: 18 SKQRLRVRKACEICKKRKIKCDGHQ---------PCTSCTKNSVQCVY 56
          S++R   ++AC  C++RKIKCDG            CT+C +++++CV+
Sbjct: 17 SRKRKVAKRACLACRERKIKCDGEANPDPSGGPGKCTNCVRSTLECVF 64

>KLLA0F25630g 2378464..2381487 some similarities with sp|P32862
           Saccharomyces cerevisiae YKL038w RGT1 regulator of
           glucose-induced genes, hypothetical start
          Length = 1007

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 20/48 (41%), Positives = 30/48 (62%), Gaps = 8/48 (16%)

Query: 18  SKQRLRVRKACEICKKRKIKCD---GH-----QPCTSCTKNSVQCVYK 57
           S++R +V +AC+ C+K+KIKCD   GH     Q CT C K   +C ++
Sbjct: 107 SRRRSKVSRACDQCRKKKIKCDFIEGHDINPDQSCTGCRKIGEKCSFE 154

>KLLA0F10835g 997512..999782 no similarity, hypothetical start
          Length = 756

 Score = 43.9 bits (102), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 32/57 (56%), Gaps = 2/57 (3%)

Query: 15 DNGSKQRLRV-RKACEICKKRKIKCDGHQP-CTSCTKNSVQCVYKFTDTASPISKPK 69
          ++G K++ R  RK C  CK+  +KCD  QP C  C K ++ C Y+ +     +S+ K
Sbjct: 10 NSGKKRKTRYSRKGCLQCKRSHLKCDEGQPKCGKCVKRNISCTYQLSLVFQDVSQSK 66

>YPR196W (YPR196W) [5609] chr16 (931370..932782) Positive
          regulator of the maltose pathway MAL genes, contains a
          Zn[2]-Cys[6] fungal-type binuclear cluster domain in
          the N-terminal region [1413 bp, 470 aa]
          Length = 470

 Score = 43.5 bits (101), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 36/59 (61%), Gaps = 6/59 (10%)

Query: 24 VRKACEICKKRKIKCDGHQPCTSCTKNSVQCVYKFTDTASPISKPKPGRSLDKESIANA 82
          VR++C+ C+ R++KCD ++PC  C + +++C Y       P+ K  P +S+ + ++  A
Sbjct: 4  VRQSCDCCRVRRVKCDRNRPCDRCRQRNLRCTY-----LQPLRKRGP-KSIGESNLERA 56

>KLLA0F02750g complement(250368..253814) some similarities with
          sgd|S0005449 Saccharomyces cerevisiae YOL089c HAL9
          transcriptional activator of ENA1, hypothetical start
          Length = 1148

 Score = 43.9 bits (102), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 18/40 (45%), Positives = 25/40 (62%), Gaps = 4/40 (10%)

Query: 23 RVRKACEICKKRKIKCDGHQP----CTSCTKNSVQCVYKF 58
          RV KAC+ C++RKIKCD   P    C++C K  V C + +
Sbjct: 29 RVSKACDRCRRRKIKCDDLDPVSGKCSNCIKYKVPCTFHY 68

>AFL200W [2995] [Homologous to ScYMR168C (CEP3) - SH]
          complement(60109..61899) [1791 bp, 596 aa]
          Length = 596

 Score = 43.5 bits (101), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 28/56 (50%), Gaps = 2/56 (3%)

Query: 18 SKQRLRVRKACEICKKRKIKCDGHQPCTSCTK--NSVQCVYKFTDTASPISKPKPG 71
          ++  +   K C +C KRK+KCD   PCT+C K   + +C    T     +  P PG
Sbjct: 2  ARSTIIASKPCAVCIKRKVKCDRLVPCTNCVKRGGAAECERADTIKRPRLGNPSPG 57

>AFR096W [3288] [Homologous to ScYJL089W (SIP4) - SH]
          complement(606993..609551) [2559 bp, 852 aa]
          Length = 852

 Score = 43.5 bits (101), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 18/33 (54%), Positives = 23/33 (69%), Gaps = 1/33 (3%)

Query: 23 RVRKACEICKKRKIKCDGHQP-CTSCTKNSVQC 54
          R  +AC+ C+ +KIKCDG +P CTSC K   QC
Sbjct: 24 RSSQACDRCRLKKIKCDGLRPSCTSCKKIGYQC 56

>CAGL0A00583g 65286..67226 weakly similar to sp|Q06149
          Saccharomyces cerevisiae YLR266c, hypothetical start
          Length = 646

 Score = 43.5 bits (101), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 18/42 (42%), Positives = 24/42 (57%), Gaps = 2/42 (4%)

Query: 21 RLRVRKACEICKKRKIKCDGHQPCTSCTKNSV--QCVYKFTD 60
          R RV K+C+ C   K+KC+   PC +C +     QCVY F D
Sbjct: 11 RRRVIKSCQYCYAHKLKCNRESPCLTCQQQGTQDQCVYNFQD 52

>Sklu_2064.2 , Contig c2064 873-3641
          Length = 922

 Score = 43.5 bits (101), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 36/76 (47%), Gaps = 4/76 (5%)

Query: 1  MDPSKYNDPSLYGKDNGSKQRLRVRKACEICKKRKIKCDGHQP-CTSCTKNSVQCVYKFT 59
          MDP K       GK    ++R R+   C  C++RKIKCD  +P C  C +  + CVY   
Sbjct: 1  MDPLKKPMEYSVGK---VQKRNRLSFVCLECRRRKIKCDKQRPCCIQCAEQGLTCVYDIE 57

Query: 60 DTASPISKPKPGRSLD 75
             +P    K   +++
Sbjct: 58 RQPAPRKSSKVSETIE 73

>YAL051W (OAF1) [17] chr1 (48565..51753) Transcription factor
           required for induction of SPS19 and POX1 on
           oleate-containing medium, plays a role in peroxisome
           proliferation [3189 bp, 1062 aa]
          Length = 1062

 Score = 43.5 bits (101), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 31/57 (54%), Gaps = 1/57 (1%)

Query: 9   PSLYGKDNGSKQRLRVRKACEICKKRKIKCDGHQP-CTSCTKNSVQCVYKFTDTASP 64
           P+    +  +++R R+   C+ C K K KCD  +P C  C K+ ++CVY  +   +P
Sbjct: 47  PAPENSETHNRKRNRILFVCQACWKSKTKCDREKPECGRCVKHGLKCVYDVSKQPAP 103

>AGL083W [4228] [Homologous to ScYKL038W (RGT1) - SH; ScYBR033W
          (EDS1) - NSH] complement(550291..552861) [2571 bp, 856
          aa]
          Length = 856

 Score = 43.1 bits (100), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 16/43 (37%), Positives = 29/43 (67%), Gaps = 3/43 (6%)

Query: 18 SKQRLRVRKACEICKKRKIKC---DGHQPCTSCTKNSVQCVYK 57
           ++R +V +AC+ C+++KIKC   +  Q C+ C KNS +C ++
Sbjct: 36 GRRRTKVSRACDQCRRKKIKCEYQEDAQSCSGCRKNSERCAFE 78

>AFR117C [3309] [Homologous to ScYLR256W (HAP1) - SH]
          (646832..650290) [3459 bp, 1152 aa]
          Length = 1152

 Score = 43.1 bits (100), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 18/35 (51%), Positives = 24/35 (68%), Gaps = 1/35 (2%)

Query: 19 KQRLRVRKACEICKKRKIKCDGHQP-CTSCTKNSV 52
          ++R RV  +C IC+KRK+KCD  +P C  CTK  V
Sbjct: 10 RKRNRVPLSCTICRKRKVKCDKTRPHCNQCTKTGV 44

>KLLA0E18194g 1613115..1615712 similar to sp|P25502 Saccharomyces
          cerevisiae YKL015w PUT3 positive activator of the
          proline utilisation pathway, start by similarity
          Length = 865

 Score = 43.1 bits (100), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 18/42 (42%), Positives = 24/42 (57%), Gaps = 1/42 (2%)

Query: 16 NGSKQRL-RVRKACEICKKRKIKCDGHQPCTSCTKNSVQCVY 56
          N  K+++ R   AC  C++R IKC G  PC+ C K  V C Y
Sbjct: 33 NDKKKKVKRSSLACTRCRRRHIKCPGGNPCSKCLKAGVACEY 74

 Score = 33.1 bits (74), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 16/72 (22%), Positives = 36/72 (50%)

Query: 308 IQSWLLIAFYLRTCHRQTSCWNALGSAIRMCKGMALYLNRFPQRHTLYEETKVKNCFWSC 367
           I+  LL AFYL+      + +   G A+R C  +  +++      T +E    +  +W+ 
Sbjct: 416 IEVMLLYAFYLQVADCTVASYFYFGQALRACLILGWHVDAQRDSLTRFELEHRRRIWWTV 475

Query: 368 FIMDKVISFQMG 379
           ++ ++++S + G
Sbjct: 476 YMFERMLSSKAG 487

>Kwal_56.23058
          Length = 775

 Score = 43.1 bits (100), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 23/68 (33%), Positives = 33/68 (48%), Gaps = 12/68 (17%)

Query: 13  GKDNGSKQRLRVRKACEICKKRKIKCDGHQP-CTSCTKNSVQCVY-----------KFTD 60
           G D  + +R   R  C  CK+R++KCD  +P C  C + + +CVY           K TD
Sbjct: 134 GADGKTVKRKYSRNGCTECKRRRMKCDEGKPTCWQCARLNRECVYVIRTKNRKRRPKSTD 193

Query: 61  TASPISKP 68
            +   SKP
Sbjct: 194 NSKDTSKP 201

>Kwal_55.21884
          Length = 882

 Score = 43.1 bits (100), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 23/54 (42%), Positives = 31/54 (57%), Gaps = 5/54 (9%)

Query: 7  NDPSLYGKDNGSKQRLRVRK-ACEICKKRKIKCDGH----QPCTSCTKNSVQCV 55
          +D SL      S +R R +K AC  C+++K KCD H    +PCT C K +V CV
Sbjct: 9  DDKSLNFDGIKSSRRGRRKKLACVECRQQKSKCDAHEKAPEPCTRCAKKNVACV 62

>Scas_625.5
          Length = 1141

 Score = 43.1 bits (100), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 15/42 (35%), Positives = 28/42 (66%), Gaps = 3/42 (7%)

Query: 19  KQRLRVRKACEICKKRKIKCDGHQP---CTSCTKNSVQCVYK 57
           K+R +  +AC+ C+K+KIKCD  +    C++C +N  +C ++
Sbjct: 66  KKRTKASRACDQCRKKKIKCDFSEEKTLCSNCQRNGEKCTFE 107

>Kwal_23.3122
          Length = 788

 Score = 42.7 bits (99), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 22/76 (28%), Positives = 37/76 (48%), Gaps = 9/76 (11%)

Query: 23  RVRKACEICKKRKIKCDGHQP-CTSCTKNSVQCVY--------KFTDTASPISKPKPGRS 73
           + +  C+ CK+R++KCD  +P C  C    ++CVY        K +  A P  +P  G  
Sbjct: 45  KSKNGCDNCKRRRVKCDEDKPSCQKCLNMKLECVYTPVTSRKRKSSSGAHPTQQPAAGAK 104

Query: 74  LDKESIANALLQLESS 89
            ++ S  +A  +  SS
Sbjct: 105 QEESSEVSATPRSSSS 120

>Kwal_26.6805
          Length = 944

 Score = 42.7 bits (99), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 33/60 (55%), Gaps = 2/60 (3%)

Query: 18 SKQRLRVRKACEICKKRKIKCDGHQP-CTSCTKNSVQCVYKFTDTASPISKPKPGRSLDK 76
          S +R R+   C+ C+K K KCD  +P C+ C K+ ++CVY   D  +P   P    ++ +
Sbjct: 19 SGRRNRLSFVCQSCRKGKTKCDRAKPSCSRCLKHGIRCVYD-VDRQTPPKTPNKDATIAR 77

>Kwal_23.6425
          Length = 735

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 18/42 (42%), Positives = 29/42 (69%), Gaps = 2/42 (4%)

Query: 17 GSKQRLRVRKACEICKKRKIKCDGHQP-CTSC-TKNSVQCVY 56
          GS++R +  K C  C+KRK+KCD ++P C +C ++   +CVY
Sbjct: 25 GSRKRRKSIKQCLFCRKRKLKCDKNRPVCGTCASRGLTECVY 66

>KLLA0D01452g 124018..128355 gi|3228691|gb|AAC23607.1 Kluyveromyces
           lactis Cat8p, start by similarity
          Length = 1445

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 19/48 (39%), Positives = 29/48 (60%), Gaps = 3/48 (6%)

Query: 23  RVRKACEICKKRKIKCDGHQP-CTSCTKNSVQCVYKFTDTASPISKPK 69
           RV +AC+ C+ +KI+CDG +P CT C     +C  K +D  S  + P+
Sbjct: 178 RVAQACDRCRAKKIRCDGKRPQCTQCAAVGFEC--KISDKLSRRAFPR 223

>Kwal_14.915
          Length = 822

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 30/57 (52%), Gaps = 4/57 (7%)

Query: 4  SKYNDPSLYGKDNGSKQRLRVRK----ACEICKKRKIKCDGHQPCTSCTKNSVQCVY 56
          S + +P+   ++ GSK   R  K    AC  C++R  KC G  PCT+C   ++ C Y
Sbjct: 21 SNFEEPASDMEEIGSKGVKRSIKRSGLACVRCRRRHAKCSGDNPCTTCRAANIACEY 77

 Score = 33.1 bits (74), Expect = 0.93,   Method: Compositional matrix adjust.
 Identities = 17/72 (23%), Positives = 36/72 (50%)

Query: 308 IQSWLLIAFYLRTCHRQTSCWNALGSAIRMCKGMALYLNRFPQRHTLYEETKVKNCFWSC 367
           I+  LL AFYL+      + +   G A+R C  M  +++      T +E    +  +W+ 
Sbjct: 371 IEVILLYAFYLQVADCTVASYFYFGQALRACLIMGWHVDAQRDILTRFELEHRRRLWWTV 430

Query: 368 FIMDKVISFQMG 379
           ++ ++++S + G
Sbjct: 431 YMFERMLSSKAG 442

>Sklu_2384.6 YKL015W, Contig c2384 10929-13424
          Length = 831

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 16/45 (35%), Positives = 25/45 (55%), Gaps = 3/45 (6%)

Query: 15 DNGSKQRLRVRK---ACEICKKRKIKCDGHQPCTSCTKNSVQCVY 56
          D G + R R ++   AC  C++R +KC G  PC+ C   ++ C Y
Sbjct: 32 DEGGQLRKRQKRSSMACVRCRRRHVKCPGGNPCSKCIAANIACEY 76

 Score = 38.1 bits (87), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 26/100 (26%), Positives = 49/100 (49%), Gaps = 14/100 (14%)

Query: 308 IQSWLLIAFYLRTCHRQTSCWNALGSAIRMCKGMALYLNRFPQRHTL--YEETKVKNCFW 365
           I+  LL AFYL+      + +   G A+R C  + L+++   QR TL  +E    +  +W
Sbjct: 382 IEVMLLYAFYLQVADCTVASYFYFGQALRACLILGLHVD--AQRDTLTRFELEHRRRLWW 439

Query: 366 SCFIMDKVISFQMG---RYPDLSLPAE-------QMPPPD 395
           + ++ ++++S + G    + D ++  E         PPPD
Sbjct: 440 TVYMFERMLSSKAGLPLSFTDNTITTELPDDFDMTNPPPD 479

>AGR061C [4371] [Homologous to ScYLR098C (CHA4) - SH]
          (831058..832896) [1839 bp, 612 aa]
          Length = 612

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 23/33 (69%)

Query: 23 RVRKACEICKKRKIKCDGHQPCTSCTKNSVQCV 55
          +++ AC+ C+KR+ KCD   PC +C K  V+C+
Sbjct: 9  KLKLACQTCRKRRRKCDLQVPCVNCQKFGVECL 41

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 43/208 (20%), Positives = 82/208 (39%), Gaps = 15/208 (7%)

Query: 199 IVNKLLRFYFDHLNPV-FSIVHEQVFLQQFNTGFLNKRRNSSKLFISMLYLILATSLRFY 257
           ++ + L  +F  L P  F+ +H + FL  F      K    S+    +++ I A   R  
Sbjct: 179 LILRSLSLFFKWLYPGPFTFIHRETFLSAFFGDAETKTYYCSE---ELVFAIAALGSRL- 234

Query: 258 EGYSQSQPVAFSQHQLDWLFKTNSSLEERLFHFAHEIVSRLSFEWESFELIQSWLLIAFY 317
              SQ     F++   ++   + + +  ++F       + +S       ++Q+ L +AFY
Sbjct: 235 ---SQKGSDLFAKTA-EYYNISKTKVLSKVFQLDSVPCTGMSSSSSKLAVVQTLLCLAFY 290

Query: 318 LRTCHRQTSCWNALGSAIRMCKGMALYLN------RFPQRHTLYEETKVKNCFWSCFIMD 371
                     W   G A R+   + L+LN       +  + +  +       +W C+I D
Sbjct: 291 DMGNGENPLAWYESGLAFRIAHEIGLHLNPEAWDDVYADKLSHLDIEVRSRIYWGCYIAD 350

Query: 372 KVISFQMGRYPDLSLPAEQMPPPDRNPD 399
            +I+   GR   L L    +P  D  P+
Sbjct: 351 HLIAVLFGRSYTLRLSNSTIPETDELPN 378

>KLLA0A04169g complement(376273..378600) similar to sgd|S0004218
          Saccharomyces cerevisiae YLR228c ECM22, start by
          similarity
          Length = 775

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 15/35 (42%), Positives = 24/35 (68%), Gaps = 1/35 (2%)

Query: 23 RVRKACEICKKRKIKCDGHQP-CTSCTKNSVQCVY 56
          + +  C+ CK+R++KCD  +P C +C K S+ CVY
Sbjct: 52 KSKNGCDHCKRRRVKCDETRPHCLNCKKMSLDCVY 86

>CAGL0K05841g 572315..576433 similar to sp|P12351 Saccharomyces
           cerevisiae YLR256w HAP1 transcription factor,
           hypothetical start
          Length = 1372

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 42/72 (58%), Gaps = 2/72 (2%)

Query: 21  RLRVRKACEICKKRKIKCDGHQP-CTSCTKNSVQCVYKFTDTA-SPISKPKPGRSLDKES 78
           R RV  +C IC++RK+KCD  +P CT C K  V  +  + + A +  ++ +  + ++ + 
Sbjct: 64  RNRVPLSCTICRRRKVKCDKSRPNCTQCVKTGVAHLCHYMEQAWAEEAEKEISKEMELKQ 123

Query: 79  IANALLQLESSL 90
           + + + QLE +L
Sbjct: 124 LRSKVKQLEETL 135

>YLR451W (LEU3) [3825] chr12 (1036089..1038749) Transcription
          factor regulating genes of branched chain amino acid
          biosynthesis pathways, acts as both a repressor and an
          inducer [2661 bp, 886 aa]
          Length = 886

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/47 (42%), Positives = 27/47 (57%), Gaps = 5/47 (10%)

Query: 16 NGSKQRLRVRK-ACEICKKRKIKCDGHQ----PCTSCTKNSVQCVYK 57
          N +    R RK AC  C+++K KCD H+    PCT C K +V C+ K
Sbjct: 24 NRTGMNARKRKFACVECRQQKSKCDAHERAPEPCTKCAKKNVPCILK 70

>ACL195C [854] [Homologous to NOHBY] (19204..19533) [330 bp, 109
          aa]
          Length = 109

 Score = 39.3 bits (90), Expect = 0.001,   Method: Composition-based stats.
 Identities = 24/65 (36%), Positives = 35/65 (53%), Gaps = 8/65 (12%)

Query: 26 KACEICKKRKIKCDGH----QPCTSCTKNSVQCVYKFTDTASPISKPKPGRSLDKESIAN 81
          ++C  C+K KIKCD      +PC+SC K  V C  ++     P  + K  RSL  E++A 
Sbjct: 29 RSCVRCRKNKIKCDSATRRPKPCSSCLKKGVGCELEYV---IPPQRSKELRSL-YENVAY 84

Query: 82 ALLQL 86
            L+L
Sbjct: 85 VRLKL 89

>Kwal_34.15751
          Length = 628

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 26/38 (68%), Gaps = 1/38 (2%)

Query: 20 QRLRVRKACEICKKRKIKCDGHQP-CTSCTKNSVQCVY 56
          ++ R+   C+ C+ RK+KC+  +P C+ C K+ +QCVY
Sbjct: 7  KKNRISHVCDACRIRKLKCNKQKPSCSRCVKHDLQCVY 44

>CAGL0H00396g complement(37005..39827) similar to sp|P08638
          Saccharomyces cerevisiae YLR451w LEU3 transcription
          factor, hypothetical start
          Length = 940

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 18/37 (48%), Positives = 22/37 (59%), Gaps = 4/37 (10%)

Query: 25 RKACEICKKRKIKCDGH----QPCTSCTKNSVQCVYK 57
          R AC  C+++K KCD H    +PCT C K  V CV K
Sbjct: 55 RVACVECRQQKSKCDAHDKAPEPCTRCQKKGVPCVLK 91

>Sklu_1622.2 YDR034C, Contig c1622 1522-3858
          Length = 778

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/67 (34%), Positives = 36/67 (53%), Gaps = 2/67 (2%)

Query: 20  QRLRVRKACEICKKRKIKCDGHQP-CTSCTKNSVQCVYKFTDTASPISKPKPGRSLDKES 78
           +R   R  C  CKKR++KCD  +P C  CT+ + +CVY   +  +   KP+ GR+    +
Sbjct: 156 KRKYSRNGCTECKKRRMKCDEGKPSCWQCTRLNRECVY-ILNPKNKKRKPRVGRNAGNST 214

Query: 79  IANALLQ 85
             +A  Q
Sbjct: 215 KHSAAKQ 221

>YPL248C (GAL4) [5202] chr16 complement(79711..82356)
          Transcription factor involved in expression of
          galactose-induced genes, phosphorylation correlates
          with activity [2646 bp, 881 aa]
          Length = 881

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 16/45 (35%), Positives = 28/45 (62%), Gaps = 1/45 (2%)

Query: 24 VRKACEICKKRKIKCDGHQP-CTSCTKNSVQCVYKFTDTASPISK 67
          + +AC+IC+ +K+KC   +P C  C KN+ +C Y      SP+++
Sbjct: 7  IEQACDICRLKKLKCSKEKPKCAKCLKNNWECRYSPKTKRSPLTR 51

>KLLA0C18953g 1682246..1684357 weakly similar to
          sp|P36598|Q9UTJ9|P40378 Schizosaccharomyces pombe
          Thiamine repressible genes regulatory protein THI1
          (Transcription factor NTF1), start by similarity
          Length = 703

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 17/37 (45%), Positives = 22/37 (59%), Gaps = 2/37 (5%)

Query: 23 RVRKACEICKKRKIKCDGHQPCTSCTK--NSVQCVYK 57
          + ++ACE CK+RK +C G  PC  C K  N   C YK
Sbjct: 13 KSKRACETCKRRKKRCSGGLPCEYCVKIGNPQGCEYK 49

 Score = 37.4 bits (85), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 25/111 (22%), Positives = 50/111 (45%), Gaps = 9/111 (8%)

Query: 307 LIQSWLLIAFYLRTCHRQTSCWNALGSAIRMCKGMALYLNRFPQRHTLYEETKVKNCFWS 366
           LIQ++L +A++  +  +    +  +G+AIR+   + +        H      K    FW 
Sbjct: 309 LIQAFLYVAYFGLSVDKSAFAYVMVGNAIRIAFTLGI--------HKTSATPKNNRIFWL 360

Query: 367 CFIMDKVISFQMGRYPDLSLPAEQMPPPDRNPDGWFHEETIQMYRLSLIIS 417
           CF+ D++++ + G +P L    E   P   + D  F   +++ Y     +S
Sbjct: 361 CFLYDRLLAIRFG-FPLLINEIEIEIPSCSSFDTDFLSISLEKYHFEAQVS 410

>KLLA0C17050g 1490472..1493339 some similarities with
          ca|CA3454|IPF10533.exon1 Candida albicans unknown
          function, exon 1, hypothetical start
          Length = 955

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 19/38 (50%), Positives = 24/38 (63%), Gaps = 1/38 (2%)

Query: 20 QRLRVRKACEICKKRKIKCDGHQP-CTSCTKNSVQCVY 56
          +R R   +C  C KRKIKCD  +P C SC KN  +C+Y
Sbjct: 38 KRQRQILSCVACHKRKIKCDRAKPVCESCGKNGWECLY 75

>Scas_630.14
          Length = 701

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 35/57 (61%), Gaps = 5/57 (8%)

Query: 16 NGSKQRLRVRKACEICKKRKIKCDGHQP-CTSCTKNSV-QCVY---KFTDTASPISK 67
          +G ++R RV K+C +C+ RK KCD  +P C+SC  + + +C Y     +D   P+S+
Sbjct: 14 DGIRKRNRVPKSCTVCRLRKSKCDRIKPYCSSCVLHGIKECRYDDRTISDKRVPVSE 70

>CAGL0D02904g complement(302952..305615) similar to sp|P07272
          Saccharomyces cerevisiae YLR014c PPR1 transcription
          factor regulating pyrimidine pathway, hypothetical
          start
          Length = 887

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 15/40 (37%), Positives = 26/40 (65%), Gaps = 1/40 (2%)

Query: 17 GSKQRLRVRKACEICKKRKIKCD-GHQPCTSCTKNSVQCV 55
          G  +  +   AC++C+++K+KCD G+  C  C +N+V CV
Sbjct: 14 GGVKFTKFPNACKLCRRKKVKCDQGYPSCKGCLRNNVPCV 53

 Score = 33.5 bits (75), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 25/124 (20%), Positives = 47/124 (37%), Gaps = 17/124 (13%)

Query: 282 SLEERLFHFAHEIVSRLSFEWESFELIQSWLLIAFYLRTCHRQTSCWNALGSAIRMCKGM 341
           + + R  +F  +I S      +  E +   LL+A Y          W  +GS +R+   +
Sbjct: 392 TFKRRATYFKKDIFSST----DRLEALMGTLLLAIYSIMRPNVPGVWYTMGSVLRLTVDL 447

Query: 342 ALYLNRFPQRHTLYEETKVKNCFWSCFIMDKVISFQMGR------------YPDLSLPAE 389
            L+  +    +  +     +  FW  + +D+ +    GR            YP L LP  
Sbjct: 448 GLHSEKINMTYDPFTREIRRRLFWCVYSLDRQVCSYFGRPFGIPEDTITTGYPSL-LPDS 506

Query: 390 QMPP 393
           ++ P
Sbjct: 507 EITP 510

>YLR228C (ECM22) [3628] chr12 complement(600021..602465) Sterol
          regulatory element binding protein involved in the
          regulation of sterol biosynthetic gene expression and
          may be involved in regulating sterol uptake [2445 bp,
          814 aa]
          Length = 814

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 30/57 (52%), Gaps = 10/57 (17%)

Query: 23 RVRKACEICKKRKIKCDGHQP-CTSCTKNSVQCVYKFTDTASPISKPKPGRSLDKES 78
          + +  C+ CK+R++KCD  +P C  CT   + CVY      SPI   +P R  D  S
Sbjct: 39 KSKTGCDNCKRRRVKCDEGKPFCKKCTNMKLDCVY------SPI---QPRRRKDSSS 86

>KLLA0D05038g 433653..435674 weakly similar to sp|P40971
          Saccharomyces cerevisiae YDR034c LYS14 transcriptional
          activator of lysine pathway genes singleton, start by
          similarity
          Length = 673

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 18/42 (42%), Positives = 26/42 (61%), Gaps = 1/42 (2%)

Query: 17 GSKQRLRVRKACEICKKRKIKCDGHQP-CTSCTKNSVQCVYK 57
            K+R   +  C  CK++K+KCD  +P C  CT  S++CVYK
Sbjct: 17 AKKKRKYSKNGCLECKRKKVKCDETKPMCWQCTHLSLECVYK 58

>KLLA0F22990g 2134385..2138146 similar to sp|P12351 Saccharomyces
          cerevisiae YLR256w HAP1 transcription factor singleton,
          hypothetical start
          Length = 1253

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 18/41 (43%), Positives = 24/41 (58%), Gaps = 1/41 (2%)

Query: 13 GKDNGSKQRLRVRKACEICKKRKIKCDGHQP-CTSCTKNSV 52
          G     ++R RV  +C IC+KRK+KCD  +P C  C K  V
Sbjct: 10 GTPQQKRKRNRVPLSCTICRKRKVKCDKGRPQCQQCVKTGV 50

>KLLA0A09251g 808253..810319 some similarities with sp|P38699
           Saccharomyces cerevisiae YHR178w STB5 SIN3 binding
           protein, hypothetical start
          Length = 688

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 45/230 (19%), Positives = 93/230 (40%), Gaps = 27/230 (11%)

Query: 195 VQLDIVNKLLRFYFDHLNPVFSIVHEQVFLQQFNT--GFLNKRRNSSKLFISMLYLILAT 252
           ++  + ++ +  +F H +  + ++++  FL + +T   F       S  F+  L++I+A 
Sbjct: 251 IERPLYDRFIAAFFKHNHKSYPLMNKIEFLNKVSTIRDFNKLPEEESNAFVFQLHMIMAI 310

Query: 253 SLRFYEGYSQSQPVAFSQHQLDWLFKTNSSLEERLFHFAHEIVSRLS--FEWESFELIQS 310
                 G +  Q       + + L +          HFA+  +         ++ E I+ 
Sbjct: 311 ------GCTTLQRAGMLTSEEEGLSE----------HFAYLAMKNFCPVMHLQNLETIKC 354

Query: 311 WLLIAFYLRTCHRQTSCWNALGSAIRMCKGMALYLNRFPQRHTLYEETKVK---NCFWSC 367
            LL+  Y     +  S W   G  +R+C G  L     P++        V+     FW+ 
Sbjct: 355 LLLLGIYSFFEPKGVSSWTISGLIMRLCIGFGLNRALTPKKLKTMSVIDVEMRYRAFWAF 414

Query: 368 FIMDKVISFQMGRYPDLSLPAEQMPPPDRNPDGWFHEETIQMYRLSLIIS 417
           +  +++++  +GR   LS     +PP    P   F EE   +   +++IS
Sbjct: 415 YSFERLVATSLGRISCLSDDDISVPP----PRALFEEEKDDIEVTNMMIS 460

>Kwal_23.3514
          Length = 579

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 14/31 (45%), Positives = 20/31 (64%)

Query: 23 RVRKACEICKKRKIKCDGHQPCTSCTKNSVQ 53
          + R  C +C KRK+KCD + PC++C K   Q
Sbjct: 7  KTRTPCVVCTKRKVKCDRNIPCSNCVKRGQQ 37

>Scas_449.1
          Length = 636

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 45/198 (22%), Positives = 72/198 (36%), Gaps = 24/198 (12%)

Query: 215 FSIVHEQVFLQQFNTGFLNKRRNSSKLFISMLYLILATSLRFYEGYSQSQPVAFSQHQLD 274
           F  VH + FL  F     N  ++S      ++Y + A   R          + +      
Sbjct: 215 FIFVHRESFLYGFFNHSENNYKDSHYCSEELIYAMCAVGSRLTPELQDMSEIYYE----- 269

Query: 275 WLFKTNSSLEERLFHFAHEIVSRLSFEWESFELIQSWLLIAFYLRTCHRQTSCWNALGSA 334
              K+ S+L E +F      V++++        +Q+ L +AFY          W   G A
Sbjct: 270 ---KSKSTLLELVFD--ENSVAKIT-------TVQALLCLAFYELGKGNNQLAWYFSGLA 317

Query: 335 IRMCKGMAL-------YLNRFPQRHTLYEETKVKNCFWSCFIMDKVISFQMGRYPDLSLP 387
           IR+   M         Y +    + T  E       +W C+I D  I   +GR   LS+ 
Sbjct: 318 IRVGYDMGFQLDPKVWYTDDTDVQLTASELKIRSRIYWGCYIADHFICLMLGRTSTLSVS 377

Query: 388 AEQMPPPDRNPDGWFHEE 405
              +P  D  P+    EE
Sbjct: 378 NSTIPESDELPEVDGTEE 395

 Score = 37.7 bits (86), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 28/57 (49%), Gaps = 5/57 (8%)

Query: 3  PSKYNDPSLYGKDNGSKQRL-----RVRKACEICKKRKIKCDGHQPCTSCTKNSVQC 54
          P+K     L G+D      L     R R AC  C++R+ KCD + PC +C +  + C
Sbjct: 7  PTKSKRELLEGEDGNELDILDDYPKRKRLACSNCRRRRKKCDLNFPCANCIRLGLNC 63

>AGL233C [4079] [Homologous to ScYKL222C - NSH; ScYOR172W - NSH]
          (260414..263032) [2619 bp, 872 aa]
          Length = 872

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 16/40 (40%), Positives = 27/40 (67%), Gaps = 2/40 (5%)

Query: 19 KQRLRVRKACEICKKRKIKCDGHQP-CTSCTKNSV-QCVY 56
          K R +V K+C  C+KR++KC+  +P C++C    + +CVY
Sbjct: 10 KTRRKVSKSCVFCRKRRVKCNKARPKCSTCIGKGLPECVY 49

>AGL091W [4220] [Homologous to ScYLR228C (ECM22) - SH; ScYDR213W
           (UPC2) - SH] complement(535317..537917) [2601 bp, 866
           aa]
          Length = 866

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 33/58 (56%), Gaps = 8/58 (13%)

Query: 23  RVRKACEICKKRKIKCDGHQP-CTSCTKNSVQCVYKFTDTASPISKPKPGRSLDKESI 79
           + +  C+ CK+R++KCD  +P C  C K  + CVY      +P +KP+  +  D E++
Sbjct: 84  KSKNGCDNCKRRRVKCDEGKPGCQKCLKMRLSCVY------TP-AKPRKKKDRDVETV 134

>YCR106W (RDS1) [627] chr3 (310954..313452) Protein with
          similarity to transcription factors, has Zn[2]-Cys[6]
          fungal-type binuclear cluster domain in the N-terminal
          region, involved in resistance to cycloheximide [2499
          bp, 832 aa]
          Length = 832

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 19/44 (43%), Positives = 29/44 (65%), Gaps = 1/44 (2%)

Query: 15 DNGSKQRLRVRKACEICKKRKIKCDGHQP-CTSCTKNSVQCVYK 57
          D+ + ++ R+R  C  CKK K KCD  +P C+ C +NS+QC Y+
Sbjct: 2  DSITVKKPRLRLVCLQCKKIKRKCDKLRPACSRCQQNSLQCEYE 45

>Sklu_2296.6 YJL089W, Contig c2296 12179-14938 reverse complement
          Length = 919

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 23/56 (41%), Positives = 31/56 (55%), Gaps = 2/56 (3%)

Query: 1  MDPSKYNDP-SLYGKDNGSKQRLRVRKACEICKKRKIKCDGHQP-CTSCTKNSVQC 54
          M+  KY  P S  G      ++ R  +AC+ C+ +KIKCDG +P CTSC K    C
Sbjct: 1  MNKRKYGTPTSPKGHPLLLSRQERSSQACDRCRLKKIKCDGLKPNCTSCKKVGFHC 56

>Kwal_14.778
          Length = 665

 Score = 40.8 bits (94), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 23/81 (28%), Positives = 38/81 (46%), Gaps = 9/81 (11%)

Query: 300 FEWE-SFELIQSWLLIAFYLRTCHRQTSCWNALGSAIRMCKGMALYLNRFPQRHTLYEET 358
           +EW  S  L+QS L +A++  + +R T  +   G AIR    + L        H      
Sbjct: 262 YEWATSVSLVQSLLYMAYFALSLNRTTFAFVITGDAIRTMFTLGL--------HKSTSSV 313

Query: 359 KVKNCFWSCFIMDKVISFQMG 379
           +    FW CFI D++++ + G
Sbjct: 314 RGNRVFWLCFIYDRLLAVRFG 334

 Score = 32.7 bits (73), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 13/24 (54%), Positives = 14/24 (58%)

Query: 26 KACEICKKRKIKCDGHQPCTSCTK 49
          KAC  CK+RK KC    PC  C K
Sbjct: 3  KACTKCKQRKKKCSKTLPCEYCLK 26

>Scas_699.7
          Length = 935

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 15/43 (34%), Positives = 27/43 (62%), Gaps = 1/43 (2%)

Query: 26 KACEICKKRKIKCDGHQP-CTSCTKNSVQCVYKFTDTASPISK 67
          +AC++C+ +K+KC   +P C  C KN+ +C Y      SP+++
Sbjct: 11 QACDLCRVKKLKCSKEKPKCAKCLKNNWECCYSPKTRRSPLTR 53

>YOR162C (YRR1) [4961] chr15 complement(639560..641992)
          Transcription factor involved in drug-induced
          transcriptional regulation, including activation of
          multidrug transporter gene SNQ2, has a Zn[2]-Cys[6]
          fungal-type binuclear cluster domain [2433 bp, 810 aa]
          Length = 810

 Score = 40.8 bits (94), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 36/68 (52%), Gaps = 12/68 (17%)

Query: 1  MDPSKYNDPSLYGKDNGS----------KQRLRVRKACEICKKRKIKCDGHQP-CTSC-T 48
          + P   N  S  G  NGS          K+R ++ K+C  C++RK++CD  +P C++C +
Sbjct: 17 VTPPSDNSNSTAGGANGSNSGTPTSTSGKKRNKLIKSCGFCRRRKLRCDQQKPMCSTCIS 76

Query: 49 KNSVQCVY 56
          +N   C Y
Sbjct: 77 RNLTTCQY 84

>YBR150C (TBS1) [335] chr2 complement(541165..544449) Protein with
           similarity to transcription factors, contains an
           N-terminal Zn[2]-Cys[6] fungal-type binuclear cluster
           domain [3285 bp, 1094 aa]
          Length = 1094

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 17/40 (42%), Positives = 24/40 (60%), Gaps = 4/40 (10%)

Query: 23  RVRKACEICKKRKIKCDGHQP----CTSCTKNSVQCVYKF 58
           RV KAC+ C+KRKI+C   +P    C +C K +  C + F
Sbjct: 102 RVTKACDYCRKRKIRCTEIEPISGKCRNCIKYNKDCTFHF 141

>Sklu_2297.5 YLR098C, Contig c2297 8133-9497
          Length = 454

 Score = 40.4 bits (93), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 27/98 (27%), Positives = 42/98 (42%), Gaps = 6/98 (6%)

Query: 308 IQSWLLIAFYLRTCHRQTSCWNALGSAIRMCKGMALYLNRFPQRHTLYEE-----TKVKN 362
           IQ+ L +AFY          W   G A R+   + L+LN     +   ++      +V++
Sbjct: 124 IQTLLCLAFYDIGNGENPLAWYLSGLAFRIAHEIGLHLNPKAWNNVYADDLSHVDIEVRS 183

Query: 363 -CFWSCFIMDKVISFQMGRYPDLSLPAEQMPPPDRNPD 399
             +W C+I D +I    GR   L L    +P  D  PD
Sbjct: 184 RIYWGCYIADHLICVLFGRSTSLRLSNSTIPETDELPD 221

>KLLA0F19602g complement(1814949..1816760) similar to sp|P43634
          Saccharomyces cerevisiae YLR098c CHA4 transcription
          factor, start by similarity
          Length = 603

 Score = 40.8 bits (94), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 12/38 (31%), Positives = 25/38 (65%)

Query: 18 SKQRLRVRKACEICKKRKIKCDGHQPCTSCTKNSVQCV 55
           K++ +   AC+ C+ ++ KCD  +PC++C K  ++C+
Sbjct: 7  GKRKRKAHLACQNCRIKRRKCDMERPCSNCLKYGIECI 44

 Score = 40.4 bits (93), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 28/101 (27%), Positives = 47/101 (46%), Gaps = 10/101 (9%)

Query: 307 LIQSWLLIAFYLRTCHRQTSCWNALGSAIRMCKGMALYLNRFPQR-HTLYEE------TK 359
           +IQ+ L +AFY          W   G A RM   + L+LN  P+    +Y++       +
Sbjct: 261 IIQTLLCLAFYDIGNGENPLAWYESGLAFRMAHEIGLHLN--PEAWDDVYDDKLSQIDIE 318

Query: 360 VKN-CFWSCFIMDKVISFQMGRYPDLSLPAEQMPPPDRNPD 399
           V++  +W C+I D +I+   GR   L +    +P  D  P+
Sbjct: 319 VRSRIYWGCYIADHLIAVLFGRSNSLRVSNSTIPETDELPN 359

>Scas_679.26
          Length = 775

 Score = 40.8 bits (94), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 29/52 (55%), Gaps = 10/52 (19%)

Query: 23 RVRKACEICKKRKIKCDGHQP-CTSCTKNSVQCVYKFTDTASPISKPKPGRS 73
          + +  C+ CK+R++KCD  +P C  C   +++CVY         S PKP ++
Sbjct: 53 KSKNGCDNCKRRRVKCDELKPTCQKCINMNLECVY---------SMPKPRKA 95

>KLLA0D10153g 858016..859983 weakly similar to sp|P35995
          Saccharomyces cerevisiae YKL222c, hypothetical start
          Length = 655

 Score = 40.4 bits (93), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 15/39 (38%), Positives = 25/39 (64%), Gaps = 1/39 (2%)

Query: 19 KQRLRVRKACEICKKRKIKCDGHQP-CTSCTKNSVQCVY 56
          K R +  ++C +C++RK KCD   P C++C K   +C+Y
Sbjct: 3  KSRNKPTRSCLMCQRRKKKCDRKAPSCSACLKKGYECIY 41

>YKL015W (PUT3) [3241] chr11 (408187..411126) Transcription factor
          that activates the proline utilization pathway genes,
          contains a Zn[2]-Cys[6] fungal-type binuclear cluster
          domain in the N-terminal region [2940 bp, 979 aa]
          Length = 979

 Score = 40.4 bits (93), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 21/38 (55%)

Query: 19 KQRLRVRKACEICKKRKIKCDGHQPCTSCTKNSVQCVY 56
          K++ R   AC  C+KR IKC G  PC  C  ++  C Y
Sbjct: 25 KRQQRSSVACLSCRKRHIKCPGGNPCQKCVTSNAICEY 62

 Score = 37.4 bits (85), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 23/115 (20%), Positives = 56/115 (48%), Gaps = 5/115 (4%)

Query: 308 IQSWLLIAFYLRTCHRQTSCWNALGSAIRMCKGMALYLNRFPQRHTLYEETKVKNCFWSC 367
           I+  LL AF+L+      + +   G A+R C  + L+++      + YE    +  +W+ 
Sbjct: 461 IEVLLLYAFFLQVADYTLASYFYFGQALRTCLILGLHVDSQSDTLSRYEIEHHRRLWWTV 520

Query: 368 FIMDKVISFQMG---RYPDLSLPAEQMPPPDRNPDGWFHEETIQMYRLSLIISDC 419
           ++ ++++S + G    + D ++      P D + +    + +  ++R + +IS+C
Sbjct: 521 YMFERMLSSKAGLPLSFTDYTISTAL--PADIDDETIEEKNSHYVFRKAELISNC 573

>KLLA0D00484g 44879..47893 no similarity, hypothetical start
          Length = 1004

 Score = 40.4 bits (93), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 16/34 (47%), Positives = 20/34 (58%), Gaps = 1/34 (2%)

Query: 25  RKACEICKKRKIKCDGHQP-CTSCTKNSVQCVYK 57
           RK C  CKK   KCD  +P C+ C K S+ C Y+
Sbjct: 68  RKGCLQCKKAHTKCDERKPKCSRCEKRSIDCTYR 101

>ACR028C [1076] [Homologous to NOHBY] (408701..410506) [1806 bp,
          601 aa]
          Length = 601

 Score = 40.4 bits (93), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 17/36 (47%), Positives = 21/36 (58%), Gaps = 1/36 (2%)

Query: 25 RKACEICKKRKIKCDGHQP-CTSCTKNSVQCVYKFT 59
          RK C  CKK   KCD  +P C  C K +V+C YK +
Sbjct: 18 RKGCLQCKKSHTKCDETKPACLKCVKRNVECTYKVS 53

>YKL038W (RGT1) [3220] chr11 (365248..368760) Protein involved in
          regulation of glucose transporters, acts as a
          transcriptional repressor that is converted to an
          activator upon glucose-induced phosphorylation [3513
          bp, 1170 aa]
          Length = 1170

 Score = 40.4 bits (93), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 15/41 (36%), Positives = 26/41 (63%), Gaps = 3/41 (7%)

Query: 19 KQRLRVRKACEICKKRKIKCDGHQP---CTSCTKNSVQCVY 56
          K+R +  +AC+ C+K+KIKCD       C++C +N  +C +
Sbjct: 38 KKRTKASRACDQCRKKKIKCDYKDEKGVCSNCQRNGDRCSF 78

>CAGL0E05434g 532577..535027 similar to sp|P47988 Saccharomyces
           cerevisiae YOR337w TEA1 TY1 enhancer activator,
           hypothetical start
          Length = 816

 Score = 40.4 bits (93), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 53/229 (23%), Positives = 80/229 (34%), Gaps = 43/229 (18%)

Query: 194 PVQLDIVNKLLRFYFDHLNPVFSIVHEQVFLQQFNTGFLNKRRNSSKLFISMLYLILATS 253
           P   +I+  L  FY       F  VH + FL  F     +  +NS      ++Y + A  
Sbjct: 294 PANPNIIKALSNFYKWLYPGHFVFVHRESFLYGFFVHANDNYKNSQYCSEELIYAMSAIG 353

Query: 254 LRFY-------EGYSQSQPVAFSQHQLDWLFKTNSSLEERLFHFAHEIVSRLSFEWESFE 306
            R         E Y +    A     LD +F   S             V R++       
Sbjct: 354 SRLSPEIMHLSESYYEKSKKAL----LDIVFDEKS-------------VPRIT------- 389

Query: 307 LIQSWLLIAFYLRTCHRQTSCWNALGSAIRMCKGMALYLNRFPQRHTLYEETKVK----- 361
            +Q+   +AFY          W   G AIR+   M   L+  P+   + ++T  K     
Sbjct: 390 TVQALFCLAFYELGKGNMQMAWYFSGLAIRVGYAMGFQLD--PKVWHVDDDTDEKLTQSE 447

Query: 362 -----NCFWSCFIMDKVISFQMGRYPDLSLPAEQMPPPDRNPDGWFHEE 405
                  +W C+I D  I   +GR   LS+    +P  D  P+    EE
Sbjct: 448 LEIRSRIYWGCYIADHFICLMLGRNSTLSVSNSTIPESDELPEIEGTEE 496

 Score = 39.7 bits (91), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 26/48 (54%)

Query: 7   NDPSLYGKDNGSKQRLRVRKACEICKKRKIKCDGHQPCTSCTKNSVQC 54
            +PS     N + +  + R AC  C++R+ KCD   PC +C K  ++C
Sbjct: 55  GNPSRESSANVTSRPTKKRLACSNCRRRRKKCDLQYPCFTCDKLGLEC 102

>ADR365W [2106] [Homologous to ScYOR337W (TEA1) - SH]
           complement(1355410..1357515) [2106 bp, 701 aa]
          Length = 701

 Score = 40.4 bits (93), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 32/130 (24%), Positives = 55/130 (42%), Gaps = 14/130 (10%)

Query: 282 SLEERLFHFAHEIVSRLSFEWES---FELIQSWLLIAFYLRTCHRQTSCWNALGSAIRMC 338
           S  E+    A + + R+ F+ +S      +Q+ L +AFY          W+  G AIR+ 
Sbjct: 329 SESEQYAQTAKDRLLRIVFDEQSPAKITTVQALLCLAFYELGNGNNQLAWSFSGLAIRVG 388

Query: 339 KGMALYLNRFPQRHTLYEETKV---------KNCFWSCFIMDKVISFQMGRYPDLSLPAE 389
             +   L+  P+     E++              +W C+I D +I   +GR P LS+   
Sbjct: 389 YDIGFQLD--PKVWVTDEDSSALSESELEIRSRIYWGCYIADHLICLLLGRTPTLSVSNS 446

Query: 390 QMPPPDRNPD 399
            +P  D  P+
Sbjct: 447 TIPESDELPE 456

 Score = 38.1 bits (87), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 16/37 (43%), Positives = 25/37 (67%), Gaps = 4/37 (10%)

Query: 18 SKQRLRVRKACEICKKRKIKCDGHQPCTSCTKNSVQC 54
          SK+RL    AC  C++R+ KCD + PC+SC +  ++C
Sbjct: 41 SKKRL----ACTNCRRRRKKCDLNYPCSSCLRLKLEC 73

>CAGL0L09691g complement(1039799..1042273) some similarities with
          sp|P25502 Saccharomyces cerevisiae YKL015w PUT3
          positive activator of the proline utilisation pathway,
          hypothetical start
          Length = 824

 Score = 40.4 bits (93), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 26/54 (48%), Gaps = 7/54 (12%)

Query: 10 SLYGKDNGSKQR-------LRVRKACEICKKRKIKCDGHQPCTSCTKNSVQCVY 56
          ++ GK NG ++           R AC  C+++ IKC G  PC  C  +S  C Y
Sbjct: 3  TVSGKGNGVRKSSTSSDPPTEKRVACLRCRQKHIKCPGGNPCAKCVISSATCEY 56

 Score = 33.5 bits (75), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 22/99 (22%), Positives = 48/99 (48%), Gaps = 9/99 (9%)

Query: 308 IQSWLLIAFYLRTCHRQTSCWNALGSAIRMCKGMALYLNRFPQRHTLYEETKVKNCFWSC 367
           I++ LL +FYL+      + +  +G A+R C  + ++++      +  E    +  +W+ 
Sbjct: 381 IEALLLYSFYLQVLDCTVASYFYIGQAVRSCLILGMHVDAQGDSISRAELEHKRRLWWTV 440

Query: 368 FIMDKVISFQMGRYPDLS-------LPAEQM--PPPDRN 397
           ++ ++++S + G    LS       LP++Q   P  D N
Sbjct: 441 YMFERMLSSKAGLPLSLSDATISTELPSDQTLHPSIDEN 479

>YLR266C (PDR8) [3660] chr12 complement(675621..677726) Zn[2]-Cys[6]
           zinc finger transcription factor, likely involved in
           pleiotropic drug response [2106 bp, 701 aa]
          Length = 701

 Score = 40.0 bits (92), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 40/155 (25%), Positives = 69/155 (44%), Gaps = 19/155 (12%)

Query: 1   MDPSKYNDPSLYGK--DNGSK-QRLRVRKACEICKKRKIKCDGHQP-CTSCTKNSV-QCV 55
           MD S +   S  G+   +G K +R +V K+C  C+KRK+KC   +P C  C    + QCV
Sbjct: 1   MDGSHFPMKSTTGEPVSSGKKGKRRKVIKSCAFCRKRKLKCSQARPMCQQCVIRKLPQCV 60

Query: 56  YKFTDTASPISKPKPGRSLDKESIANALLQLESSLLAKIDSKXXXXXXXXXXN-LVHFSS 114
           Y   +   P+S  +    +   ++   +  L++ L    ++           N L    +
Sbjct: 61  YT-EEFNYPLSNTELFEQVPNVALVQKIENLQTLLKENDNNNAKPVYCRSSENPLRSLRT 119

Query: 115 SL-----------PSPWQTFSL-DKYRFHRRYQNL 137
           S+           P+ W+T SL ++ +F   +QNL
Sbjct: 120 SVLGDNGSRYVFGPTSWKTLSLFEQNKFQTEFQNL 154

>Kwal_47.17681
          Length = 854

 Score = 40.0 bits (92), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 15/37 (40%), Positives = 23/37 (62%), Gaps = 2/37 (5%)

Query: 20 QRLRVRKACEICKKRKIKCDGH--QPCTSCTKNSVQC 54
          ++ R  +ACE+C  RK++CD +   PCTSC    + C
Sbjct: 11 RKPRTNRACEVCHDRKVRCDANIRVPCTSCQTFGLVC 47

>Scas_590.2
          Length = 1172

 Score = 40.0 bits (92), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 16/30 (53%), Positives = 22/30 (73%), Gaps = 1/30 (3%)

Query: 27 ACEICKKRKIKCDGHQP-CTSCTKNSVQCV 55
          AC +C++RK KCD   P CT+C K +V+CV
Sbjct: 40 ACLLCRRRKQKCDHQLPSCTACLKAAVKCV 69

>KLLA0F14322g 1328925..1331078 gi|32440908|emb|CAE00852.1
          Kluyveromyces lactis Sip4 protein, start by similarity
          Length = 717

 Score = 39.7 bits (91), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 30/51 (58%), Gaps = 2/51 (3%)

Query: 5  KYNDPSLYGKDNGSKQRLRVRKACEICKKRKIKCDGHQP-CTSCTKNSVQC 54
          K+N+  L      +K + R  +AC+ C+ +KIKCDG +P C++C K    C
Sbjct: 41 KHNEKKLLMPTASTKVK-RFSQACDRCRLKKIKCDGIKPSCSNCKKIGYHC 90

>Scas_700.40
          Length = 407

 Score = 39.3 bits (90), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 12/38 (31%), Positives = 23/38 (60%)

Query: 15 DNGSKQRLRVRKACEICKKRKIKCDGHQPCTSCTKNSV 52
          D+G  ++ +  K+C  C++  + CDG +PC+ C K  +
Sbjct: 9  DHGGNKKRKKTKSCLFCRRSHVNCDGKRPCSRCLKRGI 46

>Sklu_2321.3 YLR014C, Contig c2321 8747-11467
          Length = 906

 Score = 39.7 bits (91), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 27/127 (21%), Positives = 53/127 (41%), Gaps = 7/127 (5%)

Query: 266 VAFSQHQLDWLFKTNSSLEERLFHFAHEIVSRLSFEWESFELIQSWLLIAFYLRTCHRQT 325
           +  S   LD   + + + ++R  H+    +  L    +  E +   LLIA Y        
Sbjct: 372 IGESTRVLDSNAEKSRNFKKRAVHY----IDTLYCSNDRLEALAGVLLIAIYSIMRPNVP 427

Query: 326 SCWNALGSAIRMCKGMALYLNRFPQRHTLYEETKVKNCFWSCFIMDKVISFQMGR---YP 382
             W  +GSA+R+   + L+  +  + +  +     +  FW  + +D+ I    GR    P
Sbjct: 428 GVWYIMGSALRLAVDLGLHAEKLNKNYDPFTRELRRRLFWCTYALDRQICVHFGRPFGIP 487

Query: 383 DLSLPAE 389
           D ++ A+
Sbjct: 488 DENITAK 494

 Score = 30.8 bits (68), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 13/34 (38%), Positives = 19/34 (55%), Gaps = 1/34 (2%)

Query: 23 RVRKACEICKKRKIKCDGHQP-CTSCTKNSVQCV 55
          R   AC+ C+ +K+KCD   P C+ C   +  CV
Sbjct: 38 RSIAACKRCRLKKVKCDQKFPSCSKCASANEPCV 71

>KLLA0D12672g complement(1076011..1078608)
           gi|125903|sp|P08657|LAC9_KLULA Kluyveromyces lactis
           Lactose regulatory protein LAC9, start by similarity
          Length = 865

 Score = 39.7 bits (91), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 16/45 (35%), Positives = 28/45 (62%), Gaps = 1/45 (2%)

Query: 24  VRKACEICKKRKIKCDGHQP-CTSCTKNSVQCVYKFTDTASPISK 67
           + +AC+ C+K+K KC    P CT+C K ++ CVY      +P+++
Sbjct: 91  MHQACDACRKKKWKCSKTVPTCTNCLKYNLDCVYSPQVVRTPLTR 135

 Score = 38.5 bits (88), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 52/248 (20%), Positives = 104/248 (41%), Gaps = 48/248 (19%)

Query: 198 DIVNKLLRFYFDHLNPVFSIVHEQVFLQQFNTGFLNKRRNSSKLFISMLYLILATSLRFY 257
           + ++  +  YF H + ++ +V +++F  Q+N      +  + +++  +L  +LA      
Sbjct: 383 ETISAYIDAYFKHYHALYPLVSKEMFFAQYNDQI---KPENVEIWHILLNAVLALG---- 435

Query: 258 EGYSQSQPVAFSQHQLDWLFKTNSSLEERLFHFAHEIVSRLSFEWESFELIQSWLLIAFY 317
                            W   + SS     +  A   +S    E  S +L  + +L+  Y
Sbjct: 436 ----------------SWCSNSCSSHHTLYYQNALSYLSTAVLETGSTDLTIALILLTHY 479

Query: 318 LRTCHRQTSCWNALGSAIRMCKGMA--LYLNRFPQRHTLYEETKVKNCFWSCFIMDKVIS 375
           ++  H+  + W+ +G    +C  MA  L L+R     T++++   +  +W+ +     +S
Sbjct: 480 VQKMHKPNTAWSLIG----LCSHMATSLGLHRDLPNSTIHDQQLRRVLWWTIYCTGCDLS 535

Query: 376 FQMGRYPDL--SLPAEQMPPPDRNPDGWFHEETIQMYRLSLIISDCQKRDGEDLSVNEVQ 433
            + GR P L  +L A  +P P  +      E +I     S II + Q            Q
Sbjct: 536 LETGR-PSLLPNLQAIDIPLPASS--ATIKEPSI----YSSIIQESQWS----------Q 578

Query: 434 ILKQRLTN 441
           IL+Q+L+N
Sbjct: 579 ILQQKLSN 586

>ABR174W [767] [Homologous to ScYLR451W (LEU3) - SH]
          complement(728569..731163) [2595 bp, 864 aa]
          Length = 864

 Score = 39.7 bits (91), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 16/43 (37%), Positives = 28/43 (65%), Gaps = 4/43 (9%)

Query: 19 KQRLRVRKACEICKKRKIKCDGH----QPCTSCTKNSVQCVYK 57
          +++ R + AC  C+++K KC+ H    +PC+ C KN+V CV +
Sbjct: 35 RRQNRKKFACVECRQQKSKCNAHDRAPEPCSRCAKNNVPCVLQ 77

>Scas_661.23
          Length = 741

 Score = 39.7 bits (91), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 24/79 (30%), Positives = 35/79 (44%), Gaps = 6/79 (7%)

Query: 4   SKYNDPSLYGKDNGSKQ-----RLRVRKACEICKKRKIKCDGHQP-CTSCTKNSVQCVYK 57
           +K N  +L   D  +K+     R   R  C  CK+R++KCD  +P C  C + S +CVY 
Sbjct: 103 TKSNSTNLPDSDTNAKKTNIVKRKYSRNGCAECKRRRMKCDETKPICWQCARLSRECVYI 162

Query: 58  FTDTASPISKPKPGRSLDK 76
                        G S +K
Sbjct: 163 VKSGNKKRKSKSAGESAEK 181

>CAGL0M03025g complement(341849..345613) similar to sp|P39113
           Saccharomyces cerevisiae YMR280c CAT8 transcription
           factor involved in gluconeogenesis, hypothetical start
          Length = 1254

 Score = 39.7 bits (91), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 23/67 (34%), Positives = 35/67 (52%), Gaps = 6/67 (8%)

Query: 7   NDPSLYGKDNGSKQRL---RVRKACEICKKRKIKCDGHQP-CTSCTKNSVQCVYKFTDTA 62
           N  S+ G + GS+      RV +AC+ C+ +K KCDG  P C+ C     +C  K +D  
Sbjct: 36  NGNSVSGSNTGSRGSTPTYRVAQACDRCRLKKTKCDGKIPQCSQCALVGFEC--KISDRL 93

Query: 63  SPISKPK 69
           +  S P+
Sbjct: 94  NRKSFPR 100

>Kwal_47.16939
          Length = 669

 Score = 39.3 bits (90), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 17/43 (39%), Positives = 26/43 (60%), Gaps = 5/43 (11%)

Query: 16 NGSKQRLRVRKACEICKKRKIKCD--GHQPCTSCTKNSVQCVY 56
          NG+++R    K C  CKK K+KC+     PC  C ++S++C Y
Sbjct: 4  NGNRKR---TKPCSNCKKNKVKCEYLSSLPCQRCARHSLKCYY 43

>Kwal_55.20722
          Length = 827

 Score = 39.7 bits (91), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 27/51 (52%), Gaps = 2/51 (3%)

Query: 15 DNGSKQRLRVRKACEICKKRKIKCDGHQP-CTSCTKNSVQCVYKFTDTASP 64
          D  S +  R R  C  C+ RK+KCD  +P CT C +N + C Y   D  SP
Sbjct: 2  DRKSPRVNRPRLVCLECRNRKLKCDKARPKCTRCKQNLLTCSYA-NDGNSP 51

>YDR213W (UPC2) [1051] chr4 (889744..892485) Sterol regulatory
          element binding protein involved in the regulation of
          sterol biosynthetic gene expression and the uptake and
          intracellular esterification of sterols [2742 bp, 913
          aa]
          Length = 913

 Score = 39.7 bits (91), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 13/35 (37%), Positives = 22/35 (62%), Gaps = 1/35 (2%)

Query: 23 RVRKACEICKKRKIKCDGHQP-CTSCTKNSVQCVY 56
          + +  C+ CK+R++KCD  +P C  CT   ++C Y
Sbjct: 46 KSKNGCDNCKRRRVKCDEGKPACRKCTNMKLECQY 80

>YDR034C (LYS14) [885] chr4 complement(509732..512104)
           Transcriptional activator of lysine pathway genes with
           2-aminoadipate semialdehyde as coinducer [2373 bp, 790
           aa]
          Length = 790

 Score = 39.3 bits (90), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 27/48 (56%), Gaps = 1/48 (2%)

Query: 10  SLYGKDNGSKQRLRVRKACEICKKRKIKCDGHQP-CTSCTKNSVQCVY 56
           ++  K   + +R   R  C  CK+R++KCD  +P C  C + + QCVY
Sbjct: 141 TVTDKKGNTVKRKYSRNGCSECKRRRMKCDETKPTCWQCARLNRQCVY 188

>KLLA0F00572g complement(42710..44503) some similarities with
          ca|CA2184|IPF6874.3 Candida albicans unknown function,
          3-prime end, hypothetical start
          Length = 597

 Score = 39.3 bits (90), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 15/35 (42%), Positives = 24/35 (68%), Gaps = 1/35 (2%)

Query: 23 RVRKACEICKKRKIKCDGHQP-CTSCTKNSVQCVY 56
          R    C IC++RK KCD  +P CT+C +N ++C++
Sbjct: 6  RSSTGCLICRRRKKKCDEVKPTCTACKRNFLECIW 40

>YOR172W (YRM1) [4969] chr15 (654210..656570) Protein with
          similarity to transcription factors, has Zn[2]-Cys[6]
          fungal-type binuclear cluster domain in the N-terminal
          region [2361 bp, 786 aa]
          Length = 786

 Score = 39.3 bits (90), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 31/46 (67%), Gaps = 4/46 (8%)

Query: 18 SKQRLRVRKACEICKKRKIKCDGHQP-CTSC-TKNSVQCVY--KFT 59
          +++R +  K+C  C+KRK++CD  +P C++C T+    C+Y  KFT
Sbjct: 21 AQKRRKPIKSCAFCRKRKLRCDQQKPMCSTCKTRGRSGCLYTEKFT 66

>Scas_691.32
          Length = 906

 Score = 39.3 bits (90), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 19/40 (47%), Positives = 24/40 (60%), Gaps = 5/40 (12%)

Query: 23 RVRK-ACEICKKRKIKCDGHQ----PCTSCTKNSVQCVYK 57
          R RK AC  C+++K KCD ++    PCT C K  V CV K
Sbjct: 40 RKRKFACVECRQQKSKCDAYEKAPDPCTKCQKKGVPCVLK 79

>CAGL0C01199g complement(121944..124712) similar to tr|Q12151
           Saccharomyces cerevisiae YDR213w UPC2, hypothetical
           start
          Length = 922

 Score = 39.3 bits (90), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 17/63 (26%), Positives = 34/63 (53%), Gaps = 3/63 (4%)

Query: 23  RVRKACEICKKRKIKCDGHQP-CTSCTKNSVQCVYK--FTDTASPISKPKPGRSLDKESI 79
           + +  C+ CK+R++KCD  +P C  C+  ++ CVY     +  +  +  + G+S    S+
Sbjct: 43  KSKTGCDNCKRRRVKCDEGKPGCKKCSNLNLVCVYSTVVDNKVAKKTTSRKGKSPGANSL 102

Query: 80  ANA 82
            N+
Sbjct: 103 ENS 105

>Scas_688.17
          Length = 769

 Score = 39.3 bits (90), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 17/32 (53%), Positives = 20/32 (62%), Gaps = 2/32 (6%)

Query: 27 ACEICKKRKIKCD-GHQPCTSCTK-NSVQCVY 56
          AC  C+KRKI CD GH  C +C K    QC+Y
Sbjct: 16 ACIQCRKRKIGCDRGHPKCGNCIKLKRAQCIY 47

>Kwal_47.17565
          Length = 628

 Score = 38.9 bits (89), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 16/41 (39%), Positives = 24/41 (58%), Gaps = 2/41 (4%)

Query: 20 QRLRVRKACEICKKRKIKCDGHQPCTSCTKNSV--QCVYKF 58
          +R R  K C+ C + K+KC+   PC +CT+  +   CVY F
Sbjct: 5  KRHRSIKTCKYCYEHKLKCNKQSPCDNCTRLGITSHCVYGF 45

>ABL121C [471] [Homologous to ScYMR280C (CAT8) - SH]
           (170784..174641) [3858 bp, 1285 aa]
          Length = 1285

 Score = 39.3 bits (90), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 16/42 (38%), Positives = 25/42 (59%), Gaps = 3/42 (7%)

Query: 23  RVRKACEICKKRKIKCDGHQP-CTSCTKNSVQCVYKFTDTAS 63
           RV +AC+ C+ +K +CDG +P C+ C     +C  K +D  S
Sbjct: 73  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC--KISDKLS 112

>YJL089W (SIP4) [2826] chr10 (265842..268331) Transcriptional
          activator of gluconeogenic genes through CSRE elements,
          activated by Snf1p kinase, contains a Zn[2]-Cys[6]
          fungal-type binuclear cluster domain [2490 bp, 829 aa]
          Length = 829

 Score = 38.9 bits (89), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 32/60 (53%), Gaps = 3/60 (5%)

Query: 22 LRVRKACEICKKRKIKCDGHQP-CTSCTKNSVQCVYKFTDTASPISKPKPGRSLDKESIA 80
          +R   AC+ C+ +KIKCDG +P C++C K    C  K +D  S    PK    L ++ + 
Sbjct: 40 VRKAHACDRCRLKKIKCDGLKPNCSNCAKIDFPC--KTSDKLSRRGLPKGYTELLEKEVV 97

>CAGL0K11902g complement(1148381..1150876) similar to sp|P40971
           Saccharomyces cerevisiae YDR034c LYS14 transcriptional
           activator of lysine pathway genes, hypothetical start
          Length = 831

 Score = 38.9 bits (89), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 23/38 (60%), Gaps = 1/38 (2%)

Query: 20  QRLRVRKACEICKKRKIKCDGHQP-CTSCTKNSVQCVY 56
           +R   R  C  CK+R++KCD  +P C  CT+ +  CVY
Sbjct: 196 KRKYSRNGCAECKRRRMKCDESKPKCWQCTRLNRDCVY 233

>Scas_715.3
          Length = 1115

 Score = 38.9 bits (89), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 28/56 (50%), Gaps = 10/56 (17%)

Query: 23  RVRKACEICKKRKIKCDGHQ----PCTSCTKNSVQCVYKFTDTASPISKPKPGRSL 74
           R   +C  C+++KIKCD  Q    PC+ C K ++QC         P  KPK G  L
Sbjct: 101 RPVTSCSHCRQQKIKCDASQNFPAPCSRCQKMALQC------QIDPRFKPKKGSQL 150

>KLLA0A03421g 308414..311056 weakly similar to sp|P39720
          Saccharomyces cerevisiae YAL051w OAF1 peroxisome
          proliferating transcription factor, start by similarity
          Length = 880

 Score = 38.9 bits (89), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 14/40 (35%), Positives = 25/40 (62%), Gaps = 1/40 (2%)

Query: 18 SKQRLRVRKACEICKKRKIKCDGHQP-CTSCTKNSVQCVY 56
          +K+R ++   C++C+K K KCD  +P C  C + +  C+Y
Sbjct: 11 AKKRYKLSFVCQLCRKSKTKCDRKKPSCARCQRLNKPCIY 50

>Scas_696.44
          Length = 1164

 Score = 38.9 bits (89), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 13/34 (38%), Positives = 22/34 (64%), Gaps = 1/34 (2%)

Query: 22  LRVRKACEICKKRKIKCDGHQP-CTSCTKNSVQC 54
           LR+ +AC+ C+ +K +CDG +P C+ C     +C
Sbjct: 75  LRIAQACDRCRSKKTRCDGKRPQCSQCAIVGFEC 108

 Score = 30.0 bits (66), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 40/208 (19%), Positives = 80/208 (38%), Gaps = 46/208 (22%)

Query: 200 VNKLLRFYFDHLNPVFSIVHEQVFLQQFNTGFL---NKRRNSSKLFISMLYLILATSLRF 256
           +++L+ F+F   N +  I++++ FL  +N   L   N  R+     + M Y I    L  
Sbjct: 352 MDELINFFFQDWNDIIPIINKEEFLSNYNAFKLDLKNSERDKLSSNLKMNYKIFGCIL-- 409

Query: 257 YEGYSQSQPVAFSQHQLDWLFKTNSSLEERLFH------FAHEIVSRLS----FEWESFE 306
                    V   Q  L    K  +       H      + H++++ L     F+  +  
Sbjct: 410 ---------VLMCQMGLLTKIKATNGKSSPNIHLKSIMAYYHQLIANLPINNFFQIATIS 460

Query: 307 L--IQSWLLIAFYLRTCHRQTSCWNALGSAIRMCK-------------GMALYLNRFPQR 351
           +  ++ ++LI FY       ++ +   G  I M +             G +L +N+  Q 
Sbjct: 461 IPQLKLYVLILFYNLNVGDISAIYELRGRIISMSQQLRLHRCPSAVLSGSSLTMNKLDQS 520

Query: 352 HTLYEETKVKNCFWSCFIMDKVISFQMG 379
           +        +  FW+ + +D + S Q+G
Sbjct: 521 NR-------RILFWTIYSLDALSSLQLG 541

>ACL096W [953] [Homologous to ScYKL015W (PUT3) - SH]
          complement(169508..172015) [2508 bp, 835 aa]
          Length = 835

 Score = 38.9 bits (89), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 15/48 (31%), Positives = 26/48 (54%), Gaps = 1/48 (2%)

Query: 10 SLYGKDNGSKQ-RLRVRKACEICKKRKIKCDGHQPCTSCTKNSVQCVY 56
          +L G++  +K+   R   AC  C++R ++C G  PC  C   ++ C Y
Sbjct: 42 TLAGREERNKRPAKRAPLACLRCRRRHVRCPGGTPCAKCAVANIACEY 89

 Score = 34.7 bits (78), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 17/72 (23%), Positives = 36/72 (50%)

Query: 308 IQSWLLIAFYLRTCHRQTSCWNALGSAIRMCKGMALYLNRFPQRHTLYEETKVKNCFWSC 367
           I+  LL AFYL+   R    +   G A+R C  +  +++      T +E    +  +W+ 
Sbjct: 380 IEIMLLYAFYLQVADRTVPSYFYFGEALRACLILGWHVDAQRDVLTRFELEHHRRLWWTV 439

Query: 368 FIMDKVISFQMG 379
           ++ ++++S + G
Sbjct: 440 YMFERMLSSKAG 451

>YLL054C (YLL054C) [3369] chr12 complement(32894..35203) Protein
          with similarity to transcription factors, has
          Zn[2]-Cys[6] fungal-type binuclear cluster domain in
          the N-terminal region [2310 bp, 769 aa]
          Length = 769

 Score = 38.5 bits (88), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 22/67 (32%), Positives = 33/67 (49%), Gaps = 11/67 (16%)

Query: 17 GSKQRLRVRKACEICKKRKIKCDGHQP-CTSCTKNSVQCVYKFTDTASPISKPKPGRSLD 75
           S+++++    C  CK+RKIKCD   P C+ C  +S  C Y+           +PGR   
Sbjct: 4  ASQKKVKPSFVCLRCKQRKIKCDKLWPTCSKCKASSSICSYEV----------EPGRINK 53

Query: 76 KESIANA 82
            +I NA
Sbjct: 54 SPTIENA 60

>Scas_526.3
          Length = 1109

 Score = 38.5 bits (88), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 14/31 (45%), Positives = 23/31 (74%), Gaps = 1/31 (3%)

Query: 26 KACEICKKRKIKCDGHQP-CTSCTKNSVQCV 55
          ++C +C++RK +CD   P CT+C K +V+CV
Sbjct: 39 RSCLLCRRRKQRCDHKMPSCTACLKAAVKCV 69

>Sklu_2376.6 , Contig c2376 12573-15341 reverse complement
          Length = 922

 Score = 38.5 bits (88), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 17/35 (48%), Positives = 23/35 (65%), Gaps = 1/35 (2%)

Query: 19 KQRLRVRKACEICKKRKIKCDGHQP-CTSCTKNSV 52
          K+R R    C  CKKRKIKCD  +P C++C+  +V
Sbjct: 19 KKRQRTTVVCTNCKKRKIKCDRKRPACSNCSVANV 53

>Kwal_27.10232
          Length = 1209

 Score = 38.5 bits (88), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 28/48 (58%), Gaps = 3/48 (6%)

Query: 23  RVRKACEICKKRKIKCDGHQP-CTSCTKNSVQCVYKFTDTASPISKPK 69
           RV +AC+ C+ +K +CDG +P C+ C     +C  K +D  S  + P+
Sbjct: 69  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC--KVSDKLSRRAFPR 114

>Scas_711.31
          Length = 932

 Score = 38.5 bits (88), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 14/34 (41%), Positives = 22/34 (64%), Gaps = 1/34 (2%)

Query: 22 LRVRKACEICKKRKIKCDGHQP-CTSCTKNSVQC 54
          ++ ++AC+ C+ +KIKCD   P CT C K  + C
Sbjct: 39 IKRKQACDRCRLKKIKCDDRTPDCTPCMKAGIPC 72

>KLLA0D10593g complement(900326..903103) similar to sp|P08638
          Saccharomyces cerevisiae YLR451w LEU3 transcription
          factor, hypothetical start
          Length = 925

 Score = 38.5 bits (88), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 17/46 (36%), Positives = 25/46 (54%), Gaps = 4/46 (8%)

Query: 16 NGSKQRLRVRKACEICKKRKIKCDGH----QPCTSCTKNSVQCVYK 57
          N  K   + + AC  C+++K KCD H    +PC+ C K  V CV +
Sbjct: 37 NDKKMPQKKKLACVECRQQKSKCDAHERAPEPCSRCLKKGVPCVLQ 82

>CAGL0A04455g 432854..436150 similar to sp|P34228 Saccharomyces
           cerevisiae YBL066c SEF1, hypothetical start
          Length = 1098

 Score = 38.5 bits (88), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 19/36 (52%), Gaps = 4/36 (11%)

Query: 23  RVRKACEICKKRKIKCDGHQ----PCTSCTKNSVQC 54
           R   +C  C++ KIKCD  Q    PCT C KN   C
Sbjct: 82  RPVTSCTHCRQHKIKCDASQNFPAPCTRCAKNGFHC 117

>KLLA0C04620g complement(422705..426514) weakly similar to
          sp|Q05854 Saccharomyces cerevisiae YLR278c, start by
          similarity
          Length = 1269

 Score = 38.5 bits (88), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 15/31 (48%), Positives = 22/31 (70%), Gaps = 1/31 (3%)

Query: 26 KACEICKKRKIKCDGHQP-CTSCTKNSVQCV 55
          +AC +C++RK KCD   P CT+C K  V+C+
Sbjct: 39 RACLLCQRRKQKCDHKIPSCTACLKAGVKCI 69

>KLLA0E14036g complement(1239566..1241602) some similarities with
           ca|CA4758|CaPPR1 Candida albicans transcription factor
           regulating pyrimidine pathway (by homology),
           hypothetical start
          Length = 678

 Score = 38.1 bits (87), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 26/83 (31%), Positives = 39/83 (46%), Gaps = 13/83 (15%)

Query: 19  KQRLRVRKACEICKKRKIKCDGHQP-CTSCTKNSVQCVYKFTDTASPISKPKPGRSLDKE 77
           K+R     AC  CK+R+ +CDG  P C +C    +QC   F D  +       GR L ++
Sbjct: 58  KRRKNQGVACCFCKRRRKRCDGGFPQCGACVNAGIQCT--FVDKIT-------GRELPRD 108

Query: 78  SI---ANALLQLESSLLAKIDSK 97
            I    + +  LES L +  + K
Sbjct: 109 YIDRLESKVFDLESKLRSTEEDK 131

>YPL133C (RDS2) [5312] chr16 complement(299887..301227) Protein
          with similarity to transcription factors, has
          Zn[2]-Cys[6] fungal-type binuclear cluster domain in
          the N-terminal region, involved in resistance to the
          antifungal drug ketoconazole [1341 bp, 446 aa]
          Length = 446

 Score = 38.1 bits (87), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 16/54 (29%), Positives = 27/54 (50%)

Query: 15 DNGSKQRLRVRKACEICKKRKIKCDGHQPCTSCTKNSVQCVYKFTDTASPISKP 68
          ++G K+  +  K C  CK+  + CD  +PC+ C K  +  + +  D A P   P
Sbjct: 4  NSGVKRASKAFKTCLFCKRSHVVCDKQRPCSRCVKRDIAHLCREDDIAVPNEMP 57

>ACR107W [1154] [Homologous to ScYPL133C - SH]
          complement(544402..545556) [1155 bp, 384 aa]
          Length = 384

 Score = 37.7 bits (86), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 13/35 (37%), Positives = 23/35 (65%)

Query: 18 SKQRLRVRKACEICKKRKIKCDGHQPCTSCTKNSV 52
          +K+R +V KAC +C++  + CD  +PC+ C K  +
Sbjct: 13 TKKRKKVVKACVLCRRSHMICDDRRPCSRCIKRDI 47

>Scas_721.94
          Length = 869

 Score = 38.1 bits (87), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 27/48 (56%), Gaps = 8/48 (16%)

Query: 23 RVRKACEICKKRKIKCDGHQP-CTSCTKNSVQCVYKFTDTASPISKPK 69
          + ++ C  CK+R++KCD  +P C  C   +V CVY       P+ +PK
Sbjct: 50 KSKQGCTHCKRRRVKCDELKPACRRCLNWNVPCVY-------PVVQPK 90

>YMR280C (CAT8) [4234] chr13 complement(827027..831328)
          Transcription factor required for derepression of
          gluconeogenic enzymes, contains an N-terminal
          Zn[2]-Cys[6] fungal-type binuclear cluster domain [4302
          bp, 1433 aa]
          Length = 1433

 Score = 38.1 bits (87), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 12/33 (36%), Positives = 21/33 (63%), Gaps = 1/33 (3%)

Query: 23 RVRKACEICKKRKIKCDGHQP-CTSCTKNSVQC 54
          R+ +AC+ C+ +K +CDG +P C+ C     +C
Sbjct: 65 RIAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 97

>KLLA0A06039g 557368..559341 weakly similar to sp|P36023
          Saccharomyces cerevisiae YKR064w singleton, start by
          similarity
          Length = 657

 Score = 37.7 bits (86), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 27/50 (54%), Gaps = 2/50 (4%)

Query: 19 KQRLRVRKACEICKKRKIKCDGHQP-CTSCTKNSVQCVYKFTDTASPISK 67
          K+R R    C  C++RK KCD  +P C++C K    CVY   DT    SK
Sbjct: 12 KKRHRPTLVCLNCRRRKTKCDRGKPSCSNCLKLGETCVYS-EDTDENASK 60

>CAGL0H06875g complement(682518..684626) some similarities with
          sp|05085 Saccharomyces cerevisiae YML099c ARG81,
          hypothetical start
          Length = 702

 Score = 37.7 bits (86), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 28/53 (52%), Gaps = 2/53 (3%)

Query: 15 DNGSKQRLRVRKACEICKKRKIKCDGHQP-CTSCTKNSVQC-VYKFTDTASPI 65
          D  S + ++    C  C+ RK+KCD  +P C  C ++ VQC  YK     SP+
Sbjct: 2  DKKSTRSVKTYSGCWTCRARKVKCDLVRPSCLRCRRSKVQCGGYKIKLRWSPL 54

>KLLA0A01804g complement(159689..162526) similar to sgd|S0002829
          Saccharomyces cerevisiae YDR421w positive transcription
          regulator of ARO9 and ARO10, start by similarity
          Length = 945

 Score = 37.7 bits (86), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 22/76 (28%), Positives = 35/76 (46%), Gaps = 7/76 (9%)

Query: 23 RVRKACEICKKRKIKCD-------GHQPCTSCTKNSVQCVYKFTDTASPISKPKPGRSLD 75
          R  KAC  CK RK+KCD          PC  C + S +C++  T         +   SL 
Sbjct: 19 RGYKACLNCKMRKVKCDLGPFDNPHGPPCVRCKRESRECMFTETKRGGFRVAKQSLVSLK 78

Query: 76 KESIANALLQLESSLL 91
          +ES   ++  + +S++
Sbjct: 79 EESAGKSMADVITSVI 94

>YHR178W (STB5) [2464] chr8 (459297..461528) Probable
          transcriptional activator of multidrug resistance genes
          such as PDR5 and SNQ2 [2232 bp, 743 aa]
          Length = 743

 Score = 37.7 bits (86), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 24/79 (30%), Positives = 34/79 (43%), Gaps = 16/79 (20%)

Query: 12 YGKDNGSKQRLRVRKACEICKKRKIKCDGHQP-CTSCTKNSVQCVYKFTDTASPISKPKP 70
          +    G  QR     +C  C+K K KC    P C +C KN   C Y             P
Sbjct: 6  FAHQGGRSQRTTELYSCARCRKLKKKCGKQIPTCANCDKNGAHCSY-------------P 52

Query: 71 GRS--LDKESIANALLQLE 87
          GR+    K+ +A+A+L+ E
Sbjct: 53 GRAPRRTKKELADAMLRGE 71

 Score = 35.0 bits (79), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 41/211 (19%), Positives = 81/211 (38%), Gaps = 29/211 (13%)

Query: 195 VQLDIVNKLLRFYFDHLNPVFSIVHEQVFLQQFNT----GFLNKRRNSSKLFISMLYLIL 250
           +   ++++ +  YF H + +F ++ +  FL    T      L   +N    F+  +Y+I+
Sbjct: 293 IDRSLLDRFIAAYFKHNHRLFPMIDKIAFLNDAATITDFERLYDNKNYPDSFVFKVYMIM 352

Query: 251 A---TSLRFYEGYSQSQPVAFSQHQLDWLFKTNSSLEERLFHFAHEIVSRLSFEWESFEL 307
           A   T+L+     SQ +                  L E L   A +   R     +  E 
Sbjct: 353 AIGCTTLQRAGMVSQDE----------------ECLSEHLAFLAMKKF-RSVIILQDIET 395

Query: 308 IQSWLLIAFYLRTCHRQTSCWNALGSAIRMCKGMAL----YLNRFPQRHTLYEETKVKNC 363
           ++  LL+  Y     + +S W   G  +R+  G+ L       +      L  E + +  
Sbjct: 396 VRCLLLLGIYSFFEPKGSSSWTISGIIMRLTIGLGLNRELTAKKLKSMSALEAEARYR-V 454

Query: 364 FWSCFIMDKVISFQMGRYPDLSLPAEQMPPP 394
           FWS +  ++++   +GR   +      +P P
Sbjct: 455 FWSAYCFERLVCTSLGRISGIDDEDITVPLP 485

>CAGL0G09757g 930351..934622 some similarities with sp|Q05854
          Saccharomyces cerevisiae YLR278c, hypothetical start
          Length = 1423

 Score = 37.7 bits (86), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 14/31 (45%), Positives = 23/31 (74%), Gaps = 1/31 (3%)

Query: 26 KACEICKKRKIKCDGHQP-CTSCTKNSVQCV 55
          ++C +C++RK +CD   P CT+C K +V+CV
Sbjct: 39 RSCLLCRRRKQRCDHKLPSCTACLKAAVKCV 69

>Scas_674.12*
          Length = 909

 Score = 37.4 bits (85), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 14/40 (35%), Positives = 23/40 (57%), Gaps = 1/40 (2%)

Query: 20 QRLRVRKACEICKKRKIKCDGHQP-CTSCTKNSVQCVYKF 58
          ++ R    C +C+ +K+KCD  +P C  C K +  CVY+ 
Sbjct: 7  RKARPSFVCLVCRSKKVKCDKARPSCGRCRKTNKLCVYEI 46

>YMR168C (CEP3) [4123] chr13 complement(597331..599157) Component
          (subunit b) of the Cbf3 kinetochore protein complex
          [1827 bp, 608 aa]
          Length = 608

 Score = 37.4 bits (85), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 19/29 (65%)

Query: 21 RLRVRKACEICKKRKIKCDGHQPCTSCTK 49
          +L+ +  C +C +RK+KCD   PC +C K
Sbjct: 7  QLKSKHPCSVCTRRKVKCDRMIPCGNCRK 35

>KLLA0F04213g 400673..402979 similar to sp|P40971 Saccharomyces
           cerevisiae YDR034c LYS14 transcriptional activator of
           lysine pathway genes singleton, start by similarity
          Length = 768

 Score = 37.4 bits (85), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 23/38 (60%), Gaps = 1/38 (2%)

Query: 20  QRLRVRKACEICKKRKIKCDGHQP-CTSCTKNSVQCVY 56
           +R   R  C  CKKR++KCD  +P C  C + + +CVY
Sbjct: 147 KRKYSRNGCLECKKRRMKCDEGKPTCWQCARLNRKCVY 184

>YHR056C (RSC30) [2344] chr8 complement(215184..217835) Component
          of the abundant RSC chromatin remodeling complex [2652
          bp, 883 aa]
          Length = 883

 Score = 37.4 bits (85), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 20/41 (48%), Positives = 24/41 (58%), Gaps = 4/41 (9%)

Query: 20 QRLRVRK--ACEICKKRKIKCDGHQP-CTSCTK-NSVQCVY 56
          Q  +VRK  AC  C+KRKI CD  +P C +C K N   C Y
Sbjct: 5  QVRKVRKPPACTQCRKRKIGCDRAKPICGNCVKYNKPDCFY 45

>Sklu_2023.3 YHR178W, Contig c2023 2677-4653 reverse complement
          Length = 658

 Score = 37.4 bits (85), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 37/201 (18%), Positives = 83/201 (41%), Gaps = 29/201 (14%)

Query: 199 IVNKLLRFYFDHLNPVFSIVHEQVFLQQFNT----GFLNKRRNSSKLFISMLYLILATSL 254
           + ++ +  YF H +  + ++++  FL + +T      ++ R   +  FI  LY+++A   
Sbjct: 220 LYDRFIAAYFKHNHRSYPLINKIEFLNKVSTIRDFNLMDGRYEEA--FIFKLYMVMA--- 274

Query: 255 RFYEGYSQSQPVAFSQHQLDWLFKTNSSLEERLFHFAHEIVSRLSFEWESFELIQSWLLI 314
                      +  +  Q   +      L E   + A +   ++    ++ E I+  LL+
Sbjct: 275 -----------IGCTTLQRAGILNQEEELSEHFSYLAMKKFCKV-MHAQNVETIKCLLLL 322

Query: 315 AFYLRTCHRQTSCWNALGSAIRMCKGMALYLNRFPQRHTLYEETKVK---NCFWSCFIMD 371
             Y     +  S W   G  +R+  G+ L      ++ +     +V+     FWS +  +
Sbjct: 323 GIYSFFEPKGVSSWTISGLMMRLAIGLGLNRALTKKKMSTMSVIEVEMRYRAFWSFYCFE 382

Query: 372 KVISFQMGRYP-----DLSLP 387
           +++S  +GR       D+S+P
Sbjct: 383 RLVSSSLGRISAIDDDDISIP 403

>YLR278C (YLR278C) [3671] chr12 complement(700001..704026) Protein
          with similarity to transcription factors, contains an
          N-terminal Zn[2]-Cys[6] fungal-type binuclear cluster
          domain [4026 bp, 1341 aa]
          Length = 1341

 Score = 37.4 bits (85), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 13/31 (41%), Positives = 22/31 (70%), Gaps = 1/31 (3%)

Query: 26 KACEICKKRKIKCDGHQP-CTSCTKNSVQCV 55
          ++C +C++RK +CD   P CT+C K  ++CV
Sbjct: 39 RSCLLCRRRKQRCDHKLPSCTACLKAGIKCV 69

>AFR171W [3363] [Homologous to NOHBY] complement(752592..754430)
          [1839 bp, 612 aa]
          Length = 612

 Score = 37.4 bits (85), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 15/50 (30%), Positives = 27/50 (54%), Gaps = 1/50 (2%)

Query: 13 GKDNGSKQRLRVRKACEICKKRKIKCDGHQP-CTSCTKNSVQCVYKFTDT 61
          G+   +++    +  C  CK+RK+KCD  +P C  C+    +CVY   ++
Sbjct: 7  GRKGVARRSKYSKNGCSECKRRKVKCDETKPACWQCSHLGKRCVYMVNNS 56

>YIR023W (DAL81) [2687] chr9 (399774..402686) Transcriptional
           activator for allantoin, 4-aminobutyric acid (GABA), and
           urea catabolic genes; contains a Zn[2]-Cys[6]
           fungal-type binuclear cluster domain in the N-terminal
           region [2913 bp, 970 aa]
          Length = 970

 Score = 37.4 bits (85), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 40/184 (21%), Positives = 78/184 (42%), Gaps = 23/184 (12%)

Query: 203 LLRFYFDHLNPVFSIVHEQVFLQQFNTGFLNKRRNSSKLFISMLYLILATSLRFYEGYSQ 262
           L+  +F  ++P   I+HE+VFL++++       R+  +L   +L  I + +L++++ +  
Sbjct: 319 LVEIFFKLIHPFLPILHERVFLEKYS-------RSYRELTAPLLASIYSLALQYWDFH-- 369

Query: 263 SQPVAFSQHQLDWLFKTNSSLEERLFHFAHEIVSRLSFEWESFELIQSWLLIAFYLRTCH 322
             P      + D   + N+   E  +      V R         +IQ+ LLI      CH
Sbjct: 370 --PALLGFPKPDVTAQLNNIALETFY----ARVGR-----PKLSIIQTGLLILQCRSECH 418

Query: 323 RQTSCWNALGSAIRMCKGMALYLNRFPQRHTLYEETKVKNCFWSCFIMDKVISFQMGRYP 382
                W    S + + + + L +     +   +E+   K   W+ ++MDK  +   GR  
Sbjct: 419 NN---WVLCSSVVALAEELGLGVECNDWKLPKWEKDLRKRLAWAVWLMDKWCALNEGRQS 475

Query: 383 DLSL 386
            L L
Sbjct: 476 HLIL 479

>Kwal_23.4370
          Length = 692

 Score = 37.0 bits (84), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 83/441 (18%), Positives = 156/441 (35%), Gaps = 71/441 (16%)

Query: 8   DPSLYGKDNGSKQRLRVRKACEICKKRKIKCDGHQP-CTSCTKNSVQCVY---------- 56
           D  +    NG  ++  +  +C  C+K K +C    P C SC K    C Y          
Sbjct: 54  DDGVSADTNGEYKKYELY-SCSRCRKLKKRCSKESPVCVSCAKAGESCTYPGRAPRRTRK 112

Query: 57  --KFTDTASPISKPKPGRSLDKESIANALLQLE---------SSLLAKIDSKXXXXXXXX 105
             +     + +S+P   RS   E+  + +   E         S  L   D++        
Sbjct: 113 ELERVRRENSLSRPAAKRSRSSETSGHYVTPDEDFEANGKSHSYALTDSDTEKERRRSSE 172

Query: 106 XXNLVHFSSSLPSPWQTFSLDKYRFHRRYQNLLPYYLGQSLMQSLPPQTIQHHNLKTPRV 165
             +++   + +          +       Q LL + L +     +    IQ   + +   
Sbjct: 173 SASILSMLAGVHDTSPPPPAAQVAPQIHTQGLLEHELHKPDSIPIRASAIQIETVTS--- 229

Query: 166 QNYGWNMSGGHYLKNGSDSSLDI--INFDDPVQLDIVNKLLRFYFDHLNPVFSIVHEQVF 223
                        K G  +S+     NF   ++  + ++ +  YF H +  + ++++  F
Sbjct: 230 -----------VFKGGRTTSMLTPEGNFKH-IERPLYDRFIAAYFKHNHRSYPLINKIEF 277

Query: 224 LQQFNT--GFLNKRRNSSKLFISMLYLILATSLRFYEGYSQSQPVAFSQHQLDWLFKTNS 281
           L + +T   F          FI  LY+++A       G +  Q           L K   
Sbjct: 278 LNKVSTIRQFEEMEDKYETSFIFQLYMVMAI------GCTTLQRAGI-------LSKNEE 324

Query: 282 SLEERLFHFAHEIVSRLS--FEWESFELIQSWLLIAFYLRTCHRQTSCWNALGSAIRMCK 339
            L E   HFA+  + +       ++ + I   LL+  Y     +  S W   G  +R+  
Sbjct: 325 GLSE---HFAYLAMKKFCTVMHQQNVDTITCLLLLGIYSFFEPQGVSSWTISGIIMRLTI 381

Query: 340 GMALYLNRFPQRHTLYEETKVK---NCFWSCFIMDKVISFQMGRYP-----DLSLPAEQM 391
           G+ L+     ++       +V+     FWS +  ++++S  +GR       D+S+P   +
Sbjct: 382 GLGLHRALTARKIKCMSVVEVEMRYRAFWSFYSFERLVSTSLGRISAIDDDDISVP---L 438

Query: 392 PPPDRNPDGWFHEETIQMYRL 412
           P P    +    E TI M  L
Sbjct: 439 PRPLYAEETDDIEVTIMMISL 459

>CAGL0I02552g 227257..230274 weakly similar to sp|P38699
           Saccharomyces cerevisiae YHR178w STB5 SIN3 binding
           protein, hypothetical start
          Length = 1005

 Score = 37.4 bits (85), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 40/200 (20%), Positives = 77/200 (38%), Gaps = 29/200 (14%)

Query: 194 PVQLDIVNKLLRFYFDHLNPVFSIVHEQVFLQQFNT--------GFLNKRRNSSKLFISM 245
           P++  ++ K +  YF+H + +F +V +  FL++  T                  K FI  
Sbjct: 398 PIKKSLLEKFVSAYFEHNHRLFPMVDKVTFLKKLATINSFESIEMLAVNNPELPKTFIFE 457

Query: 246 LYLILATSLRFYEGYSQSQPVAFSQHQLDWLFKTNSSLEERLFHFAHEIVSRLSFEWESF 305
           +Y+I+A      +   +             L      L E L + A     R     +  
Sbjct: 458 IYMIMAIGCTTLQRAGK-------------LTTDEGHLYEHLAYLAMRNF-RDILHQQDI 503

Query: 306 ELIQSWLLIAFYLRTCHRQTSCWNALGSAIRMCKGMALYLNRFPQRHTLYEETKVK---- 361
             ++  +L+  Y     +  S W   G A+R+   + L LNR      + + + V+    
Sbjct: 504 TTLRCLILLGIYSFFEPKGVSSWTISGIAMRL--AIELGLNRPLTAKEMGDMSAVEVESR 561

Query: 362 -NCFWSCFIMDKVISFQMGR 380
              FWS +  ++V++  +GR
Sbjct: 562 YRVFWSAYCFERVVATSLGR 581

>Scas_659.10
          Length = 757

 Score = 37.0 bits (84), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 17/45 (37%), Positives = 26/45 (57%), Gaps = 2/45 (4%)

Query: 17 GSKQRLRVRKACEICKKRKIKCDGHQP-CTSC-TKNSVQCVYKFT 59
          G K+R +  K+C  C+ RK+KCD ++P C  C  +    C+Y  T
Sbjct: 10 GFKRRRKPIKSCAFCRGRKLKCDKNKPICNQCLMRKHPTCIYTET 54

>Scas_597.2
          Length = 540

 Score = 37.0 bits (84), Expect = 0.055,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 26/51 (50%), Gaps = 2/51 (3%)

Query: 9  PSLYGKDNGSKQRLRVRKACEICKKRKIKCDGHQPCTSCTKNSVQ--CVYK 57
          PS   K + + +R ++  AC  C K    CD  +PC+ C K  +Q  CV K
Sbjct: 24 PSAKEKKSQTGKRRKINVACSNCAKSHSSCDSCRPCSRCIKKELQDSCVDK 74

>Kwal_26.6732
          Length = 676

 Score = 37.0 bits (84), Expect = 0.055,   Method: Compositional matrix adjust.
 Identities = 15/35 (42%), Positives = 20/35 (57%), Gaps = 1/35 (2%)

Query: 23 RVRKACEICKKRKIKCDGHQP-CTSCTKNSVQCVY 56
          R    C  C+KR+ KCD  +P CT C  N +QC +
Sbjct: 7  RSVTGCLTCRKRRKKCDERKPVCTGCESNFLQCTW 41

>YBR033W (YBR033W) [224] chr2 (301906..304665) Protein with
          similarity to transcription factors, has Zn[2]-Cys[6]
          fungal-type binuclear cluster domain in the N-terminal
          region [2760 bp, 919 aa]
          Length = 919

 Score = 37.0 bits (84), Expect = 0.058,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 27/47 (57%), Gaps = 3/47 (6%)

Query: 13 GKDNGSKQRLRVRKACEICKKRKIKC--DGHQP-CTSCTKNSVQCVY 56
          G + G+KQR +   AC+ C++++IKC  D H   C  C +   +C +
Sbjct: 41 GSEKGTKQRKKASHACDQCRRKRIKCRFDKHTGVCQGCLEVGEKCQF 87

>Kwal_56.24566
          Length = 755

 Score = 37.0 bits (84), Expect = 0.059,   Method: Compositional matrix adjust.
 Identities = 14/38 (36%), Positives = 25/38 (65%), Gaps = 1/38 (2%)

Query: 20 QRLRVRKACEICKKRKIKCDGHQP-CTSCTKNSVQCVY 56
          +R R R  C  C+ R+ KCD  +P C +C+K+ ++C++
Sbjct: 24 KRNRSRAGCFTCRLRRKKCDEARPKCGTCSKHMLKCIW 61

>ACL058W [991] [Homologous to NOHBY] complement(261723..264176)
          [2454 bp, 817 aa]
          Length = 817

 Score = 37.0 bits (84), Expect = 0.061,   Method: Compositional matrix adjust.
 Identities = 16/37 (43%), Positives = 19/37 (51%), Gaps = 1/37 (2%)

Query: 28 CEICKKRKIKCDGHQP-CTSCTKNSVQCVYKFTDTAS 63
          C  C KRK+KC+  +P C  C KN   C Y   D  S
Sbjct: 38 CMPCHKRKVKCNRARPVCDHCEKNRYACAYFVNDRVS 74

>Kwal_33.13934
          Length = 797

 Score = 37.0 bits (84), Expect = 0.062,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 31/64 (48%), Gaps = 8/64 (12%)

Query: 15 DNG-----SKQRLRVRKACEICKKRKIKCDGHQP-CTSCTK--NSVQCVYKFTDTASPIS 66
          DNG     +K+R R    C  CK+RK KCD  +P C +C++  +   CVY       P+ 
Sbjct: 5  DNGENELRTKKRRRPTVVCTNCKRRKSKCDRLKPICGNCSRLGDQATCVYGPELGNKPVK 64

Query: 67 KPKP 70
             P
Sbjct: 65 SESP 68

>AAL175W [12] [Homologous to ScYML099C (ARG81) - NSH]
          complement(32874..35525) [2652 bp, 883 aa]
          Length = 883

 Score = 37.0 bits (84), Expect = 0.063,   Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 28/57 (49%), Gaps = 5/57 (8%)

Query: 3  PSKYNDPSLYGKDNGS----KQRLRVRKACEICKKRKIKCDGHQP-CTSCTKNSVQC 54
          P+  ND +L  K+       + R +    C  C+ RK+KCD  +P C  C K+ + C
Sbjct: 15 PAARNDEALQKKEGSGTAVRRPRAKTFTGCWTCRLRKVKCDLGKPSCQRCEKSGLDC 71

>CAGL0M02651g complement(304583..305971) similar to sp|P19541
          Saccharomyces cerevisiae YPL133c, hypothetical start
          Length = 462

 Score = 36.6 bits (83), Expect = 0.064,   Method: Compositional matrix adjust.
 Identities = 15/62 (24%), Positives = 33/62 (53%), Gaps = 13/62 (20%)

Query: 17 GSKQRLRVRKACEICKKRKIKCDGHQPCTSCTK-------------NSVQCVYKFTDTAS 63
           +K++ ++ K+C  C++  + CD  +PC+ C K             +++Q  Y++ ++ S
Sbjct: 5  AAKKQKKLYKSCIFCRRSHVNCDHQRPCSRCIKREIGHLCVADENVSNIQSQYQYKNSMS 64

Query: 64 PI 65
          PI
Sbjct: 65 PI 66

>Kwal_56.24670
          Length = 643

 Score = 36.6 bits (83), Expect = 0.066,   Method: Compositional matrix adjust.
 Identities = 16/42 (38%), Positives = 21/42 (50%), Gaps = 1/42 (2%)

Query: 16 NGSKQRLRVRKACEICKKRKIKCDGHQP-CTSCTKNSVQCVY 56
          N   +R   +  C  CK RK +C  H+P CT C +    CVY
Sbjct: 15 NTVGKRTHRKTGCIPCKIRKKRCSEHKPTCTDCERLGFTCVY 56

>CAGL0F07755g complement(755947..757782) similar to sp|P40969
          Saccharomyces cerevisiae YMR168c CEP3 kinetochore
          protein complex, start by similarity
          Length = 611

 Score = 36.6 bits (83), Expect = 0.069,   Method: Compositional matrix adjust.
 Identities = 14/32 (43%), Positives = 18/32 (56%), Gaps = 2/32 (6%)

Query: 26 KACEICKKRKIKCDGHQPCTSCTKNSV--QCV 55
          + C +C KRK+KCD   PC  C K     +CV
Sbjct: 12 RPCSVCSKRKVKCDRLVPCGHCRKRGTESECV 43

>Kwal_27.9688
          Length = 841

 Score = 36.6 bits (83), Expect = 0.070,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 30/55 (54%), Gaps = 6/55 (10%)

Query: 1  MDPSKYNDPSLYGKDNGSKQRLRVRKACEICKKRKIKCDGHQP-CTSCTKNSVQC 54
          M P K +D    GK+    +R++    C  C+ RK+KCD  +P C  C K+ ++C
Sbjct: 1  MKPRKSSDTK--GKE---VRRVKTFTGCWTCRSRKVKCDLGKPNCQRCEKSGLEC 50

>Kwal_23.2905
          Length = 881

 Score = 36.6 bits (83), Expect = 0.072,   Method: Compositional matrix adjust.
 Identities = 25/102 (24%), Positives = 42/102 (41%), Gaps = 3/102 (2%)

Query: 291 AHEIVSRLSFEWESFELIQSWLLIAFYLRTCHRQTSCWNALGSAIRMCKGMALYLNRFPQ 350
           A E +  L    +  E +   LLIA Y          W  +GSA+R+   + L+  +  +
Sbjct: 385 ASEYIDALFRSNDRMEALAGTLLIAKYSIMRPNVPGVWYTMGSALRLAVDLGLHAEKLNK 444

Query: 351 RHTLYEETKVKNCFWSCFIMDKVISFQMGR---YPDLSLPAE 389
            +  +     +  FW  F +D+ I    GR    PD ++  E
Sbjct: 445 NYDPFTRDFRRRLFWCTFSLDRQICAFFGRPFGIPDENISTE 486

 Score = 32.0 bits (71), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 14/34 (41%), Positives = 19/34 (55%), Gaps = 1/34 (2%)

Query: 23 RVRKACEICKKRKIKCDGHQP-CTSCTKNSVQCV 55
          R   AC+ C+ RK+KCD   P C+ C   +  CV
Sbjct: 44 RSIAACKRCRIRKVKCDQKFPSCSRCVSANEPCV 77

>CAGL0L04576g 526960..529557 similar to tr|Q12340 Saccharomyces
           cerevisiae YOR172w, hypothetical start
          Length = 865

 Score = 36.6 bits (83), Expect = 0.079,   Method: Compositional matrix adjust.
 Identities = 18/69 (26%), Positives = 37/69 (53%), Gaps = 2/69 (2%)

Query: 26  KACEICKKRKIKCDGHQP-CTSC-TKNSVQCVYKFTDTASPISKPKPGRSLDKESIANAL 83
           + C  C++RK+KCD  +P C++C ++    C+Y+ T     +   +   S+   ++   +
Sbjct: 38  RTCAFCRRRKLKCDNARPMCSTCVSRKFSTCIYEDTVDTRKVKLEEVFDSVPNLTLLKKV 97

Query: 84  LQLESSLLA 92
            +LE +L A
Sbjct: 98  EELEKALQA 106

>ADR199C [1940] [Homologous to ScYDR421W (ARO80) - SH]
          (1048530..1051364) [2835 bp, 944 aa]
          Length = 944

 Score = 36.6 bits (83), Expect = 0.081,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 26/48 (54%), Gaps = 8/48 (16%)

Query: 16 NGSKQRLRVRKACEICKKRKIKCD-------GHQPCTSCTKNSVQCVY 56
          +G K R R+ KAC  C+ RK++CD          PC  C++   +C++
Sbjct: 21 SGRKWR-RIYKACLNCRTRKVRCDLGPVDKPREPPCVRCSRERKECIF 67

>KLLA0F22880g 2123577..2127071 some similarities with
          ca|CA3639|IPF9251 Candida albicans unknown function,
          hypothetical start
          Length = 1164

 Score = 36.6 bits (83), Expect = 0.086,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 32/55 (58%), Gaps = 11/55 (20%)

Query: 26 KACEICKKRKIKCDGHQP-CTSCTKN--SVQCVY-------KFTDTASP-ISKPK 69
          K+C +C++RK++CD  +P C  C K+  +++C Y       KF    +P +S P+
Sbjct: 7  KSCLVCRRRKVRCDRAKPVCLVCVKHGSNMECNYEVQKREVKFVSMKTPDVSNPR 61

>AGL099C [4213] [Homologous to ScYDR207C (UME6) - SH]
           (516587..518830) [2244 bp, 747 aa]
          Length = 747

 Score = 36.2 bits (82), Expect = 0.089,   Method: Compositional matrix adjust.
 Identities = 15/35 (42%), Positives = 23/35 (65%), Gaps = 1/35 (2%)

Query: 23  RVRKACEICKKRKIKCDGHQP-CTSCTKNSVQCVY 56
           R R  C IC+ RK KC   +P C++C + +++CVY
Sbjct: 675 RSRTGCWICRLRKKKCSEERPQCSNCLRLNLECVY 709

>AFL160C [3035] [Homologous to ScYPL248C (GAL4) - SH]
          (130842..132788) [1947 bp, 648 aa]
          Length = 648

 Score = 36.2 bits (82), Expect = 0.097,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 28/48 (58%), Gaps = 1/48 (2%)

Query: 21 RLRVRKACEICKKRKIKCDGHQP-CTSCTKNSVQCVYKFTDTASPISK 67
          R  V +AC+ C++RK+KC    P C  C +++  C+Y      SP+++
Sbjct: 2  RPPVIQACDSCRRRKMKCSKTFPKCAKCREDNRVCLYSPKIRRSPLTR 49

>Scas_610.9
          Length = 809

 Score = 36.2 bits (82), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 14/39 (35%), Positives = 22/39 (56%), Gaps = 4/39 (10%)

Query: 23 RVRKACEICKKRKIKCDGH----QPCTSCTKNSVQCVYK 57
          R + AC  C+++K KCD +     PC+ C +  V C+ K
Sbjct: 14 RRKYACVECRQQKSKCDANDKAPNPCSKCARKGVPCILK 52

>YLR014C (PPR1) [3432] chr12 complement(172267..174981)
          Transcription factor regulating pyrimidine pathway,
          contains a Zn[2]-Cys[6] fungal-type binuclear cluster
          domain in the N-terminal region [2715 bp, 904 aa]
          Length = 904

 Score = 36.2 bits (82), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 16/34 (47%), Positives = 20/34 (58%), Gaps = 1/34 (2%)

Query: 23 RVRKACEICKKRKIKCDGHQP-CTSCTKNSVQCV 55
          + R AC+ C+ +KIKCD   P C  C K  V CV
Sbjct: 29 KSRTACKRCRLKKIKCDQEFPSCKRCAKLEVPCV 62

 Score = 32.3 bits (72), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 19/101 (18%), Positives = 40/101 (39%), Gaps = 2/101 (1%)

Query: 291 AHEIVSRLSFEWESFELIQSWLLIAFYLRTCHRQTSCWNALGSAIRMCKGMALYLNRFPQ 350
           A + ++ L    +  E +   LL+  Y          W  +GS +R+   + L+  +  +
Sbjct: 424 ATKYIASLFSSSDRLEALAGTLLMVIYSIMRPNVPGVWYTMGSVLRLTVDLGLHSEKINK 483

Query: 351 RHTLYEETKVKNCFWSCFIMDKVISFQMGRYPDLSLPAEQM 391
            +  +     +  FW  + +D+ I    GR     +P E +
Sbjct: 484 NYDAFTREIRRRLFWCVYSLDRQICSYFGR--PFGIPEESI 522

>KLLA0D00396g complement(36277..37362) some similarities with
          ca|CA2346|CaSEF1 Candida albicans Putative
          transcription factor1, hypothetical start
          Length = 361

 Score = 35.8 bits (81), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 14/42 (33%), Positives = 23/42 (54%), Gaps = 4/42 (9%)

Query: 22 LRVRKACEICKKRKIKCDGHQ----PCTSCTKNSVQCVYKFT 59
          L+  ++C  C+K K+KCD       PCT+C+K  + C   + 
Sbjct: 2  LKPLRSCTRCRKNKVKCDSANTRPGPCTACSKRGLVCTLDYV 43

>Scas_626.6
          Length = 839

 Score = 36.2 bits (82), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 13/36 (36%), Positives = 21/36 (58%), Gaps = 1/36 (2%)

Query: 20 QRLRVRKACEICKKRKIKCDGHQP-CTSCTKNSVQC 54
          +R +    C  C+ RK+KCD  +P C  C K+ ++C
Sbjct: 13 RRAKTFTGCWTCRSRKVKCDLRRPGCVRCDKSGLEC 48

>KLLA0E19701g complement(1739869..1741914) some similarities with
          sp|P26370 Saccharomyces cerevisiae YDL170w UGA3
          transcriptional activator for GABA catabolic genes
          singleton, hypothetical start
          Length = 681

 Score = 35.8 bits (81), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 15/39 (38%), Positives = 22/39 (56%), Gaps = 1/39 (2%)

Query: 19 KQRLRVRKACEICKKRKIKCDGHQP-CTSCTKNSVQCVY 56
          K+R   +K C  CK RK +C   +P C  C + S+ CV+
Sbjct: 11 KRRRHSKKGCLTCKVRKKRCSEDRPICKDCARLSLDCVF 49

>Kwal_26.8662
          Length = 355

 Score = 35.4 bits (80), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 13/38 (34%), Positives = 22/38 (57%)

Query: 15 DNGSKQRLRVRKACEICKKRKIKCDGHQPCTSCTKNSV 52
          D   K+R +V KAC  C++  + C+  +PC+ C K  +
Sbjct: 3  DQIQKKRKKVSKACIYCRRSHMICNEQRPCSRCVKRDI 40

>Kwal_47.17233
          Length = 948

 Score = 35.8 bits (81), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 20/47 (42%), Positives = 24/47 (51%), Gaps = 3/47 (6%)

Query: 20 QRLRVRK--ACEICKKRKIKCDGHQP-CTSCTKNSVQCVYKFTDTAS 63
          Q  R RK  +C  C KRKIKC    P C+ C K + +C Y   D  S
Sbjct: 25 QHRRQRKILSCVPCHKRKIKCTRETPSCSKCLKKNWECSYFLNDRIS 71

>ACL093C [956] [Homologous to ScYIR023W (DAL81) - SH]
           (178239..181271) [3033 bp, 1010 aa]
          Length = 1010

 Score = 36.2 bits (82), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 45/201 (22%), Positives = 85/201 (42%), Gaps = 37/201 (18%)

Query: 197 LDIVNKLLR--------FYFDHLNPVFSIVHEQVFLQQFNTGFLNKRRNSSKLFISMLYL 248
           +D+V KL+          +F  ++P F I+HE+VFL++++  +        +L   +L  
Sbjct: 335 VDLVEKLVHPHGKILVDIFFKLIHPYFPILHERVFLEKYSKSY-------RELTAPILAS 387

Query: 249 ILATSLRFYEGYSQSQPVAFSQHQLDWLFKTNSSLEERLFHFAHEIVSRLSF---EWESF 305
           I + +L++++ + Q+  V F   + D + + N            EI  R  F   E    
Sbjct: 388 IYSLALQWWDFHPQA--VGF--QRPDVIDQLN------------EIALRTFFDVLERPKL 431

Query: 306 ELIQSWLLIAFYLRTCHRQTSCWNALGSAIRMCKGMALYLNRFPQRHTLYEETKVKNCFW 365
            ++Q+ LLI      C    + W      + + + + L ++    R   +E    +   W
Sbjct: 432 SIVQTGLLILQCRSEC---PNNWILCSEVVALAEDLGLGIDCKDWRLPSWERGLRRRLAW 488

Query: 366 SCFIMDKVISFQMGRYPDLSL 386
           + +  DK IS    RY  L L
Sbjct: 489 AVWYQDKWISMLEARYSHLIL 509

 Score = 31.6 bits (70), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 10/32 (31%), Positives = 18/32 (56%), Gaps = 3/32 (9%)

Query: 28  CEICKKRKIKC---DGHQPCTSCTKNSVQCVY 56
           C+ C++R++KC     H  C  C    ++CV+
Sbjct: 119 CDHCRRRQVKCVTVAEHSNCLQCETKGIKCVF 150

>KLLA0D10197g complement(861726..864296) similar to sp|P05085
          Saccharomyces cerevisiae YML099c ARG81 transcription
          factor involved in arginine metabolism singleton, start
          by similarity
          Length = 856

 Score = 35.8 bits (81), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 14/38 (36%), Positives = 21/38 (55%), Gaps = 1/38 (2%)

Query: 18 SKQRLRVRKACEICKKRKIKCDGHQP-CTSCTKNSVQC 54
          +K R++    C  C+ RK+KCD  +P C  C K  + C
Sbjct: 4  AKPRVKTFTGCWTCRSRKVKCDLRRPGCERCEKGGLIC 41

>Scas_709.65*
          Length = 651

 Score = 35.8 bits (81), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 13/42 (30%), Positives = 26/42 (61%), Gaps = 3/42 (7%)

Query: 18 SKQRLRVRKACEICKKRKIKCDGH---QPCTSCTKNSVQCVY 56
          +++R +  +AC+ C  R+IKCD +   + C+ C K   +C++
Sbjct: 34 NRKRKKASRACDQCHHRRIKCDFNPETRNCSGCEKTEEKCLF 75

>KLLA0F18084g complement(1652031..1654613) no similarity,
          hypothetical start
          Length = 860

 Score = 35.8 bits (81), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 13/33 (39%), Positives = 20/33 (60%), Gaps = 1/33 (3%)

Query: 27 ACEICKKRKIKCDGHQP-CTSCTKNSVQCVYKF 58
          +C+ C+K + KCD  +P C  C K  + CVY+ 
Sbjct: 4  SCQNCRKTRRKCDRGKPTCARCIKYKIDCVYEL 36

>AGR280C [4591] [Homologous to ScYLR278C - SH] (1266918..1270238)
          [3321 bp, 1106 aa]
          Length = 1106

 Score = 35.8 bits (81), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 13/31 (41%), Positives = 22/31 (70%), Gaps = 1/31 (3%)

Query: 26 KACEICKKRKIKCDGHQP-CTSCTKNSVQCV 55
          ++C +C++RK +CD   P CT+C K  V+C+
Sbjct: 39 RSCLLCQRRKQRCDHKIPSCTACLKAGVRCI 69

>YJL103C (YJL103C) [2812] chr10 complement(228942..230798) Protein
          with similarity to transcription factors, contains a
          Zn[2]-Cys[6] fungal-type binuclear cluster domain in
          the N-terminal region [1857 bp, 618 aa]
          Length = 618

 Score = 35.4 bits (80), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 12/34 (35%), Positives = 21/34 (61%)

Query: 19 KQRLRVRKACEICKKRKIKCDGHQPCTSCTKNSV 52
          + R  ++ ACE C  + I+CD  +PC +C K ++
Sbjct: 11 QTRKSIQTACEFCHTKHIQCDVGRPCQNCLKRNI 44

>YDR303C (RSC3) [1131] chr4 complement(1068721..1071378) Component
          of the abundant RSC chromatin remodeling complex [2658
          bp, 885 aa]
          Length = 885

 Score = 35.8 bits (81), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 24/39 (61%), Gaps = 2/39 (5%)

Query: 20 QRLRVRKACEICKKRKIKCDGHQP-CTSCTK-NSVQCVY 56
          ++++   AC  C+KRKI CD  +P C +C K N + C Y
Sbjct: 6  RKMKKPPACVQCRKRKIGCDRVKPICGNCMKHNKMDCFY 44

>KLLA0D12650g complement(1073580..1075535) weakly similar to
          ca|CA2184|IPF6874.3 Candida albicans unknown function,
          3-prime end, hypothetical start
          Length = 651

 Score = 35.4 bits (80), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 24/41 (58%), Gaps = 1/41 (2%)

Query: 23 RVRKACEICKKRKIKCDGHQP-CTSCTKNSVQCVYKFTDTA 62
          R  + C  C+ R  KCD  +P C+ C +N ++CV++  + A
Sbjct: 27 RSSRGCLTCRDRHKKCDEKKPLCSGCKENFLRCVWRDNEEA 67

>AAL057C [130] [Homologous to ScYDR303C (RSC3) - SH; ScYHR056C
          (RSC30) - SH] (246899..249328) [2430 bp, 809 aa]
          Length = 809

 Score = 35.4 bits (80), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 20/67 (29%), Positives = 34/67 (50%), Gaps = 8/67 (11%)

Query: 20 QRLRVRKACEICKKRKIKCDGHQP-CTSCTKNS-VQCVYK-----FTDTASPISKPKPGR 72
          ++++   AC  C+KRKI CD  +P C +C +N    C Y      +  +    + P PG+
Sbjct: 8  RKMKKPPACVQCRKRKIGCDRAKPLCGNCVRNGKSDCFYPDIPGVYAQSGGGGATP-PGK 66

Query: 73 SLDKESI 79
          S +  S+
Sbjct: 67 SAELASV 73

>ABL099W [493] [Homologous to ScYDR034C (LYS14) - SH]
           complement(212832..215234) [2403 bp, 800 aa]
          Length = 800

 Score = 35.4 bits (80), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 14/38 (36%), Positives = 23/38 (60%), Gaps = 1/38 (2%)

Query: 20  QRLRVRKACEICKKRKIKCDGHQP-CTSCTKNSVQCVY 56
           +R   R  C  CK+R++KCD  +P C  C++ + +C Y
Sbjct: 189 KRKYSRNGCTECKRRRMKCDEGKPICWQCSRLNRECKY 226

>Kwal_23.3178
          Length = 611

 Score = 35.0 bits (79), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 30/59 (50%), Gaps = 5/59 (8%)

Query: 2   DPSKYNDPSLYGKDNGSKQRLRVRKACEICKKRKIKCDGHQP-CTSCTKNSVQCVYKFT 59
           DP+   D      ++GS    R R  C IC+ RK KC   +P C +C + ++QC Y  T
Sbjct: 523 DPTSPKDKPRRKNNSGS----RSRTGCWICRLRKKKCTEEKPSCHNCLRLNLQCFYDHT 577

>CAGL0M05907g 622029..624704 similar to sp|P36023 Saccharomyces
          cerevisiae YKR064w, hypothetical start
          Length = 891

 Score = 35.0 bits (79), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 16/41 (39%), Positives = 22/41 (53%), Gaps = 2/41 (4%)

Query: 18 SKQRLRVRKACEICKKRKIKCDGHQPCTSCTK--NSVQCVY 56
          +K R R    C  C+KRK KCD   PC+ C +  ++  C Y
Sbjct: 8  TKSRRRPMLVCVNCRKRKSKCDRQLPCSKCIQHGDTDTCTY 48

>YBL066C (SEF1) [131] chr2 complement(96906..100079) Protein with
           similarity to transcription factors, has Zn[2]-Cys[6]
           fungal-type binuclear cluster domain in the N-terminal
           region [3174 bp, 1057 aa]
          Length = 1057

 Score = 35.0 bits (79), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 29/64 (45%), Gaps = 10/64 (15%)

Query: 15  DNGSKQRLRVRKACEICKKRKIKCDGHQ----PCTSCTKNSVQCVYKFTDTASPISKPKP 70
           D+  +   R   +C  C++ KIKCD  Q    PC+ C K  + C        +P  +PK 
Sbjct: 44  DDSHQINHRPVTSCTHCRQHKIKCDASQNFPHPCSRCEKIGLHC------EINPQFRPKK 97

Query: 71  GRSL 74
           G  L
Sbjct: 98  GSQL 101

>Kwal_26.8109
          Length = 970

 Score = 35.0 bits (79), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 14/42 (33%), Positives = 25/42 (59%), Gaps = 3/42 (7%)

Query: 19 KQRLRVRKACEICKKRKIKCD--GHQP-CTSCTKNSVQCVYK 57
          ++R +  +AC+ C+ +K +CD     P CTSC + S  C ++
Sbjct: 30 RRRSKTSRACDQCRGKKTRCDFSDENPVCTSCQRMSKTCTFE 71

>YML099C (ARG81) [3872] chr13 complement(74398..77040) Component
          of the ARGR regulatory complex, contains a Zn[2]-Cys[6]
          fungal-type binuclear cluster domain [2643 bp, 880 aa]
          Length = 880

 Score = 35.0 bits (79), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 16/42 (38%), Positives = 23/42 (54%), Gaps = 3/42 (7%)

Query: 16 NGSKQRLRVRK--ACEICKKRKIKCDGHQP-CTSCTKNSVQC 54
          NG K+  R +    C  C+ RK+KCD   P C  C K+++ C
Sbjct: 7  NGPKKMGRAKTFTGCWTCRGRKVKCDLRHPHCQRCEKSNLPC 48

>YDR421W (ARO80) [1245] chr4 (1312028..1314880) Positive
          transcription regulator of ARO9 and ARO10, member of
          the Zn2Cys6 transcription factor family [2853 bp, 950
          aa]
          Length = 950

 Score = 35.0 bits (79), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 23/78 (29%), Positives = 33/78 (42%), Gaps = 18/78 (23%)

Query: 20 QRLRVRKACEICKKRKIKCD-------GHQPCTSCTKNSVQCVYKFTDTAS--------- 63
          +R R  +AC  C+ RK+KCD          PC  C +   +C++      S         
Sbjct: 17 KRRRTYQACISCRSRKVKCDLGPVDNPHDPPCARCKRELKKCIFSSNKGTSNDLPPNSIN 76

Query: 64 PISKPKPGRSLDKESIAN 81
           IS P  G+S  K+ I N
Sbjct: 77 AISLPSLGKS--KQEIQN 92

>YIL136W (OM45) [2540] chr9 (93619..94800) Protein of the outer
           mitochondrial membrane [1182 bp, 393 aa]
          Length = 393

 Score = 34.7 bits (78), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 15/35 (42%), Positives = 19/35 (54%)

Query: 127 KYRFHRRYQNLLPYYLGQSLMQSLPPQTIQHHNLK 161
           K +  RR  N+  YY GQ    S PPQ  + HN+K
Sbjct: 26  KAKGQRREGNVSAYYNGQEYGSSAPPQLGKLHNIK 60

>Scas_657.3
          Length = 856

 Score = 35.0 bits (79), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 16/40 (40%), Positives = 24/40 (60%), Gaps = 3/40 (7%)

Query: 27 ACEICKKRKIKCDGHQP-CTSCT-KNSVQCVYKFTDTASP 64
          +C  C++RK+KCD  +P C++C  +    CVY   D  SP
Sbjct: 44 SCAFCRQRKLKCDQKRPICSTCIGRKLTTCVYA-DDNLSP 82

>KLLA0C08657g 757100..759268 some similarities with
          ca|CA3551|IPF13229 Candida albicans unknown function,
          hypothetical start
          Length = 722

 Score = 34.7 bits (78), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 20/61 (32%), Positives = 26/61 (42%), Gaps = 5/61 (8%)

Query: 13 GKDNGSKQRLRVRKACEICKKRKIKC-----DGHQPCTSCTKNSVQCVYKFTDTASPISK 67
           K   +K+  R  KAC+ CKK K KC      G   C  C      C ++   T SP+  
Sbjct: 9  AKKTPAKRGTRGVKACDYCKKLKAKCVPSPVPGEVRCLRCDSLKRHCSFEDLFTDSPVHA 68

Query: 68 P 68
          P
Sbjct: 69 P 69

>KLLA0F10417g 961004..962527 similar to sp|P38140 Saccharomyces
          cerevisiae YBR239c, start by similarity
          Length = 507

 Score = 34.7 bits (78), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 23/85 (27%), Positives = 38/85 (44%), Gaps = 9/85 (10%)

Query: 19 KQRLRVRKACEICKKRKIKCDGHQPCTSCTKNSVQ--CV------YKFTDTASPISKPKP 70
          K+  +V  AC  C K  + CD ++PCT C +  ++  C+       K+         P  
Sbjct: 4  KRNKKVSVACVHCAKSHVTCDDNRPCTRCIRKGLEESCIDAPRKKVKYLRDVPEDQLPSV 63

Query: 71 GRSLDKESIANAL-LQLESSLLAKI 94
           RS  +    NA+ L++E  +L  I
Sbjct: 64 LRSTKQVPPVNAVKLKMEPGILPNI 88

>Sklu_1373.2 YDR207C, Contig c1373 1069-2895
          Length = 608

 Score = 34.7 bits (78), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 15/35 (42%), Positives = 22/35 (62%), Gaps = 1/35 (2%)

Query: 23  RVRKACEICKKRKIKCDGHQP-CTSCTKNSVQCVY 56
           R R  C IC+ RK KC   +P C +CT+ +++C Y
Sbjct: 536 RSRTGCWICRLRKKKCTEEKPHCNNCTRLNLECFY 570

>Kwal_23.6529
          Length = 598

 Score = 34.7 bits (78), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 21/61 (34%), Positives = 25/61 (40%), Gaps = 4/61 (6%)

Query: 18 SKQRLRVRKACEICKKRKIKCDGHQP-CTSCTKNSV-QCVYKFTD--TASPISKPKPGRS 73
          S +  R R  C  CKK KIKCD  +P C  C K     C Y         P    K G+ 
Sbjct: 4  STKNQRSRGGCINCKKSKIKCDEKKPMCGQCAKKGRDDCAYALVLQWGGRPYKNAKKGKK 63

Query: 74 L 74
          +
Sbjct: 64 V 64

>Kwal_47.18089
          Length = 745

 Score = 34.3 bits (77), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 28/54 (51%), Gaps = 6/54 (11%)

Query: 27 ACEICKKRKIKCDGHQP-CTSCTKNSV-QCVY----KFTDTASPISKPKPGRSL 74
          +C  C+ RK+KCD  +P C SC    + +C+Y     F  T+  +   KP  +L
Sbjct: 28 SCTFCRHRKLKCDHKRPMCGSCAARKLPECIYVDSFNFQLTSDELFSNKPNVAL 81

>Kwal_14.819
          Length = 568

 Score = 34.3 bits (77), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 13/31 (41%), Positives = 19/31 (61%), Gaps = 1/31 (3%)

Query: 27 ACEICKKRKIKCDGHQP-CTSCTKNSVQCVY 56
          +C  C+ RK++C    P C SCTK + +C Y
Sbjct: 15 SCRQCRDRKVRCSRQIPKCKSCTKRNCECFY 45

>Scas_685.22
          Length = 777

 Score = 34.3 bits (77), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 20/61 (32%), Positives = 28/61 (45%), Gaps = 8/61 (13%)

Query: 17  GSKQRLRVRK-----ACEICKKRKIKCDGH---QPCTSCTKNSVQCVYKFTDTASPISKP 68
           G K   R RK     +C++C+K K +CD       C  C    + C     DT++P  KP
Sbjct: 47  GEKSLKRPRKKRKTFSCDVCRKFKTRCDFEVTVGKCHRCHVLQLDCSLSKEDTSTPNDKP 106

Query: 69  K 69
           K
Sbjct: 107 K 107

>CAGL0L03674g 420574..422463 some similarities with sp|P42950
          Saccharomyces cerevisiae YJL103c, hypothetical start
          Length = 629

 Score = 34.3 bits (77), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 11/24 (45%), Positives = 16/24 (66%)

Query: 26 KACEICKKRKIKCDGHQPCTSCTK 49
          KACE C ++ + CD  +PC +C K
Sbjct: 3  KACEFCHEKHLHCDPGRPCINCVK 26

>KLLA0D11286g complement(964642..966678) no similarity,
          hypothetical start
          Length = 678

 Score = 33.9 bits (76), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 19/41 (46%), Positives = 23/41 (56%), Gaps = 2/41 (4%)

Query: 21 RLRVRKACEICKKRKIKCDGHQP-CTSCTKNSVQCVYKFTD 60
          R R  K+C  C   K KCD  +P CT C K S+ C Y FT+
Sbjct: 19 RKRTPKSCIRCYSIKRKCDHKKPSCTRCFKKSLPCEY-FTE 58

>Kwal_23.4016
          Length = 628

 Score = 33.9 bits (76), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 13/39 (33%), Positives = 23/39 (58%), Gaps = 3/39 (7%)

Query: 27 ACEICKKRKIKC---DGHQPCTSCTKNSVQCVYKFTDTA 62
          AC+ C ++KIKC   +  + C  CT+  ++CV + T + 
Sbjct: 16 ACDNCYRKKIKCRRNNDEEKCAQCTRLKIRCVNRKTSSV 54

>CAGL0D03850g 384689..387193 weakly similar to sp|Q06639
          Saccharomyces cerevisiae YDR303c RSC3 or sp|P38781
          Saccharomyces cerevisiae YHR056c, hypothetical start
          Length = 834

 Score = 33.9 bits (76), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 23/38 (60%), Gaps = 4/38 (10%)

Query: 23 RVRK--ACEICKKRKIKCDGHQP-CTSCTK-NSVQCVY 56
          +V+K  AC+ C++RKI CD  +P C +C K     C Y
Sbjct: 9  KVKKPPACQQCRRRKIGCDRGKPICGNCLKQGKTDCFY 46

>Sklu_2268.2 YKR064W, Contig c2268 4260-6887 reverse complement
          Length = 875

 Score = 33.9 bits (76), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 15/41 (36%), Positives = 23/41 (56%), Gaps = 3/41 (7%)

Query: 19 KQRLRVRKACEICKKRKIKCDGHQP-CTSCTK--NSVQCVY 56
          ++R R    C  CK+RK KCD  +P C++C +  +   C Y
Sbjct: 4  RRRNRPTVVCSNCKRRKSKCDKQKPACSNCVRLGDEATCTY 44

>Scas_588.11
          Length = 835

 Score = 33.9 bits (76), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 23/39 (58%), Gaps = 2/39 (5%)

Query: 20 QRLRVRKACEICKKRKIKCDGHQP-CTSCTK-NSVQCVY 56
          +++R   AC  C+KRKI CD  +P C +C K N   C +
Sbjct: 6  RKMRKPPACVQCRKRKIGCDRVKPICGNCRKTNKGDCFF 44

>Sklu_2397.8 YML099C, Contig c2397 9784-12330
          Length = 848

 Score = 33.9 bits (76), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 12/36 (33%), Positives = 19/36 (52%), Gaps = 1/36 (2%)

Query: 20 QRLRVRKACEICKKRKIKCD-GHQPCTSCTKNSVQC 54
          +R +    C  C+ RK+KCD G   C  C ++  +C
Sbjct: 12 RRAKTFTGCWTCRSRKVKCDLGRPSCKRCERSGFEC 47

>KLLA0A10329g 903873..905792 some similarities with
          ca|CA6113|IPF100.3 Candida albicans zinc finger
          protein, 3-prime end (by homology), hypothetical start
          Length = 639

 Score = 33.5 bits (75), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 20/42 (47%), Gaps = 1/42 (2%)

Query: 19 KQRLRVRKACEICKKRKIKCDGHQP-CTSCTKNSVQCVYKFT 59
          K+  R    C+ CK  K KCD  +P C  C K   QC Y  T
Sbjct: 8  KKVARSYMGCQKCKSLKKKCDEVKPHCGYCKKRGFQCDYSRT 49

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.322    0.135    0.420 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 22,943,796
Number of extensions: 981997
Number of successful extensions: 3378
Number of sequences better than 10.0: 297
Number of HSP's gapped: 3344
Number of HSP's successfully gapped: 337
Length of query: 687
Length of database: 16,596,109
Length adjustment: 108
Effective length of query: 579
Effective length of database: 12,857,365
Effective search space: 7444414335
Effective search space used: 7444414335
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 65 (29.6 bits)