Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Sklu_2406.226526513280.0
YPL132W (COX11)30021410041e-138
Kwal_26.86602492169961e-138
CAGL0M02673g2852119891e-136
KLLA0D07007g2612159861e-136
ACR106C2662199671e-133
Scas_700.412912399631e-132
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Sklu_2406.2
         (265 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Sklu_2406.2 YPL132W, Contig c2406 657-1454                            516   0.0  
YPL132W (COX11) [5313] chr16 (301715..302617) Protein required f...   391   e-138
Kwal_26.8660                                                          388   e-138
CAGL0M02673g 306446..307303 similar to sp|P19516 Saccharomyces c...   385   e-136
KLLA0D07007g complement(601656..602441) similar to sp|P19516 Sac...   384   e-136
ACR106C [1153] [Homologous to ScYPL132W (COX11) - SH] (543421..5...   377   e-133
Scas_700.41                                                           375   e-132

>Sklu_2406.2 YPL132W, Contig c2406 657-1454
          Length = 265

 Score =  516 bits (1328), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 250/265 (94%), Positives = 250/265 (94%)

Query: 1   MMNSLLFKTAXXXXXXXXXXXXXXXKNDLWFNLRHFHTQKAPRQQLDFSKLTQKEIKQLR 60
           MMNSLLFKTA               KNDLWFNLRHFHTQKAPRQQLDFSKLTQKEIKQLR
Sbjct: 1   MMNSLLFKTATRSTLRSTRLLNRSTKNDLWFNLRHFHTQKAPRQQLDFSKLTQKEIKQLR 60

Query: 61  AIKQERERAFKDRTAAYYFSSVAVVFLGLAYAAVPLYRAICARTGYGGIPITDKRKFTED 120
           AIKQERERAFKDRTAAYYFSSVAVVFLGLAYAAVPLYRAICARTGYGGIPITDKRKFTED
Sbjct: 61  AIKQERERAFKDRTAAYYFSSVAVVFLGLAYAAVPLYRAICARTGYGGIPITDKRKFTED 120

Query: 121 KLVPVDTDRRIRISFTSEVSRILPWKFTPQQREVYVLPGETALAFYKARNTSDKDIIGMA 180
           KLVPVDTDRRIRISFTSEVSRILPWKFTPQQREVYVLPGETALAFYKARNTSDKDIIGMA
Sbjct: 121 KLVPVDTDRRIRISFTSEVSRILPWKFTPQQREVYVLPGETALAFYKARNTSDKDIIGMA 180

Query: 181 TYSISPGEAAPYFNKIQCFCFEEQRLAAGEEVDMPVFFFIDPDFASDPAMRNIDDVILHY 240
           TYSISPGEAAPYFNKIQCFCFEEQRLAAGEEVDMPVFFFIDPDFASDPAMRNIDDVILHY
Sbjct: 181 TYSISPGEAAPYFNKIQCFCFEEQRLAAGEEVDMPVFFFIDPDFASDPAMRNIDDVILHY 240

Query: 241 TFFKAHYADGAAVSDPSAAVVEAAE 265
           TFFKAHYADGAAVSDPSAAVVEAAE
Sbjct: 241 TFFKAHYADGAAVSDPSAAVVEAAE 265

>YPL132W (COX11) [5313] chr16 (301715..302617) Protein required for
           heme A synthesis [903 bp, 300 aa]
          Length = 300

 Score =  391 bits (1004), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 180/214 (84%), Positives = 200/214 (93%)

Query: 42  PRQQLDFSKLTQKEIKQLRAIKQERERAFKDRTAAYYFSSVAVVFLGLAYAAVPLYRAIC 101
           P+   D SKLT+ EI+QLR +K+ RER FKDRT A+YFSSVAV+FLGLAYAAVPLYRAIC
Sbjct: 52  PKHTFDISKLTRNEIQQLRELKRARERKFKDRTVAFYFSSVAVLFLGLAYAAVPLYRAIC 111

Query: 102 ARTGYGGIPITDKRKFTEDKLVPVDTDRRIRISFTSEVSRILPWKFTPQQREVYVLPGET 161
           ARTG+GGIPITD+RKFT+DKL+PVDT++RIRISFTSEVS+ILPWKF PQQREVYVLPGET
Sbjct: 112 ARTGFGGIPITDRRKFTDDKLIPVDTEKRIRISFTSEVSQILPWKFVPQQREVYVLPGET 171

Query: 162 ALAFYKARNTSDKDIIGMATYSISPGEAAPYFNKIQCFCFEEQRLAAGEEVDMPVFFFID 221
           ALAFYKA+N SDKDIIGMATYSI+PGEAA YFNKIQCFCFEEQ+LAAGEE+DMPVFFFID
Sbjct: 172 ALAFYKAKNYSDKDIIGMATYSIAPGEAAQYFNKIQCFCFEEQKLAAGEEIDMPVFFFID 231

Query: 222 PDFASDPAMRNIDDVILHYTFFKAHYADGAAVSD 255
           PDFASDPAMRNIDD+ILHYTFF+AHY DG AVSD
Sbjct: 232 PDFASDPAMRNIDDIILHYTFFRAHYGDGTAVSD 265

>Kwal_26.8660
          Length = 249

 Score =  388 bits (996), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 176/216 (81%), Positives = 207/216 (95%), Gaps = 1/216 (0%)

Query: 40  KAPRQQLDFSKLTQKEIKQLRAIKQERERAFKDRTAAYYFSSVAVVFLGLAYAAVPLYRA 99
           K+P  Q+D SKLTQ EI+QLRA+K +++R FKDRTAAYYF+SVAV+FLGLAYAAVP YRA
Sbjct: 22  KSP-NQIDLSKLTQTEIQQLRALKLQKDRQFKDRTAAYYFTSVAVLFLGLAYAAVPFYRA 80

Query: 100 ICARTGYGGIPITDKRKFTEDKLVPVDTDRRIRISFTSEVSRILPWKFTPQQREVYVLPG 159
           ICARTG+GG+PITD+RKFT+DKL+PV++D+RIRISFTSEVS+ILPWKFTP+QREV+VLPG
Sbjct: 81  ICARTGWGGVPITDRRKFTDDKLIPVESDKRIRISFTSEVSQILPWKFTPEQREVHVLPG 140

Query: 160 ETALAFYKARNTSDKDIIGMATYSISPGEAAPYFNKIQCFCFEEQRLAAGEEVDMPVFFF 219
           ETALAFYKA+NTSDKDIIGMATYSI+PG+A+PYFNKIQCFCFEEQRLAAGEE+DMPVFFF
Sbjct: 141 ETALAFYKAKNTSDKDIIGMATYSITPGDASPYFNKIQCFCFEEQRLAAGEEIDMPVFFF 200

Query: 220 IDPDFASDPAMRNIDDVILHYTFFKAHYADGAAVSD 255
           IDPDFA+DP MRNIDD++LHYTFF+AHYA+G AVS+
Sbjct: 201 IDPDFAADPRMRNIDDIVLHYTFFRAHYANGGAVSE 236

>CAGL0M02673g 306446..307303 similar to sp|P19516 Saccharomyces
           cerevisiae YPL132w COX11 cytochrome-c oxidase assembly
           protein, hypothetical start
          Length = 285

 Score =  385 bits (989), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 175/211 (82%), Positives = 199/211 (94%)

Query: 45  QLDFSKLTQKEIKQLRAIKQERERAFKDRTAAYYFSSVAVVFLGLAYAAVPLYRAICART 104
            +DFSKLT+ EIKQLR +K  ++R +KDRT AYYF SVAV+FLGLAYAAVPLYRAICART
Sbjct: 50  NIDFSKLTRDEIKQLRDMKMAKDRKYKDRTVAYYFGSVAVIFLGLAYAAVPLYRAICART 109

Query: 105 GYGGIPITDKRKFTEDKLVPVDTDRRIRISFTSEVSRILPWKFTPQQREVYVLPGETALA 164
           G+GG+PITDKRKFT+DKL+PVDT +RIR+SFTSEVS+ILPWKFTPQQREVYVLPGETALA
Sbjct: 110 GFGGVPITDKRKFTDDKLIPVDTGKRIRVSFTSEVSQILPWKFTPQQREVYVLPGETALA 169

Query: 165 FYKARNTSDKDIIGMATYSISPGEAAPYFNKIQCFCFEEQRLAAGEEVDMPVFFFIDPDF 224
           FYKA+N SDKDIIGMATYSI+PG+AA YFNKIQCFCFEEQ+LAAGEE+DMPVFFFIDPDF
Sbjct: 170 FYKAKNNSDKDIIGMATYSITPGDAAQYFNKIQCFCFEEQKLAAGEEIDMPVFFFIDPDF 229

Query: 225 ASDPAMRNIDDVILHYTFFKAHYADGAAVSD 255
           ASDP+MRNIDD+ILHYTFF+AHY DG+AVS+
Sbjct: 230 ASDPSMRNIDDLILHYTFFRAHYGDGSAVSE 260

>KLLA0D07007g complement(601656..602441) similar to sp|P19516
           Saccharomyces cerevisiae YPL132w COX11 cytochrome-c
           oxidase assembly protein singleton, start by similarity
          Length = 261

 Score =  384 bits (986), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 176/215 (81%), Positives = 201/215 (93%)

Query: 44  QQLDFSKLTQKEIKQLRAIKQERERAFKDRTAAYYFSSVAVVFLGLAYAAVPLYRAICAR 103
            + D SKLT++EIK++R  K    R +KDRT A+YF+S+AV+FLGLAYAAVPLYRAICAR
Sbjct: 39  NKFDLSKLTREEIKEIRDYKISAARRYKDRTVAFYFTSIAVLFLGLAYAAVPLYRAICAR 98

Query: 104 TGYGGIPITDKRKFTEDKLVPVDTDRRIRISFTSEVSRILPWKFTPQQREVYVLPGETAL 163
           TGYGGIPITDKRKFT+DKL+PVD+++RIRISFTSEVS+ILPWKF PQQREVYVLPGETAL
Sbjct: 99  TGYGGIPITDKRKFTDDKLIPVDSNKRIRISFTSEVSQILPWKFVPQQREVYVLPGETAL 158

Query: 164 AFYKARNTSDKDIIGMATYSISPGEAAPYFNKIQCFCFEEQRLAAGEEVDMPVFFFIDPD 223
           AFYKA+N SDKDIIGMATYSI+PGE++PYFNKIQCFCFEEQ+LAAGEEVDMPVFFFIDPD
Sbjct: 159 AFYKAKNNSDKDIIGMATYSITPGESSPYFNKIQCFCFEEQKLAAGEEVDMPVFFFIDPD 218

Query: 224 FASDPAMRNIDDVILHYTFFKAHYADGAAVSDPSA 258
           FASDP+MRNIDD+ILHYTFFKAHYADG+AVSD +A
Sbjct: 219 FASDPSMRNIDDIILHYTFFKAHYADGSAVSDAAA 253

>ACR106C [1153] [Homologous to ScYPL132W (COX11) - SH]
           (543421..544221) [801 bp, 266 aa]
          Length = 266

 Score =  377 bits (967), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 175/219 (79%), Positives = 196/219 (89%)

Query: 34  RHFHTQKAPRQQLDFSKLTQKEIKQLRAIKQERERAFKDRTAAYYFSSVAVVFLGLAYAA 93
           R  H+    R +LDFSKLTQ EIKQLR +K +RERAF+DRTAAYYF+SV VVFLGLAYAA
Sbjct: 29  RPLHSSGRSRAKLDFSKLTQAEIKQLRDMKVQRERAFRDRTAAYYFASVGVVFLGLAYAA 88

Query: 94  VPLYRAICARTGYGGIPITDKRKFTEDKLVPVDTDRRIRISFTSEVSRILPWKFTPQQRE 153
           VPLYR +CARTG+GG PITD+RKFT DK+VPVD D+RIR+SFTSEVS+ILPWKF PQQRE
Sbjct: 89  VPLYRLLCARTGFGGTPITDRRKFTSDKMVPVDMDKRIRVSFTSEVSQILPWKFVPQQRE 148

Query: 154 VYVLPGETALAFYKARNTSDKDIIGMATYSISPGEAAPYFNKIQCFCFEEQRLAAGEEVD 213
           VYVLPGETALAFYKA+NTSDKDIIGMATYSI+PG AA YFNKIQCFCFEEQ+L AGEEVD
Sbjct: 149 VYVLPGETALAFYKAKNTSDKDIIGMATYSITPGGAAQYFNKIQCFCFEEQKLLAGEEVD 208

Query: 214 MPVFFFIDPDFASDPAMRNIDDVILHYTFFKAHYADGAA 252
           MPVFFFIDPDFA+DP MRN+DD++LHYTFF+A YA  AA
Sbjct: 209 MPVFFFIDPDFATDPQMRNVDDLVLHYTFFRAQYASEAA 247

>Scas_700.41
          Length = 291

 Score =  375 bits (963), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 175/239 (73%), Positives = 206/239 (86%), Gaps = 8/239 (3%)

Query: 34  RHFHTQKAPRQ--------QLDFSKLTQKEIKQLRAIKQERERAFKDRTAAYYFSSVAVV 85
           R +  Q+AP +        + D SKL++ EI++LR  K + +   K+RT A YFSS+AV+
Sbjct: 42  RSYTQQQAPPRMNSQEKIPKFDISKLSKAEIQRLRDFKHQEDTKMKNRTIALYFSSMAVL 101

Query: 86  FLGLAYAAVPLYRAICARTGYGGIPITDKRKFTEDKLVPVDTDRRIRISFTSEVSRILPW 145
           FLGL+YAAVP+YRA+CARTG+GGIPITD+RKFT+DKL+PVDT++RI+ISFTSEVS+ILPW
Sbjct: 102 FLGLSYAAVPIYRALCARTGFGGIPITDRRKFTDDKLIPVDTEKRIKISFTSEVSQILPW 161

Query: 146 KFTPQQREVYVLPGETALAFYKARNTSDKDIIGMATYSISPGEAAPYFNKIQCFCFEEQR 205
           KF PQQREVYVLPGETALAFYKA+N SDKDIIGMATYSISPGEAA YFNKIQCFCFEEQ+
Sbjct: 162 KFVPQQREVYVLPGETALAFYKAKNHSDKDIIGMATYSISPGEAAQYFNKIQCFCFEEQK 221

Query: 206 LAAGEEVDMPVFFFIDPDFASDPAMRNIDDVILHYTFFKAHYADGAAVSDPSAAVVEAA 264
           LAAGEE+DMPVFFFIDPDFASDPAMRNIDD+ILHYTFFKAHY DG+AVSD +A V   +
Sbjct: 222 LAAGEEIDMPVFFFIDPDFASDPAMRNIDDIILHYTFFKAHYGDGSAVSDAAATVAPGS 280

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.324    0.136    0.406 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 7,856,425
Number of extensions: 316897
Number of successful extensions: 970
Number of sequences better than 10.0: 8
Number of HSP's gapped: 969
Number of HSP's successfully gapped: 8
Length of query: 265
Length of database: 16,596,109
Length adjustment: 100
Effective length of query: 165
Effective length of database: 13,134,309
Effective search space: 2167160985
Effective search space used: 2167160985
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.5 bits)
S2: 60 (27.7 bits)