Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Sklu_2411.1050450425820.0
Kwal_26.820650650019280.0
YKL045W (PRI2)52850918490.0
Scas_625.952452018330.0
CAGL0L01749g50250017310.0
KLLA0F04818g49349815450.0
ABR056C48949914020.0
YIL071C (PCI8)444101701.7
YOR336W (KRE5)136556683.0
AER191W31451663.8
Kwal_26.720123466663.9
Sklu_2423.864789664.8
CAGL0D05654g31982655.2
YLR462W20258637.6
YEL075C12258619.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Sklu_2411.10
         (504 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Sklu_2411.10 YKL045W, Contig c2411 18845-20359                        999   0.0  
Kwal_26.8206                                                          747   0.0  
YKL045W (PRI2) [3214] chr11 (353138..354724) DNA primase large s...   716   0.0  
Scas_625.9                                                            710   0.0  
CAGL0L01749g 184351..185859 highly similar to sp|P20457 Saccharo...   671   0.0  
KLLA0F04818g 469283..470764 similar to sp|P20457 Saccharomyces c...   599   0.0  
ABR056C [647] [Homologous to ScYKL045W (PRI2) - SH] (498192..499...   544   0.0  
YIL071C (PCI8) [2600] chr9 complement(228657..229991) Protein th...    32   1.7  
YOR336W (KRE5) [5115] chr15 (949768..953865) Protein involved in...    31   3.0  
AER191W [2693] [Homologous to ScYNR003C (RPC34) - SH] complement...    30   3.8  
Kwal_26.7201                                                           30   3.9  
Sklu_2423.8 YDL074C, Contig c2423 13513-15456 reverse complement       30   4.8  
CAGL0D05654g complement(537378..538337) no similarity, hypotheti...    30   5.2  
YLR462W (YLR462W) [3835] chr12 (1065953..1066561) Protein of unk...    29   7.6  
YEL075C (YEL075C) [1356] chr5 complement(5345..5713) Protein of ...    28   9.0  

>Sklu_2411.10 YKL045W, Contig c2411 18845-20359
          Length = 504

 Score =  999 bits (2582), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 484/504 (96%), Positives = 484/504 (96%)

Query: 1   MFRQTKRKISSRRNFDNSTDASGQFILQATTSEGEQKLYEKLYSSKISFYDLPPQGEITL 60
           MFRQTKRKISSRRNFDNSTDASGQFILQATTSEGEQKLYEKLYSSKISFYDLPPQGEITL
Sbjct: 1   MFRQTKRKISSRRNFDNSTDASGQFILQATTSEGEQKLYEKLYSSKISFYDLPPQGEITL 60

Query: 61  DQFETWAIDRLKILLEIESCVQRNKTIKEIETIVKPLLQKSLPYNTDSFQDRKKDYYSHF 120
           DQFETWAIDRLKILLEIESCVQRNKTIKEIETIVKPLLQKSLPYNTDSFQDRKKDYYSHF
Sbjct: 61  DQFETWAIDRLKILLEIESCVQRNKTIKEIETIVKPLLQKSLPYNTDSFQDRKKDYYSHF 120

Query: 121 ILRLCFCRSKELREKFTRSETLLFKIRFNMLTSQDQTKFVQSLNLPLLQFISDEEKANLS 180
           ILRLCFCRSKELREKFTRSETLLFKIRFNMLTSQDQTKFVQSLNLPLLQFISDEEKANLS
Sbjct: 121 ILRLCFCRSKELREKFTRSETLLFKIRFNMLTSQDQTKFVQSLNLPLLQFISDEEKANLS 180

Query: 181 QQLYQTIAPAXXXXXXXXXXXXXXXXXXXXKFIKLPFESVIELVGSRQVFVSRGFAYLPQ 240
           QQLYQTIAPA                    KFIKLPFESVIELVGSRQVFVSRGFAYLPQ
Sbjct: 181 QQLYQTIAPALQFQLSLSEEQQRRQFFQQEKFIKLPFESVIELVGSRQVFVSRGFAYLPQ 240

Query: 241 FQQLNHIANEFSTKLSTEMLKTYQHLPRLNEDDRLLPILHHLSSGYAIVDFQQQGNEYGA 300
           FQQLNHIANEFSTKLSTEMLKTYQHLPRLNEDDRLLPILHHLSSGYAIVDFQQQGNEYGA
Sbjct: 241 FQQLNHIANEFSTKLSTEMLKTYQHLPRLNEDDRLLPILHHLSSGYAIVDFQQQGNEYGA 300

Query: 301 DNGDITAKMVYSDEIVSNFPLCAKNLMRGLQTNHHLRYQGRQQLSLFLKGIGLNVDEALK 360
           DNGDITAKMVYSDEIVSNFPLCAKNLMRGLQTNHHLRYQGRQQLSLFLKGIGLNVDEALK
Sbjct: 301 DNGDITAKMVYSDEIVSNFPLCAKNLMRGLQTNHHLRYQGRQQLSLFLKGIGLNVDEALK 360

Query: 361 FWSDAFGRNGGMSIDKFNKEYKYNFRHNYGLEGNRINYKPWDCRTILSKPRPARGEFHGC 420
           FWSDAFGRNGGMSIDKFNKEYKYNFRHNYGLEGNRINYKPWDCRTILSKPRPARGEFHGC
Sbjct: 361 FWSDAFGRNGGMSIDKFNKEYKYNFRHNYGLEGNRINYKPWDCRTILSKPRPARGEFHGC 420

Query: 421 PYRDWNVEKLSSELSQNLKLTPTQVTGVLDSCQRNEFTVACTKVFELTHGSSTTEINEQS 480
           PYRDWNVEKLSSELSQNLKLTPTQVTGVLDSCQRNEFTVACTKVFELTHGSSTTEINEQS
Sbjct: 421 PYRDWNVEKLSSELSQNLKLTPTQVTGVLDSCQRNEFTVACTKVFELTHGSSTTEINEQS 480

Query: 481 HIAHPNLYYDRSRQLQKKQLEKES 504
           HIAHPNLYYDRSRQLQKKQLEKES
Sbjct: 481 HIAHPNLYYDRSRQLQKKQLEKES 504

>Kwal_26.8206
          Length = 506

 Score =  747 bits (1928), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 355/500 (71%), Positives = 407/500 (81%), Gaps = 2/500 (0%)

Query: 1   MFRQTKRKISSRRNFDNST-DASGQFILQATTSEGEQKLYEKLYSSKISFYDLPPQGEIT 59
           MFRQ KR+I+SRRNF     D+SG+FIL  TT+E E KLYE LY SK+SFY +PP+GEIT
Sbjct: 1   MFRQAKRRITSRRNFAGQVGDSSGKFILDGTTTEEESKLYESLYESKLSFYQMPPKGEIT 60

Query: 60  LDQFETWAIDRLKILLEIESCVQRNKTIKEIETIVKPLLQKSLPYNTDSFQDRKKDYYSH 119
           L+QFE WAI+RLK+LLEIESC+QRNK+ KE+E IVKPLL K LP  +D  QDRKKDYYSH
Sbjct: 61  LEQFEVWAINRLKVLLEIESCIQRNKSPKEMEIIVKPLLNKLLPSTSDDLQDRKKDYYSH 120

Query: 120 FILRLCFCRSKELREKFTRSETLLFKIRFNMLTSQDQTKFVQSLNLPLLQFISDEEKANL 179
           FILRLCFCRSKELR+K  RSET L K+RFNMLTS+DQ KFVQ+LNLP LQFI+DEEK  L
Sbjct: 121 FILRLCFCRSKELRDKVIRSETALLKLRFNMLTSRDQAKFVQTLNLPFLQFITDEEKEQL 180

Query: 180 SQQLYQTIAPAXXXXXXXXXXXXXXXXXXXXKFIKLPFESVIELVGSRQVFVSRGFAYLP 239
           S QLYQTI+ A                    KFIKLPFESVI+LVGSRQVF+ +G+AYLP
Sbjct: 181 STQLYQTISSALQFQLNLTDETQRRQYFNQEKFIKLPFESVIDLVGSRQVFIKKGYAYLP 240

Query: 240 QFQQLNHIANEFSTKLSTEMLKTYQHLPRLNEDDRLLPILHHLSSGYAIVDFQQQGNEYG 299
           QFQQLNHIANEFS  LS  + KTYQ +PRLNEDDRLLPILHHLSSGY I +FQQQ     
Sbjct: 241 QFQQLNHIANEFSNMLSLALSKTYQSIPRLNEDDRLLPILHHLSSGYTISNFQQQDQFNQ 300

Query: 300 ADNGDITAKMVYSDEIVSNFPLCAKNLMRGLQTNHHLRYQGRQQLSLFLKGIGLNVDEAL 359
           A  G++TA  VYSD+I  NFPLCAKNLM GL+ NHHLRYQGRQQLS FLKGIG++VDEAL
Sbjct: 301 ASQGEVTATSVYSDKIRENFPLCAKNLMNGLKENHHLRYQGRQQLSFFLKGIGMDVDEAL 360

Query: 360 KFWSDAFGRNGGMSIDKFNKEYKYNFRHNYGLEGNRINYKPWDCRTILSKPRPARGEFHG 419
           +FWSDAF   G M+ DKF KEY+YNFRHNYGLEGNRINYKPWDCRTILS+PRP+RGE+HG
Sbjct: 361 QFWSDAFTSGGHMTADKFTKEYRYNFRHNYGLEGNRINYKPWDCRTILSRPRPSRGEYHG 420

Query: 420 CPYRDWNVEKLSSELSQNLKLTPTQVTGVLDSCQRNEFTVACTKVFELTH-GSSTTEINE 478
           CPYRDWN ++LS ELSQ + LTP QVT VLDS QR E+T+ACTKVFE+TH G++  E+N+
Sbjct: 421 CPYRDWNADRLSMELSQGMSLTPAQVTSVLDSVQRTEYTIACTKVFEMTHGGAANVEVND 480

Query: 479 QSHIAHPNLYYDRSRQLQKK 498
           Q+HIAHPNLYY+RSRQ QKK
Sbjct: 481 QTHIAHPNLYYERSRQFQKK 500

>YKL045W (PRI2) [3214] chr11 (353138..354724) DNA primase large
           subunit (DNA polymerase alpha 58 kDa subunit), involved
           in synthesis of RNA primers for Okazaki fragments [1587
           bp, 528 aa]
          Length = 528

 Score =  716 bits (1849), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 345/509 (67%), Positives = 420/509 (82%), Gaps = 17/509 (3%)

Query: 1   MFRQTKRKISSRRNFDN------------STDASGQFILQATTSEGEQKLYEKLYSSKIS 48
           MFRQ+KR+I+SR+NF +            +T+A+ Q IL +++SE E+KLY +LY SK+S
Sbjct: 1   MFRQSKRRIASRKNFSSYDDIVKSELDVGNTNAANQIILSSSSSEEEKKLYARLYESKLS 60

Query: 49  FYDLPPQGEITLDQFETWAIDRLKILLEIESCVQRNKTIKEIETIVKPLLQKSLPYNTDS 108
           FYDLPPQGEITL+QFE WAIDRLKILLEIESC+ RNK+IKEIETI+KP  QK LP+NT+S
Sbjct: 61  FYDLPPQGEITLEQFEIWAIDRLKILLEIESCLSRNKSIKEIETIIKPQFQKLLPFNTES 120

Query: 109 FQDRKKDYYSHFILRLCFCRSKELREKFTRSETLLFKIRFNMLTSQDQTKFVQSLNLPLL 168
            +DRKKDYYSHFILRLCFCRSKELREKF R+ET LFKIRFNMLTS DQTKFVQSL+LPLL
Sbjct: 121 LEDRKKDYYSHFILRLCFCRSKELREKFVRAETFLFKIRFNMLTSTDQTKFVQSLDLPLL 180

Query: 169 QFISDEEKANLSQQLYQTIAPAXXXXXXXXXXXXXXXXXXXXKFIKLPFESVIELVGSRQ 228
           QFIS+EEKA LS QLYQT++ +                    KFIKLPFE+VIELVG+R 
Sbjct: 181 QFISNEEKAELSHQLYQTVSASLQFQLNLNEEHQRKQYFQQEKFIKLPFENVIELVGNRL 240

Query: 229 VFVSRGFAYLPQFQQLNHIANEFSTKLSTEMLKTYQHLPRLNEDDRLLPILHHLSSGYAI 288
           VF+  G+AYLPQFQQLN ++NEF++KL+ E++KTYQ+LPRLNEDDRLLPIL+HLSSGY I
Sbjct: 241 VFLKDGYAYLPQFQQLNLLSNEFASKLNQELIKTYQYLPRLNEDDRLLPILNHLSSGYTI 300

Query: 289 VDF-QQQGNEYGADNGD-ITAKMVYSDEIVSNFPLCAKNLMRGLQTNHHLRYQGRQQLSL 346
            DF QQ+ N++  +  D I A+ V+S+EI SN+PLC KNLM GL+ NHHLRY GRQQLSL
Sbjct: 301 ADFNQQKANQFSENVDDEINAQSVWSEEISSNYPLCIKNLMEGLKKNHHLRYYGRQQLSL 360

Query: 347 FLKGIGLNVDEALKFWSDAFGRNGGMSIDKFNKEYKYNFRHNYGLEGNRINYKPWDCRTI 406
           FLKGIGL+ DEALKFWS+AF RNG M+++KFNKEY+Y+FRHNYGLEGNRINYKPWDC TI
Sbjct: 361 FLKGIGLSADEALKFWSEAFTRNGNMTMEKFNKEYRYSFRHNYGLEGNRINYKPWDCHTI 420

Query: 407 LSKPRPARGEFHGCPYRDWNVEKLSSELSQNLKLTPTQVTGVLDSCQRNEFTVACTKVFE 466
           LSKPRP RG++HGCP+RDW+ E+LS+EL +++KLT  Q+  VLDSCQ+ E+T+ACTKVFE
Sbjct: 421 LSKPRPGRGDYHGCPFRDWSHERLSAEL-RSMKLTQAQIISVLDSCQKGEYTIACTKVFE 479

Query: 467 LTHGSSTT--EINEQSHIAHPNLYYDRSR 493
           +TH S++   EI EQ+HIAHPNLY++RSR
Sbjct: 480 MTHNSASADLEIGEQTHIAHPNLYFERSR 508

>Scas_625.9
          Length = 524

 Score =  710 bits (1833), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 341/520 (65%), Positives = 411/520 (79%), Gaps = 18/520 (3%)

Query: 1   MFRQTKRKISSRRNFDNSTDASG------------QFILQATTSEGEQKLYEKLYSSKIS 48
           MFRQ KR+ISSRRNFD+S   S             QFIL  +T+E E+ LY  +Y SKIS
Sbjct: 1   MFRQNKRRISSRRNFDSSPFGSDNKNGNENNGGANQFILPGSTTEEEKTLYNNIYDSKIS 60

Query: 49  FYDLPPQGEITLDQFETWAIDRLKILLEIESCVQRNKTIKEIETIVKPLLQKSLPYNTDS 108
           FY+  PQGEITL+QFE WAIDRLKILLEIESC+ RNKT+KEIET++KP  QK LP+NTDS
Sbjct: 61  FYEARPQGEITLEQFEVWAIDRLKILLEIESCLSRNKTLKEIETLIKPQFQKLLPFNTDS 120

Query: 109 FQDRKKDYYSHFILRLCFCRSKELREKFTRSETLLFKIRFNMLTSQDQTKFVQSLNLPLL 168
           F D+KKDYYSHFILRLCFCR+KELREKF R+ETLLFKIRFNMLTS DQ KFV+SLNL  L
Sbjct: 121 FLDKKKDYYSHFILRLCFCRTKELREKFIRAETLLFKIRFNMLTSFDQIKFVKSLNLSKL 180

Query: 169 QFISDEEKANLSQQLYQTIAPAXXXXXXXXXXXXXXXXXXXXKFIKLPFESVIELVGSRQ 228
           QFI+DEEK  LS +LYQTI PA                    KFIKLPFE+VIELVG+RQ
Sbjct: 181 QFITDEEKTELSDKLYQTITPALIYQLNLTDENQRKLFFQNEKFIKLPFENVIELVGNRQ 240

Query: 229 VFVSRGFAYLPQFQQLNHIANEFSTKLSTEMLKTYQHLPRLNEDDRLLPILHHLSSGYAI 288
            F+ +GF Y+PQFQQLN I+ EFS KL+  ++KTYQ LPRLNEDDRLLPIL+HLSSGY I
Sbjct: 241 AFIRKGFIYIPQFQQLNLISTEFSNKLNEALMKTYQFLPRLNEDDRLLPILNHLSSGYTI 300

Query: 289 VDFQQQ---GNEYGADNGDITAKMVYSDEIVSNFPLCAKNLMRGLQTNHHLRYQGRQQLS 345
            DF +    G     ++ +I A+ VYS+EI +N+PLC KNL RGL+ + HL+Y GRQQLS
Sbjct: 301 ADFNENSKFGMYQNGNDDEINAQTVYSEEISANYPLCIKNLFRGLKEHGHLKYHGRQQLS 360

Query: 346 LFLKGIGLNVDEALKFWSDAFGRNGGMSIDKFNKEYKYNFRHNYGLEGNRINYKPWDCRT 405
           LFLKGIGL+ DE+LKFWS+AF +NG M++DKFNKEY+YNFRHNYGLEGNRINYKPWDCRT
Sbjct: 361 LFLKGIGLSADESLKFWSEAFTKNGRMTVDKFNKEYRYNFRHNYGLEGNRINYKPWDCRT 420

Query: 406 ILSKPRPARGEFHGCPYRDWNVEKLSSELSQNLKLTPTQVTGVLDSCQRNEFTVACTKVF 465
           ILSKPRP RGE+HGCPYRDWN +KL++EL +++ LTP+Q+  +LDSC++ E+T+ACTK F
Sbjct: 421 ILSKPRPGRGEYHGCPYRDWNPDKLTAEL-RSMNLTPSQIASILDSCEKTEYTIACTKTF 479

Query: 466 ELTHGSSTT--EINEQSHIAHPNLYYDRSRQLQKKQLEKE 503
           E TH ++ T  EI++Q+HI+HPNLY++RSRQLQKK+ E E
Sbjct: 480 EFTHNTTGTDLEIDDQTHISHPNLYFERSRQLQKKKQEME 519

>CAGL0L01749g 184351..185859 highly similar to sp|P20457
           Saccharomyces cerevisiae YKL045w PRI2, start by
           similarity
          Length = 502

 Score =  671 bits (1731), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 320/500 (64%), Positives = 399/500 (79%), Gaps = 6/500 (1%)

Query: 1   MFRQTKRKISSRRNFDNSTDASGQFILQATTSEGEQKLYEKLYSSKISFYDLPPQGEITL 60
           MFRQ+K+++S RRNF      +   I+ ATT+E E+KLY+++Y +K+SFYD+PPQGEITL
Sbjct: 1   MFRQSKKRVSMRRNFAEDRGDASAIIIGATTTEEEKKLYQRIYENKLSFYDIPPQGEITL 60

Query: 61  DQFETWAIDRLKILLEIESCVQRNKTIKEIETIVKPLLQK-SLPYNTDSFQDRKKDYYSH 119
           ++FE WAIDRLK+LLEIESC+ RNKT+KEIE I+KPL +K ++  N D+F+DRKK+YYSH
Sbjct: 61  EEFEIWAIDRLKLLLEIESCLARNKTLKEIEGIIKPLFKKYNIFNNMDTFEDRKKEYYSH 120

Query: 120 FILRLCFCRSKELREKFTRSETLLFKIRFNMLTSQDQTKFVQSLNLPLLQFISDEEKANL 179
           FILRLCFC+SKELR+KF R ET+L ++RFNML+S DQ KFV+SLNLP LQFI +EEKA L
Sbjct: 121 FILRLCFCKSKELRDKFVRIETMLLRLRFNMLSSTDQAKFVKSLNLPSLQFIDEEEKAEL 180

Query: 180 SQQLYQTIAPAXXXXXXXXXXXXXXXXXXXXKFIKLPFESVIELVGSRQVFVSRGFAYLP 239
           S QLYQTI+                      KFIKLPFESVIELVG+RQVF+  G+AYLP
Sbjct: 181 STQLYQTISRDLQFTLNLADEQQRQLYFKNEKFIKLPFESVIELVGNRQVFLKNGYAYLP 240

Query: 240 QFQQLNHIANEFSTKLSTEMLKTYQHLPRLNEDDRLLPILHHLSSGYAIVDFQQQGNEYG 299
           QFQQLN IANEFSTKL  E++KTYQ+LPRLNEDDRL+PIL+HLSSGY I D     +++G
Sbjct: 241 QFQQLNLIANEFSTKLQEELIKTYQYLPRLNEDDRLIPILNHLSSGYTIADSGSFDSQFG 300

Query: 300 A-DNGDITAKMVYSDEIVSNFPLCAKNLMRGLQTNHHLRYQGRQQLSLFLKGIGLNVDEA 358
             ++ +I AK V+S+EI  ++PL  KNL  GL+ N+HLRY GRQQL+LFLKGIGL+VDEA
Sbjct: 301 NNEDNEINAKSVWSEEISKHYPLSVKNLFYGLKENNHLRYHGRQQLTLFLKGIGLSVDEA 360

Query: 359 LKFWSDAFGRNGGMSIDKFNKEYKYNFRHNYGLEGNRINYKPWDCRTILSKPRPARGEFH 418
           LKFW DAF +N  M+ +KFNKEY+YN RH+YGLEGNRINYKPWDCRTILSKPRP RGE+H
Sbjct: 361 LKFWHDAFTKNNKMTTEKFNKEYRYNIRHSYGLEGNRINYKPWDCRTILSKPRPNRGEYH 420

Query: 419 GCPYRDWNVEKLSSELSQNLKLTPTQVTGVLDSCQRNEFTVACTKVFELTHGSSTTEINE 478
           GCP+RDWN ++L+SELS+ + LT  Q+T VLDSC ++E+T+ACTKVFE+TH        E
Sbjct: 421 GCPFRDWNHDRLTSELSK-MGLTTQQITDVLDSCDKHEYTIACTKVFEMTHNVPE---GE 476

Query: 479 QSHIAHPNLYYDRSRQLQKK 498
             HI+HPNLY++RSRQL+KK
Sbjct: 477 SMHISHPNLYFERSRQLEKK 496

>KLLA0F04818g 469283..470764 similar to sp|P20457 Saccharomyces
           cerevisiae YKL045w PRI2 DNA-directed DNA polymerase
           alpha, 58 KD subunit (DNA primase) singleton, start by
           similarity
          Length = 493

 Score =  599 bits (1545), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 289/498 (58%), Positives = 375/498 (75%), Gaps = 18/498 (3%)

Query: 1   MFRQTKRKISSRRNF----DNSTDASGQFILQATTSEGEQKLYEKLYSSKISFYDLPPQG 56
           MFRQTK+++++RRNF     N  D +G         +G Q  Y+ LY +K+++Y LPP+G
Sbjct: 1   MFRQTKKRVANRRNFVGDDQNRIDVTGY----GNQDDGMQ--YDILYPTKLTWYRLPPKG 54

Query: 57  EITLDQFETWAIDRLKILLEIESCVQRNKTIKEIETIVKPLLQKSLPYNTDSFQDRKKDY 116
           EITL+QFETWAIDRLK+LLE+ES  QRNK++KEIET +KP+L   L    D+ + RKKDY
Sbjct: 55  EITLEQFETWAIDRLKVLLELESLWQRNKSMKEIETTIKPVLSSKLNLGNDN-ESRKKDY 113

Query: 117 YSHFILRLCFCRSKELREKFTRSETLLFKIRFNMLTSQDQTKFVQSLNLPLLQFISDEEK 176
           YSHFILRLCFCRSKELR+KF R+ETLLFKIRF MLT+QDQ  F+ SL+LP +  I +EEK
Sbjct: 114 YSHFILRLCFCRSKELRDKFVRAETLLFKIRFQMLTTQDQLNFISSLDLPYVNSIDEEEK 173

Query: 177 ANLSQQLYQTIAPAXXXXXXXXXXXXXXXXXXXXKFIKLPFESVIELVGSRQVFVSRGFA 236
            +LS +LYQT++                      K+ KLP E+V++LVGSRQ+F+ +G+A
Sbjct: 174 QSLSTELYQTVSHLLTFQLNLTEETQRRQFFNREKYYKLPMENVMDLVGSRQIFIKKGWA 233

Query: 237 YLPQFQQLNHIANEFSTKLSTEMLKTYQHLPRLNEDDRLLPILHHLSSGYAIVDFQQQGN 296
           Y+PQFQQLN I+NEFS  L TE++ TYQ +P+LNEDDR+LPILHHLSSGY + +  Q+ N
Sbjct: 234 YVPQFQQLNLISNEFSDCLQTELMGTYQMIPKLNEDDRILPILHHLSSGYVVTE-SQELN 292

Query: 297 EYGADNGDITAKMVYSDEIVSNFPLCAKNLMRGLQTNHHLRYQGRQQLSLFLKGIGLNVD 356
             G  N + T + V + +++ +FPLCAK LM  LQTNHHLRYQGRQQLS FLKGIGL+VD
Sbjct: 293 GAGV-NDEFTHRSVKTKKVMEHFPLCAKQLMEQLQTNHHLRYQGRQQLSFFLKGIGLSVD 351

Query: 357 EALKFWSDAFGRNGGMSIDKFNKEYKYNFRHNYGLEGNRINYKPWDCRTILSKPRPARGE 416
           EAL+FW+++F   G M++D+FNKEYKYNFRHNYGLEGNRINYKPWDCRTILSKPRP+RGE
Sbjct: 352 EALQFWTESFTSGGKMTVDQFNKEYKYNFRHNYGLEGNRINYKPWDCRTILSKPRPSRGE 411

Query: 417 FHGCPYRDWNVEKLSSELSQNLKLTPTQVTGVLDSCQRNEFTVACTKVFELTHGSSTTEI 476
           +HGCPYRD++ +KL + L + + LT  QV  V++SCQ+ ++T+ACTKVFE  H ++T ++
Sbjct: 412 YHGCPYRDYHPDKLVATLKE-MSLTQQQVNSVVESCQQQDYTIACTKVFEAVHKTTTADL 470

Query: 477 NEQSHIAHPNLYYDRSRQ 494
                I HPN Y++RSRQ
Sbjct: 471 ----QIVHPNQYFERSRQ 484

>ABR056C [647] [Homologous to ScYKL045W (PRI2) - SH]
           (498192..499661) [1470 bp, 489 aa]
          Length = 489

 Score =  544 bits (1402), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 266/499 (53%), Positives = 344/499 (68%), Gaps = 18/499 (3%)

Query: 1   MFRQTKRKISSRRNFDNSTDASGQFILQATTSEGEQKLYEKLYSSKISFYDLPPQGEITL 60
           MFRQ+KR+++ RR+ D    A G  IL   T+E EQ  Y++LY +K+SFY LPP GEITL
Sbjct: 1   MFRQSKRRVAQRRHGDG---ADGATILAGLTAEEEQARYDQLYPAKLSFYALPPVGEITL 57

Query: 61  DQFETWAIDRLKILLEIESCVQRNKTIKEIETIVKPLLQKSLPYNTDSFQDRKKDYYSHF 120
           DQFETWAIDRLK+LLE+ES +QRN+  +E+E  +KPLL K LP   +  + R+KDYYSHF
Sbjct: 58  DQFETWAIDRLKVLLELESLIQRNRAGRELEQAMKPLLGKLLPLGEEQ-EARRKDYYSHF 116

Query: 121 ILRLCFCRSKELREKFTRSETLLFKIRFNMLTSQDQTKFVQSLNLPLLQFISDEEKANLS 180
           ILRLCFCR+ ELRE+F R+ET LF++RF MLTS DQ +FVQSL+LPL+QFI + EK  L 
Sbjct: 117 ILRLCFCRTAELRERFVRAETALFRLRFQMLTSADQARFVQSLDLPLVQFIDEAEKQALG 176

Query: 181 QQLYQTIAPAXXXXXXXXXXXXXXXXXXXXKFIKLPFESVIELVGSRQVFVSRGFAYLPQ 240
            QLY  +AP                     +F+KLPFESVI+LVG R V +  G+AYLPQ
Sbjct: 177 AQLYDAVAPQLLHQLQLTDEAQRRQFFQHERFLKLPFESVIDLVGPRHVLLRGGWAYLPQ 236

Query: 241 FQQLNHIANEFSTKLSTEMLKTYQHLPRLNEDDRLLPILHHLSSGYAIVDFQQQGNEYGA 300
           F QLNHIA E++ +L+T++  TYQHLP L  DDRL PIL HLS+G+ +            
Sbjct: 237 FMQLNHIAAEYAARLATDLRATYQHLPALAGDDRLPPILAHLSAGHVVAPPPPP------ 290

Query: 301 DNGDITAKMVYSDEIVSNFPLCAKNLMRGLQTNHHLRYQGRQQLSLFLKGIGLNVDEALK 360
             G +TA  + ++ + +  PLCA+ L+ GL  NHHLRY GRQQL+LFLKG G++ D+AL+
Sbjct: 291 TGGGLTAADLAAEPVRAALPLCARGLLDGLAANHHLRYLGRQQLALFLKGAGMSADDALR 350

Query: 361 FWSDAFGRNGGMSIDKFNKEYKYNFRHNYGLEGNRINYKPWDCRTILSKPRPARGEFHGC 420
           FW+DAF   G  S+D+FN+EY+Y  RH YGLEGNRINY+PWDCRTIL+KPRPAR EFHGC
Sbjct: 351 FWADAFT-AGPTSLDRFNREYRYALRHTYGLEGNRINYRPWDCRTILAKPRPARNEFHGC 409

Query: 421 PYRDWNVEKLSSELSQNLKLTPTQVTGVLDSCQRNEFTVACTKVFELTHG------SSTT 474
           PYRDW  ++L++ L+      P  V  V D+C R E+T+ACT VF+  HG          
Sbjct: 410 PYRDWAPDRLAAALAAMQLAPPA-VAAVRDACARREYTLACTHVFDACHGHVAPSAPGHV 468

Query: 475 EINEQSHIAHPNLYYDRSR 493
              + SHI HPN +++R+R
Sbjct: 469 PAPDMSHIVHPNQFFERAR 487

>YIL071C (PCI8) [2600] chr9 complement(228657..229991) Protein that
           binds to Prt1p and Rpg1p subunits of eIF3, may have
           regulatory role in transcription or translation,
           putative subunit of the signalosome, required for the
           removal of Rub1p from Cdc53p [1335 bp, 444 aa]
          Length = 444

 Score = 31.6 bits (70), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 32/101 (31%), Positives = 47/101 (46%), Gaps = 16/101 (15%)

Query: 85  KTIKEIETIVKPLLQKSLPYNTDSFQDRKKDYYSHFI----------LRLCFCRSKELRE 134
           K I+EIE  VK ++Q     N D     +KD  SH +          +++  C S  L+E
Sbjct: 129 KGIEEIEYNVKNIIQGR--KNFDMLNSMEKDRISHEVVQDDSFSLLRIQMLLCVSYFLQE 186

Query: 135 KFTRSETLLFKIRFNMLTSQDQTKFVQSLNLPLLQFISDEE 175
           ++    T  F     M+TS+  T  V S +L  + FIS EE
Sbjct: 187 RYFDCCTKFF----TMMTSEPLTLKVLSEHLDCMNFISKEE 223

>YOR336W (KRE5) [5115] chr15 (949768..953865) Protein involved in
           beta-1,6-glucan biosynthesis [4098 bp, 1365 aa]
          Length = 1365

 Score = 30.8 bits (68), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 30/56 (53%), Gaps = 9/56 (16%)

Query: 304 DITAKMVYSDEIVSNFPLCAKNLMRG-------LQTNHHLRYQG--RQQLSLFLKG 350
           DITA + ++  IV+NFPL +K L++        + +N  L  +G     L L++ G
Sbjct: 287 DITATLNFTKSIVNNFPLISKQLIKVSSVNKDIITSNEELNSKGFDYNMLGLYING 342

>AER191W [2693] [Homologous to ScYNR003C (RPC34) - SH]
           complement(997715..998659) [945 bp, 314 aa]
          Length = 314

 Score = 30.0 bits (66), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 31/51 (60%), Gaps = 2/51 (3%)

Query: 321 LCAKNLMRGLQTNHHLRYQGRQQLSLFLKGIGLNVDEALKF-WSDAFGRNG 370
           L  KNL+R ++ N+ LR+Q    +S   K  G++ DEAL + + +A GR G
Sbjct: 55  LLDKNLIRLVKQNNELRFQAV-NVSEAQKKSGMSSDEALVYSYIEASGREG 104

>Kwal_26.7201
          Length = 234

 Score = 30.0 bits (66), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 32/66 (48%), Gaps = 5/66 (7%)

Query: 13  RNFDNSTDASGQF--ILQATTSEGEQKLYEKLYSSKISFYDLPPQGEITLDQFETWAIDR 70
           R+  N     GQ   I    T +   K+ +  Y+    F D  PQG +++ +F+TW  D+
Sbjct: 160 RSGANRVSTPGQLAKIYPLLTQQLAAKIVQHAYNYLTGFLD--PQGNVSIKRFDTW-WDK 216

Query: 71  LKILLE 76
            K+ LE
Sbjct: 217 FKVRLE 222

>Sklu_2423.8 YDL074C, Contig c2423 13513-15456 reverse complement
          Length = 647

 Score = 30.0 bits (66), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 28/89 (31%), Positives = 43/89 (48%), Gaps = 6/89 (6%)

Query: 219 SVIELVGSRQVFVSR-GFAYLPQFQQLNHIANEFSTKLSTEMLKTYQHLPRLN---EDD- 273
           S I+L+      +SR   +YL +FQQL+     F+ KLSTE     + L + N   E D 
Sbjct: 278 SKIQLITRENSELSRINDSYLAKFQQLSQEREIFTNKLSTEFQTAQETLKKHNSTLEKDL 337

Query: 274 -RLLPILHHLSSGYAIVDFQQQGNEYGAD 301
            R+      L S  A+++ Q+  +E   D
Sbjct: 338 VRIRTTRDELLSRIAVLESQRAKSEMLTD 366

>CAGL0D05654g complement(537378..538337) no similarity, hypothetical
           start
          Length = 319

 Score = 29.6 bits (65), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 25/82 (30%), Positives = 41/82 (50%), Gaps = 14/82 (17%)

Query: 109 FQDRKKDYYSHFILRLCFCRSK-------ELREKFTRSETL--LFKIRFNMLTSQDQTKF 159
           F +  K+Y  +++ RL +   +       EL   +TR ET+  L K + N L S   TKF
Sbjct: 147 FDNIAKNYLGYYLWRLEWLTQRNSQVTEQELYYIYTRVETMVSLVKDKLNQLYSLPLTKF 206

Query: 160 VQSLNLPLLQFISDEEKANLSQ 181
           ++S+ +P+     D    N+SQ
Sbjct: 207 MESVLIPM-----DGLNCNMSQ 223

>YLR462W (YLR462W) [3835] chr12 (1065953..1066561) Protein of
          unknown function, has very strong similarity to a
          region of S. cerevisiae Yil177p [609 bp, 202 aa]
          Length = 202

 Score = 28.9 bits (63), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 17/58 (29%), Positives = 30/58 (51%)

Query: 38 LYEKLYSSKISFYDLPPQGEITLDQFETWAIDRLKILLEIESCVQRNKTIKEIETIVK 95
          L+E + +   SFY+    G I + +F T A+DR +   ++   V   K +K+  T V+
Sbjct: 35 LFESIPTEVRSFYEDEKSGLIKVVKFRTGAMDRKRSFEKVVISVMVGKNVKKFLTFVE 92

>YEL075C (YEL075C) [1356] chr5 complement(5345..5713) Protein of
          unknown function, has very strong similarity to a
          region of S. cerevisiae Yil177p, which is an
          ATP-dependent helicase that may function in telomere
          maintenance [369 bp, 122 aa]
          Length = 122

 Score = 28.1 bits (61), Expect = 9.0,   Method: Composition-based stats.
 Identities = 17/58 (29%), Positives = 30/58 (51%)

Query: 38 LYEKLYSSKISFYDLPPQGEITLDQFETWAIDRLKILLEIESCVQRNKTIKEIETIVK 95
          L+E + +   SFY+    G I + +F T A+DR +   ++   V   K +K+  T V+
Sbjct: 35 LFESIPTEVRSFYEDEKSGLIKVVKFRTGAMDRKRSFEKVVISVMVGKNVKKFLTFVE 92

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.319    0.135    0.393 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 16,414,036
Number of extensions: 719337
Number of successful extensions: 2101
Number of sequences better than 10.0: 30
Number of HSP's gapped: 2119
Number of HSP's successfully gapped: 30
Length of query: 504
Length of database: 16,596,109
Length adjustment: 106
Effective length of query: 398
Effective length of database: 12,926,601
Effective search space: 5144787198
Effective search space used: 5144787198
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 64 (29.3 bits)