Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Sklu_2401.747345924490.0
Kwal_23.399547443210561e-140
Scas_716.344794119551e-125
YGR091W (PRP31)4943899211e-119
KLLA0D14883g4673658301e-106
CAGL0G03025g4793426484e-79
ADR032W4392614413e-49
AFR328C5131651325e-08
Sklu_1985.14982211291e-07
CAGL0A04015g5082211282e-07
Kwal_34.158945121591282e-07
Scas_665.125152451272e-07
ACL144C5492481272e-07
YOR310C (NOP58)5112211244e-07
KLLA0F08613g5111441245e-07
Kwal_56.246545072481236e-07
YLR197W (SIK1)5042231192e-06
KLLA0D12254g5132211164e-06
Scas_537.75102261112e-05
CAGL0I09790g5131681102e-05
CAGL0I01804g21650730.41
KLLA0B13948g2450176730.92
ADR292W98941692.0
Sklu_2066.2639152673.8
Kwal_55.2043489653674.2
Sklu_2394.3243134638.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Sklu_2401.7
         (473 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Sklu_2401.7 YGR091W, Contig c2401 14483-15904                         947   0.0  
Kwal_23.3995                                                          411   e-140
Scas_716.34                                                           372   e-125
YGR091W (PRP31) [2051] chr7 (666343..667827) Protein required fo...   359   e-119
KLLA0D14883g 1254381..1255784 some similarities with sp|P49704 S...   324   e-106
CAGL0G03025g 280230..281669 similar to sp|P49704 Saccharomyces c...   254   4e-79
ADR032W [1773] [Homologous to ScYGR091W (PRP31) - SH] complement...   174   3e-49
AFR328C [3520] [Homologous to ScYOR310C (NOP58) - SH] (1032031.....    55   5e-08
Sklu_1985.1 YLR197W, Contig c1985 148-1644 reverse complement          54   1e-07
CAGL0A04015g complement(397378..398904) similar to sp|Q12460 Sac...    54   2e-07
Kwal_34.15894                                                          54   2e-07
Scas_665.12                                                            54   2e-07
ACL144C [905] [Homologous to ScYLR197W (SIK1) - SH] (94809..9645...    54   2e-07
YOR310C (NOP58) [5094] chr15 complement(896820..898355) Nucleola...    52   4e-07
KLLA0F08613g complement(801623..803158) similar to sp|Q12499 Sac...    52   5e-07
Kwal_56.24654                                                          52   6e-07
YLR197W (SIK1) [3600] chr12 (546099..547613) Nucleolar protein c...    50   2e-06
KLLA0D12254g 1045077..1046618 highly similar to sp|Q12460 Saccha...    49   4e-06
Scas_537.7                                                             47   2e-05
CAGL0I09790g complement(934746..936287) highly similar to sp|Q12...    47   2e-05
CAGL0I01804g complement(149918..150568) highly similar to sp|P32...    33   0.41 
KLLA0B13948g 1222276..1229628 highly similar to sp|P32600 Saccha...    33   0.92 
ADR292W [2033] [Homologous to ScYDR325W (YCG1) - SH] complement(...    31   2.0  
Sklu_2066.2 YJL128C, Contig c2066 5081-7000                            30   3.8  
Kwal_55.20434                                                          30   4.2  
Sklu_2394.3 YHR043C, Contig c2394 2120-2851 reverse complement         29   8.4  

>Sklu_2401.7 YGR091W, Contig c2401 14483-15904
          Length = 473

 Score =  947 bits (2449), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 459/459 (100%), Positives = 459/459 (100%)

Query: 15  FGSMSDGELEESVLVDDTEQSETCTAIETEQLLRALAREYKPINLSTGALNGPKELCQLL 74
           FGSMSDGELEESVLVDDTEQSETCTAIETEQLLRALAREYKPINLSTGALNGPKELCQLL
Sbjct: 15  FGSMSDGELEESVLVDDTEQSETCTAIETEQLLRALAREYKPINLSTGALNGPKELCQLL 74

Query: 75  PLQNGIKKLMLNNKFSTVTLLSELQPVIQSELALLHNYIKSLYSKKFSELDSLVNPPRSY 134
           PLQNGIKKLMLNNKFSTVTLLSELQPVIQSELALLHNYIKSLYSKKFSELDSLVNPPRSY
Sbjct: 75  PLQNGIKKLMLNNKFSTVTLLSELQPVIQSELALLHNYIKSLYSKKFSELDSLVNPPRSY 134

Query: 135 SKLIKFLETSDARDLSTLEGILSKEQILIVSMSMKTGFKRDLALPSDEKTYLLTAIDMLI 194
           SKLIKFLETSDARDLSTLEGILSKEQILIVSMSMKTGFKRDLALPSDEKTYLLTAIDMLI
Sbjct: 135 SKLIKFLETSDARDLSTLEGILSKEQILIVSMSMKTGFKRDLALPSDEKTYLLTAIDMLI 194

Query: 195 QLYDLQDEITSFIASQVINIAPNVCAIVGPQVASKILSAAGGLLELSQVPSCNLASIGKD 254
           QLYDLQDEITSFIASQVINIAPNVCAIVGPQVASKILSAAGGLLELSQVPSCNLASIGKD
Sbjct: 195 QLYDLQDEITSFIASQVINIAPNVCAIVGPQVASKILSAAGGLLELSQVPSCNLASIGKD 254

Query: 255 RYMSHEINTDMSGVRQRGYVYSCSLIQDQPPHVHKQALRMVCAKVSLAARVDISNNKDNS 314
           RYMSHEINTDMSGVRQRGYVYSCSLIQDQPPHVHKQALRMVCAKVSLAARVDISNNKDNS
Sbjct: 255 RYMSHEINTDMSGVRQRGYVYSCSLIQDQPPHVHKQALRMVCAKVSLAARVDISNNKDNS 314

Query: 315 LGVKWANEISEKLNKLQDPPNISNTKPLPIPEDKPKKKRAGRKFRKYKQQFQLSHLRQLQ 374
           LGVKWANEISEKLNKLQDPPNISNTKPLPIPEDKPKKKRAGRKFRKYKQQFQLSHLRQLQ
Sbjct: 315 LGVKWANEISEKLNKLQDPPNISNTKPLPIPEDKPKKKRAGRKFRKYKQQFQLSHLRQLQ 374

Query: 375 NRVEFGTQERTVIDSYGEEIGMGMAGSLQATQYSTHNNTAKMRKSMKRRIADAEDNVRDF 434
           NRVEFGTQERTVIDSYGEEIGMGMAGSLQATQYSTHNNTAKMRKSMKRRIADAEDNVRDF
Sbjct: 375 NRVEFGTQERTVIDSYGEEIGMGMAGSLQATQYSTHNNTAKMRKSMKRRIADAEDNVRDF 434

Query: 435 VLLDDRMGVAEGNKDIPTQPSEKKSKTAGNGWYSKHISQ 473
           VLLDDRMGVAEGNKDIPTQPSEKKSKTAGNGWYSKHISQ
Sbjct: 435 VLLDDRMGVAEGNKDIPTQPSEKKSKTAGNGWYSKHISQ 473

>Kwal_23.3995
          Length = 474

 Score =  411 bits (1056), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 208/432 (48%), Positives = 291/432 (67%), Gaps = 9/432 (2%)

Query: 47  LRALAREYKPINLSTGALNGPKELCQLLPLQNGIKKLMLNNKFSTVTLLSELQPVIQSEL 106
           L  L    +P   S G+L GP E+ ++   +  + ++M          LS+LQP++  E+
Sbjct: 41  LSELLEAQQPSLSSEGSLKGPLEVSRVYSKRFKLYEMMGQKSSFNAMQLSKLQPIVLEEM 100

Query: 107 ALLHNYIKSLYSKKFSELDSLVNPPRSYSKLIKFLETSDARD--LSTLEGILSKEQILIV 164
            LL   +  +Y ++F EL SL+  P+ Y++++K LETSD  +  L  LE I+SKE  L++
Sbjct: 101 GLLQKLMAKIYERRFPELQSLMTSPKGYAQVVKHLETSDINEGNLRGLEDIISKEHFLVL 160

Query: 165 SMSMKTGFKRDLALPSDEKTYLLTAIDMLIQLYDLQDEITSFIASQVINIAPNVCAIVGP 224
           SM+M TGFK+D+ L +++   ++   D+L++L D++D+I  ++AS V ++APN+C +VG 
Sbjct: 161 SMAMHTGFKQDVPLTAEDSRLVIQTADVLLELCDIRDKIERYVASLVSDVAPNLCILVGS 220

Query: 225 QVASKILSAAGGLLELSQVPSCNLASIGKDRYMSHEINTDMSGVRQRGYVYSCSLIQDQP 284
           Q+A+ +++ AGGL ELS++PSCNL+SIGK +  SH  +TD SGVRQ+GY+Y   L+  QP
Sbjct: 221 QIAASLIAVAGGLSELSEIPSCNLSSIGKTKNSSHTSDTDASGVRQKGYIYQSDLVSGQP 280

Query: 285 PHVHKQALRMVCAKVSLAARVDISNN-KDNSLGVKWANEISEKLNKLQDPPNISNTKPLP 343
               KQALRMVCAKVSL AR D S +    +LG KW  ++ EKL KLQDPPNISNTK LP
Sbjct: 281 VSFQKQALRMVCAKVSLCARADRSKSCPSGTLGAKWKEQVLEKLRKLQDPPNISNTKALP 340

Query: 344 IPEDKPKKKRAGRKFRKYKQQFQLSHLRQLQNRVEFGTQERTVIDSYGEEIGMGMAGSLQ 403
           IPEDKPKKKRAGR+FRKYK+QFQLSH RQLQNR+EFG QE T  D++GEEIGMGMA +L+
Sbjct: 341 IPEDKPKKKRAGRRFRKYKEQFQLSHTRQLQNRMEFGKQENTTFDAFGEEIGMGMAHTLR 400

Query: 404 ATQYSTHNNTAKMRKSMKRRIADAEDNVRDFVLLDDRMGVAEGNKD--IPTQP--SEKKS 459
           A   +   N AKMRKSM++R+       +DF+  DDR  +  GN    +   P  S +KS
Sbjct: 401 APT-TVFRNRAKMRKSMQQRLLSESQGTQDFLTTDDRSNIL-GNTSTALSASPVTSTQKS 458

Query: 460 KTAGNGWYSKHI 471
           KT+   WY K++
Sbjct: 459 KTSDTDWYRKYM 470

>Scas_716.34
          Length = 479

 Score =  372 bits (955), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 198/411 (48%), Positives = 280/411 (68%), Gaps = 23/411 (5%)

Query: 46  LLRALAREYKPIN-LSTGALN-GPKELCQLLPLQNGIKKLMLNNKFSTVTLL---SELQP 100
            L  L + +KP   LS+  +N  PK+L  +      +K +  +   S + +L   +EL  
Sbjct: 61  FLNELVKTFKPSTMLSSVDMNMEPKKLSIVYRAIEKLKAMFHSQSTSFIEVLPHLNELSH 120

Query: 101 VIQSELALLHNYIKSLYSKKFSELDSLVNPPRSYSKLIKFLE-TSD--ARDLST---LEG 154
            I+ E+ +L+ Y K++YS +F+ELD++   P  Y+K+   +E TSD  A  L     +E 
Sbjct: 121 QIRREIDILYQYSKNIYSTRFTELDTIAATPYQYAKVTSLIEGTSDDKAGQLPINIEIEA 180

Query: 155 ILSKEQILIVSMSMKTGFKRDLALPSDEKTYLLTAIDMLIQLYDLQDEITSFIASQVINI 214
            LSKEQ+L++ MSM+T F ++  L    K  LL A  M+IQL DLQ+ I  +I+S V +I
Sbjct: 181 KLSKEQVLVLRMSMQTSFLKNKPLEKKVKHLLLEACSMIIQLTDLQNVILQYISSNVSDI 240

Query: 215 APNVCAIVGPQVASKILSAAGGLLELSQVPSCNLASIGKDRYMSHEINTDMSGVRQRGYV 274
           APN+C +VGP+VAS +++  GG+L+L+++PSCNLASIGK+R++SHE++T +SGVRQ GY+
Sbjct: 241 APNLCVLVGPEVASLLIAHTGGILQLAEIPSCNLASIGKNRHLSHELHTTLSGVRQEGYI 300

Query: 275 YSCSLIQDQPPHVHKQALRMVCAKVSLAARVDISNN---KDNSLGVKWANEISEKLNKLQ 331
           YS  L+Q+QP   HKQ LRMVCAKV+LAARVD       K++ LG +W  E+  K+ K+ 
Sbjct: 301 YSSELVQNQPIQNHKQMLRMVCAKVALAARVDAGQRGAAKNDLLGQRWREELETKIQKVT 360

Query: 332 DPPNISNTKPLPIPEDKPKKKRAGRKFRKYKQQFQLSHLRQLQNRVEFGTQERTVIDSYG 391
           + PNISN KPLPIPEDKPKKKRAGRKFRKYKQQFQLSHLRQLQNR+EFG QE++ +D++G
Sbjct: 361 ESPNISNVKPLPIPEDKPKKKRAGRKFRKYKQQFQLSHLRQLQNRMEFGKQEQSTMDAFG 420

Query: 392 EEIGMGMA--------GSLQATQYSTHNNTAKMRKSMKRRIADAEDNVRDF 434
           EEIGMGM         G ++A+     +N+AK+ K MKRR+ +A+   ++F
Sbjct: 421 EEIGMGMTSSSIQQSIGGIRASSQRV-DNSAKITKVMKRRLKEADSQSKEF 470

>YGR091W (PRP31) [2051] chr7 (666343..667827) Protein required for
           pre-mRNA splicing, associated with U4/U6.U5 tri-snRNP
           [1485 bp, 494 aa]
          Length = 494

 Score =  359 bits (921), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 185/389 (47%), Positives = 269/389 (69%), Gaps = 21/389 (5%)

Query: 69  ELCQLLPLQNGIKKLMLNNKFSTVTLL---SELQPVIQSELALLHNYIKSLYSKKFSELD 125
           E  Q+LP    +K+++   +   + LL   +E+ P+I+S + L+HN++ SLYS++F EL 
Sbjct: 69  ETAQILPKIVDLKRILQQQEIDFIKLLPFFNEIIPLIKSNIKLMHNFLISLYSRRFPELS 128

Query: 126 SLVNPPRSYSKLIKFLETSDARDLSTLE--------GILSKEQILIVSMSMKTGFKRDLA 177
           SL+  P  YSK+I  LE  +     + E          L++EQIL+++MSMKT FK    
Sbjct: 129 SLIPSPLQYSKVISILENENYSKNESDELFFHLENKAKLTREQILVLTMSMKTSFKNKEP 188

Query: 178 LPSDEKTYLLTAIDMLIQLYDLQDEITSFIASQVINIAPNVCAIVGPQVASKILSAAGGL 237
           L    +T +L A  +L  L+ LQ++I  +IAS++  IAPNVC +VGP++A+++++ AGG+
Sbjct: 189 LDIKTRTQILEANSILENLWKLQEDIGQYIASKISIIAPNVCFLVGPEIAAQLIAHAGGV 248

Query: 238 LELSQVPSCNLASIGKDRYMSHEINTDMSGVRQRGYVYSCSLIQDQPPHVHKQALRMVCA 297
           LE S++PSCN+ASIGK++++SHE++T  SGVRQ GY+++  +IQ  P  VHKQ LRM+CA
Sbjct: 249 LEFSRIPSCNIASIGKNKHLSHELHTLESGVRQEGYLFASDMIQKFPVSVHKQMLRMLCA 308

Query: 298 KVSLAARVDI---SNNKDNSLGVKWANEISEKLNKLQDPPNISNTKPLPIPEDKPKKKRA 354
           KVSLAARVD    + +++  L  KW  E+S+K  KL + P+IS TK LPIPED+PKKKRA
Sbjct: 309 KVSLAARVDAGQKNGDRNTVLAHKWKAELSKKARKLSEAPSISETKALPIPEDQPKKKRA 368

Query: 355 GRKFRKYKQQFQLSHLRQLQNRVEFGTQERTVIDSYGEEIGMGMAG-SLQATQYSTH--- 410
           GRKFRKYK++F+LSH+RQLQNR+EFG QE+TV+DSYGEE+G+GM+  SLQ    +T    
Sbjct: 369 GRKFRKYKEKFRLSHVRQLQNRMEFGKQEQTVLDSYGEEVGLGMSNTSLQQAVGATSGSR 428

Query: 411 ---NNTAKMRKSMKRRIADAEDNVRDFVL 436
               N AK+ K MK RI++A     +F++
Sbjct: 429 RSAGNQAKLTKVMKHRISEANQQADEFLI 457

>KLLA0D14883g 1254381..1255784 some similarities with sp|P49704
           Saccharomyces cerevisiae YGR091w PRP31 pre-mRNA splicing
           protein, hypothetical start
          Length = 467

 Score =  324 bits (830), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 170/365 (46%), Positives = 241/365 (66%), Gaps = 26/365 (7%)

Query: 92  VTLLSELQPVIQSELALLHNYIKSLYSKKFSELDSLVNPPRSYSKLIKFLETSDARDLST 151
           V  L +L P+  +EL+++   I   Y  KF  L+++V   + Y  ++K L+    +D+  
Sbjct: 89  VIKLGQLMPLFDTELSMVFQCIVDTYKAKFPGLETIVPERKQYVDVVKMLQ----QDIPN 144

Query: 152 --LEGILSKEQILIVSMSMKTGFKRDLALPSDEKTYLLTAIDMLIQLYDLQDEITSFIAS 209
             L+ +LSKE+ L+VSMS+KT FK    +   +K  L  AI     LY+L+D ++ ++ +
Sbjct: 145 VQLDQVLSKEETLVVSMSLKTDFKEGARI---DKDLLSKAIHWFDILYNLRDNVSHYVET 201

Query: 210 QVINIAPNVCAIVGPQVASKILSAAGGLLELSQVPSCNLASIGKDRYMSHEINTDMSGVR 269
           ++  +APN+CA++GP  A+K+++  G + ELS VPSCNLASIG+D+ + H  + D+SGVR
Sbjct: 202 RIQMVAPNLCALLGPDTAAKLVTHCGSVKELSVVPSCNLASIGQDKTL-HGKSLDISGVR 260

Query: 270 QRGYVYSCSLIQDQPPHVHKQALRMVCAKVSLAARVDIS--------------NNKDNSL 315
           Q+GY++   ++Q QPP   KQALRMV AKV+LAAR D +              N+  + L
Sbjct: 261 QKGYLFYTDVVQTQPPEFQKQALRMVSAKVALAARADCTMGNQVINPDGNSDGNSDASKL 320

Query: 316 GVKWANEISEKLNKLQDPPNISNTKPLPIPEDKPKKKRAGRKFRKYKQQFQLSHLRQLQN 375
           G+KW +EI EKL K+ DPPNISN KPLPIPED PKKKRAGR+FRKYK+QF++SHLRQ+QN
Sbjct: 321 GLKWRHEIVEKLKKIIDPPNISNIKPLPIPEDAPKKKRAGRRFRKYKEQFKMSHLRQMQN 380

Query: 376 RVEFGTQERTVIDSYGEEIGMGMAGSLQATQYSTHNNTAKMRKSMKRRIADAEDNVRDFV 435
           R+EFG +E+T +D YGEEIG GMA S   +  S+ N T KMRKSM+ R+     N   F 
Sbjct: 381 RMEFGKEEQTTMDPYGEEIGFGMADSKNVSALSSFNKT-KMRKSMRLRLDQETKNTHSF- 438

Query: 436 LLDDR 440
           L D+R
Sbjct: 439 LQDER 443

>CAGL0G03025g 280230..281669 similar to sp|P49704 Saccharomyces
           cerevisiae YGR091w PRP31 pre-mRNA splicing protein,
           hypothetical start
          Length = 479

 Score =  254 bits (648), Expect = 4e-79,   Method: Compositional matrix adjust.
 Identities = 137/342 (40%), Positives = 217/342 (63%), Gaps = 24/342 (7%)

Query: 116 LYSKKFSELDSLVNPPRSYSKLIKFLETSDARDLSTLEGIL---------SKEQILIVSM 166
           +Y  KFSEL S++  P  Y++ I  LE         LE ++         S+E I++++M
Sbjct: 134 IYEDKFSELKSILRLPHQYAQCISLLEQG-----LELEQVVLRFEELCSTSRELIMVLNM 188

Query: 167 SMKTGFKRDLALPSDEKTYLLTAIDMLIQLYDLQDEITSFIASQVINIAPNVCAIVGPQV 226
           S++  +K +  L    K  L     ++ + +D+   ++  IA+++  IAPN+CA++G   
Sbjct: 189 SLRADYKGNYKLTDTNKKSLHKLTSIIFEAHDIIRFVSVEIANRIGEIAPNLCALLGTNT 248

Query: 227 ASKILSAAGGLLELSQVPSCNLASIGKDRYMSHEINTDMSGVRQRGYVYSCSLIQDQPPH 286
           AS ++S  GGLL+LS++PSCN+A+IGK     H I   ++     GY++   L+Q+QP  
Sbjct: 249 ASLLVSHTGGLLQLSKIPSCNIANIGKKNTKDHNI---LNFSNPGGYIFQNELVQNQPIE 305

Query: 287 VHKQALRMVCAKVSLAARVDI---SNNKDNSLGVKWANEISEKLNKLQDPPNISNTKPLP 343
            HKQ +RM+ +KVSLAARVD    + +K+N LG +W  EI EK+ K++ PPNIS+ K LP
Sbjct: 306 NHKQMMRMLSSKVSLAARVDAGLKTGDKNNKLGKQWRVEIEEKIKKIRAPPNISDVKALP 365

Query: 344 IPEDKPKKKRAGRKFRKYKQQFQLSHLRQLQNRVEFGTQERTVIDSYGEEIGMGMAGSLQ 403
           IPEDKPKKKRAGRKFRKYK+QF+LS  RQLQNR+ FG QE T+ D++G+E+G+GM    +
Sbjct: 366 IPEDKPKKKRAGRKFRKYKEQFKLSGTRQLQNRMVFGKQEATIYDTFGDEVGLGMTSQRK 425

Query: 404 -ATQYSTHNNTAKMRKS--MKRRIADAEDNVRDFV-LLDDRM 441
                ST  ++  ++K   +++++ D++ + ++++  L DR+
Sbjct: 426 NGLAISTTGSSFGVKKPQYIQKKLKDSKRSTQEYIDALADRI 467

>ADR032W [1773] [Homologous to ScYGR091W (PRP31) - SH]
           complement(763163..764482) [1320 bp, 439 aa]
          Length = 439

 Score =  174 bits (441), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 96/261 (36%), Positives = 152/261 (58%), Gaps = 10/261 (3%)

Query: 67  PKELCQLLPLQNGIKKLMLNNKFSTVTLLSELQPVIQSELALLHNYIKSLYSKKFSELDS 126
           P+     LPL   + + +   +    TL  +L PV++ E A ++  +++ Y   F EL  
Sbjct: 40  PRSRPSALPLLPELHEALAAGQLDLGTL-GQLLPVLRDEAADVYRQLEARYRPVFPELAE 98

Query: 127 LVNPPRSYSKLIKFLETSDARDLSTLEGILSKEQILIVSMSMKTGFKRDLALPSDEKTYL 186
           LV   R+Y ++++ LET      + L+ +L++EQ ++V+M+     + D   P+     L
Sbjct: 99  LVPSQRTYVRVLRALETG-----APLDELLTREQAMLVAMTRPQAPRAD---PARWPREL 150

Query: 187 LTAIDMLIQLYDLQDEITSFIASQVINIAPNVCAIVGPQVASKILSAAGGLLELSQVPSC 246
               D   QL+   D I + I  Q   +AP V A+VGP VA+ +LS AG + EL+QVP+C
Sbjct: 151 APHADRHEQLHTAVDAIDAHIVRQAHRLAPTVTALVGPVVAAALLSHAGSVRELAQVPAC 210

Query: 247 NLASIGKDRYMSHEINTDMSGVRQRGYVYSCSLIQDQPPHVHKQALRMVCAKVSLAARVD 306
           NLA+IG  R+ +H   TD SGVR RG+V+   L+Q+QPP + +QALRM+CA+++LAARVD
Sbjct: 211 NLAAIGAPRHAAHARRTDASGVRLRGHVWDTPLVQEQPPALQRQALRMLCARLALAARVD 270

Query: 307 ISNNKDNSLGVKWANEISEKL 327
            S   D +L  +W  +I  ++
Sbjct: 271 AS-APDPALAARWRADILARI 290

>AFR328C [3520] [Homologous to ScYOR310C (NOP58) - SH]
           (1032031..1033572) [1542 bp, 513 aa]
          Length = 513

 Score = 55.5 bits (132), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 34/165 (20%), Positives = 92/165 (55%), Gaps = 10/165 (6%)

Query: 191 DMLIQLYDLQDEITSFIASQVINIAPNVCAIVGPQVASKILSAAGGLLELSQVPSCNLAS 250
           + +++    +++++++++S++  IAPN+  +VG  V +++++ AG L+ L++ P+  +  
Sbjct: 260 EQIVEFAAYREQLSNYLSSRMKAIAPNLTQLVGELVGARLIAHAGSLVSLAKAPASTIQI 319

Query: 251 IGKDRYMSHEINTDMSGVRQRGYVYSCSLIQDQPPHVHKQALRMVCAKVSLAARVD-ISN 309
           +G ++ +   + T      + G +Y  SL+         +  R++ AK +++ R D ++ 
Sbjct: 320 LGAEKALFRALKTKHD-TPKYGLLYHASLVGQATGKNKGKIARVLAAKAAVSLRYDALAE 378

Query: 310 NKDNS--LGVKWANEISEKLNKLQD-----PPNIS-NTKPLPIPE 346
           ++D+S  +G++   ++  +L++L+       P +S + K + I E
Sbjct: 379 DRDDSGDIGLEARAKVESRLSQLEGRDLRTTPKVSRDAKKIEISE 423

>Sklu_1985.1 YLR197W, Contig c1985 148-1644 reverse complement
          Length = 498

 Score = 54.3 bits (129), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 45/221 (20%), Positives = 100/221 (45%), Gaps = 9/221 (4%)

Query: 113 IKSLYSKKFSELDSLVNPPRSYSKLIKFLE---TSDARDLSTLEGILSKEQILI--VSMS 167
           +K  Y   F EL  LV     +++L+ F++   + D   L  L  IL+ +  +   V  +
Sbjct: 194 VKEWYGWHFPELAKLVPDNYKFAQLVLFIKDKASLDEESLHDLASILNDDAGIAERVIDN 253

Query: 168 MKTGFKRDLALPSDEKTYLLTAIDMLIQLYDLQDEITSFIASQVINIAPNVCAIVGPQVA 227
            +    +DL+    E   +    + ++ L D + ++  ++  ++  +APN+  ++G  + 
Sbjct: 254 ARISMGQDLSETDMENVCIFA--ERVVSLADYRRQLYDYLCEKMHTVAPNLSELIGEVIG 311

Query: 228 SKILSAAGGLLELSQVPSCNLASIGKDRYMSHEINTDMSGVRQRGYVYSCSLIQDQPPHV 287
           ++++S AG L  LS+  +  +  +G ++ +   + T      + G +Y    I       
Sbjct: 312 ARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTK-GNTPKYGLIYHSGFIAKASAKN 370

Query: 288 HKQALRMVCAKVSLAARVD-ISNNKDNSLGVKWANEISEKL 327
             +  R +  K S+A+R+D  S+   N  G     ++ ++L
Sbjct: 371 KGRISRYLANKCSMASRIDNYSDEPTNVFGSVLKKQVEQRL 411

>CAGL0A04015g complement(397378..398904) similar to sp|Q12460
           Saccharomyces cerevisiae YLR197w SIK1 involved in
           pre-rRNA processing, hypothetical start
          Length = 508

 Score = 53.9 bits (128), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 42/221 (19%), Positives = 101/221 (45%), Gaps = 9/221 (4%)

Query: 113 IKSLYSKKFSELDSLVNPPRSYSKLIKFLE---TSDARDLSTLEGILSKEQILIVSM--S 167
           +K  Y   F EL  LV    +++KL+ F++   + +   L  L  +++++  +   +  +
Sbjct: 193 VKEWYGWHFPELAKLVPDNYTFAKLVLFIKDKASLNEESLHDLAAVVNEDAGIAERIIDN 252

Query: 168 MKTGFKRDLALPSDEKTYLLTAIDMLIQLYDLQDEITSFIASQVINIAPNVCAIVGPQVA 227
            +    +DL+    E   +      ++ L D + ++  ++  ++  +APN+  ++G  + 
Sbjct: 253 ARISMGQDLSETDMENVCVFA--QRVVSLVDYRKQLYDYLCEKMHTVAPNLSGLIGEVIG 310

Query: 228 SKILSAAGGLLELSQVPSCNLASIGKDRYMSHEINTDMSGVRQRGYVYSCSLIQDQPPHV 287
           ++++S AG L  LS+  +  +  +G ++ +   + T      + G +Y    I       
Sbjct: 311 ARLISHAGSLTSLSKQAASTVQILGAEKALFRALKTK-GNTPKYGLIYHSGFIAKASAKN 369

Query: 288 HKQALRMVCAKVSLAARVD-ISNNKDNSLGVKWANEISEKL 327
             +  R +  K S+A+R+D  S+   N  G     ++ ++L
Sbjct: 370 KGRISRYLANKCSMASRIDNYSDEPTNVFGSVLKKQVEQRL 410

>Kwal_34.15894
          Length = 512

 Score = 53.9 bits (128), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 32/159 (20%), Positives = 88/159 (55%), Gaps = 10/159 (6%)

Query: 200 QDEITSFIASQVINIAPNVCAIVGPQVASKILSAAGGLLELSQVPSCNLASIGKDRYMSH 259
           ++++++++++++  IAPN+  +VG  V +++++ AG L+ L++ P+  +  +G ++ +  
Sbjct: 269 REQLSNYLSARMKAIAPNLTQLVGELVGARLIAHAGSLISLAKSPASTIQILGAEKALFR 328

Query: 260 EINTDMSGVRQRGYVYSCSLIQDQPPHVHKQALRMVCAKVSLAARVD-ISNNKDNS--LG 316
            + T      + G +Y  SL+         +  R++ AK +++ R D ++ ++D+S  +G
Sbjct: 329 ALKTKHD-TPKYGLLYHASLVGQATGKNKGKIARVLAAKAAVSLRYDALAEDRDDSGDIG 387

Query: 317 VKWANEISEKLNKLQD------PPNISNTKPLPIPEDKP 349
           ++  +++  +L++L+       P  +   K + I E + 
Sbjct: 388 LESRSKVESRLSQLEGRDLRTTPKVVREAKKVEITEARA 426

>Scas_665.12
          Length = 515

 Score = 53.5 bits (127), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 45/245 (18%), Positives = 118/245 (48%), Gaps = 12/245 (4%)

Query: 114 KSLYSKKFSELDSLVNPPRSYSKLIKFLETSDARDLSTLEGILSKEQILIVSMSMKTGFK 173
           K  Y   F EL  +V    +Y+++I  +        + +  IL +E    V  + +    
Sbjct: 185 KEWYGWHFPELAKIVTDSVAYARIILTMGIRSKAADTDMSEILPEEIEERVKTAAEVSMG 244

Query: 174 RDLALPSDEKTYLLTAIDMLIQLYDLQDEITSFIASQVINIAPNVCAIVGPQVASKILSA 233
            ++     E    L   D +++    ++++++++++++  IAPN+  +VG  V +++++ 
Sbjct: 245 TEITQLDLENIKCLA--DQIVEFAAYREQLSNYLSARMKAIAPNLTQLVGELVGARLIAH 302

Query: 234 AGGLLELSQVPSCNLASIGKDRYMSHEINTDMSGVRQRGYVYSCSLIQDQPPHVHKQALR 293
           +G L+ L++ P+  +  +G ++ +   + T      + G +Y  SL+         +  R
Sbjct: 303 SGSLISLAKSPASTIQILGAEKALFRALKTKHD-TPKYGLLYHASLVGQATGKNKGKIAR 361

Query: 294 MVCAKVSLAARVD-ISNNKDNS--LGVKWANEISEKLNKLQ------DPPNISNTKPLPI 344
           ++ AK +++ R D ++ ++D++  +G++   ++  +L++L+       P  +   K + I
Sbjct: 362 VLAAKAAVSIRYDALAEDRDDAGDIGLESRAKVENRLSQLEGRDLRTTPKVVREAKKVEI 421

Query: 345 PEDKP 349
            E + 
Sbjct: 422 SESRA 426

>ACL144C [905] [Homologous to ScYLR197W (SIK1) - SH] (94809..96458)
           [1650 bp, 549 aa]
          Length = 549

 Score = 53.5 bits (127), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 49/248 (19%), Positives = 109/248 (43%), Gaps = 13/248 (5%)

Query: 86  NNKFSTVTLLSELQPVIQSELALLHNYIKSLYSKKFSELDSLVNPPRSYSKLIKFLE--- 142
           N+    + LL +L   I +        +K  Y   F EL  LV     ++KL+ F+    
Sbjct: 171 NHIIQAIALLDQLDKDINT----FAMRVKEWYGWHFPELAKLVPDNYKFAKLVLFIRDKA 226

Query: 143 TSDARDLSTLEGILSKEQILI--VSMSMKTGFKRDLALPSDEKTYLLTAIDMLIQLYDLQ 200
           + +   L  L  IL ++  +   V  + +    +DL+    E   +    + ++ L + +
Sbjct: 227 SLNDESLHDLSAILGEDAGIAERVISNARISMGQDLSEVDMENVSVFA--ERVVNLVEYR 284

Query: 201 DEITSFIASQVINIAPNVCAIVGPQVASKILSAAGGLLELSQVPSCNLASIGKDRYMSHE 260
            ++  ++  ++  +APN+  ++G  + ++++S AG L  LS+  +  +  +G ++ +   
Sbjct: 285 RQLYEYLCEKMHTVAPNLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRA 344

Query: 261 INTDMSGVRQRGYVYSCSLIQDQPPHVHKQALRMVCAKVSLAARVD-ISNNKDNSLGVKW 319
           + T      + G +Y    I         +  R +  K S+A+R+D  S++  N  G   
Sbjct: 345 LKTK-GNTPKYGLIYHSGFISKASAKNKGRISRYLANKCSMASRIDNYSDDPTNVFGQVL 403

Query: 320 ANEISEKL 327
             ++ ++L
Sbjct: 404 KKQVEQRL 411

>YOR310C (NOP58) [5094] chr15 complement(896820..898355) Nucleolar
           protein component of box C/D snoRNPs, which are
           necessary for 2'-O-methylation of ribosomal RNAs,
           component of U3 snoRNP (also called small subunit
           processome), which is required for 18S rRNA biogenesis
           [1536 bp, 511 aa]
          Length = 511

 Score = 52.4 bits (124), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 41/221 (18%), Positives = 111/221 (50%), Gaps = 6/221 (2%)

Query: 114 KSLYSKKFSELDSLVNPPRSYSKLIKFLETSDARDLSTLEGILSKEQILIVSMSMKTGFK 173
           K  Y   F EL  +V    +Y+++I  +        + L  IL +E    V  + +    
Sbjct: 185 KEWYGWHFPELAKIVTDSVAYARIILTMGIRSKASETDLSEILPEEIEERVKTAAEVSMG 244

Query: 174 RDLALPSDEKTYLLTAIDMLIQLYDLQDEITSFIASQVINIAPNVCAIVGPQVASKILSA 233
            ++     +    L   + +++    ++++++++++++  IAPN+  +VG  V +++++ 
Sbjct: 245 TEITQTDLDNINALA--EQIVEFAAYREQLSNYLSARMKAIAPNLTQLVGELVGARLIAH 302

Query: 234 AGGLLELSQVPSCNLASIGKDRYMSHEINTDMSGVRQRGYVYSCSLIQDQPPHVHKQALR 293
           +G L+ L++ P+  +  +G ++ +   + T      + G +Y  SL+         +  R
Sbjct: 303 SGSLISLAKSPASTIQILGAEKALFRALKTKHD-TPKYGLLYHASLVGQATGKNKGKIAR 361

Query: 294 MVCAKVSLAARVD-ISNNKDNS--LGVKWANEISEKLNKLQ 331
           ++ AK +++ R D ++ ++D+S  +G++   ++  +L++L+
Sbjct: 362 VLAAKAAVSLRYDALAEDRDDSGDIGLESRAKVENRLSQLE 402

>KLLA0F08613g complement(801623..803158) similar to sp|Q12499
           Saccharomyces cerevisiae YOR310c NOP58 required for
           pre-18S rRNA processing, start by similarity
          Length = 511

 Score = 52.4 bits (124), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 28/144 (19%), Positives = 84/144 (58%), Gaps = 4/144 (2%)

Query: 191 DMLIQLYDLQDEITSFIASQVINIAPNVCAIVGPQVASKILSAAGGLLELSQVPSCNLAS 250
           + +++    +++++++++S++  IAPN+  +VG  V +++++ +G L+ L++ P+  +  
Sbjct: 260 EQIVEFAAYREQLSNYLSSRMKAIAPNLTQLVGELVGARLIAHSGSLISLAKSPASTIQI 319

Query: 251 IGKDRYMSHEINTDMSGVRQRGYVYSCSLIQDQPPHVHKQALRMVCAKVSLAARVD-ISN 309
           +G ++ +   + T      + G +Y  SL+         +  R++ AK +++ R D ++ 
Sbjct: 320 LGAEKALFRALKTKHD-TPKYGLLYHASLVGQASGKNKGKIARVLAAKAAVSLRYDALAE 378

Query: 310 NKDNS--LGVKWANEISEKLNKLQ 331
           ++D+S  +G++   ++  +L++L+
Sbjct: 379 DRDDSGDIGLESRAKVESRLSQLE 402

>Kwal_56.24654
          Length = 507

 Score = 52.0 bits (123), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 53/248 (21%), Positives = 111/248 (44%), Gaps = 13/248 (5%)

Query: 86  NNKFSTVTLLSELQPVIQSELALLHNYIKSLYSKKFSELDSLVNPPRSYSKLIKFLE--T 143
           N+    + LL +L   I +        +K  Y   F EL  LV     +++L+ F++   
Sbjct: 171 NHIIQAIALLDQLDKDINT----FAMRVKEWYGWHFPELAKLVPDNYKFAQLVLFIKDKA 226

Query: 144 SDARD-LSTLEGILSKEQILI--VSMSMKTGFKRDLALPSDEKTYLLTAIDMLIQLYDLQ 200
           S + D L  L  IL  +  +   V  + +    +DL+  +D     + A + +  L D +
Sbjct: 227 SLSEDSLHDLSAILDNDAGIAERVIDNARISMGQDLS-ETDMDNVCVFA-ERVTSLADYR 284

Query: 201 DEITSFIASQVINIAPNVCAIVGPQVASKILSAAGGLLELSQVPSCNLASIGKDRYMSHE 260
            ++  ++ S++  +APN+  ++G  + ++++S AG L  LS+  +  +  +G ++ +   
Sbjct: 285 RQLYEYLCSKMHTVAPNLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRA 344

Query: 261 INTDMSGVRQRGYVYSCSLIQDQPPHVHKQALRMVCAKVSLAARVD-ISNNKDNSLGVKW 319
           + T      + G +Y    I         +  R +  K S+A+R+D  S+   N  G   
Sbjct: 345 LKTK-GNTPKYGLIYHSGFIGKAAAKNKGRISRYLANKCSIASRIDNYSDEPTNVFGTVL 403

Query: 320 ANEISEKL 327
             ++ ++L
Sbjct: 404 KKQVEQRL 411

>YLR197W (SIK1) [3600] chr12 (546099..547613) Nucleolar protein
           component of box C/D snoRNPs, which are necessary for
           2'-O-methylation of ribosomal RNAs, component of U3
           snoRNP (also called small subunit processome), which is
           required for 18S rRNA biogenesis [1515 bp, 504 aa]
          Length = 504

 Score = 50.4 bits (119), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 45/223 (20%), Positives = 101/223 (45%), Gaps = 13/223 (5%)

Query: 113 IKSLYSKKFSELDSLVNPPRSYSKLIKFLETSDARD---LSTLEGILSKE----QILIVS 165
           +K  Y   F EL  LV    +++KL+ F++   + +   L  L  +L+++    Q +I +
Sbjct: 195 VKEWYGWHFPELAKLVPDNYTFAKLVLFIKDKASLNDDSLHDLAALLNEDSGIAQRVIDN 254

Query: 166 MSMKTGFKRDLALPSDEKTYLLTAIDMLIQLYDLQDEITSFIASQVINIAPNVCAIVGPQ 225
             +  G  +D++    E   +      +  L D + ++  ++  ++  +APN+  ++G  
Sbjct: 255 ARISMG--QDISETDMENVCVFA--QRVASLADYRRQLYDYLCEKMHTVAPNLSELIGEV 310

Query: 226 VASKILSAAGGLLELSQVPSCNLASIGKDRYMSHEINTDMSGVRQRGYVYSCSLIQDQPP 285
           + ++++S AG L  LS+  +  +  +G ++ +   + T      + G +Y    I     
Sbjct: 311 IGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTK-GNTPKYGLIYHSGFISKASA 369

Query: 286 HVHKQALRMVCAKVSLAARVD-ISNNKDNSLGVKWANEISEKL 327
               +  R +  K S+A+R+D  S    N  G     ++ ++L
Sbjct: 370 KNKGRISRYLANKCSMASRIDNYSEEPSNVFGSVLKKQVEQRL 412

>KLLA0D12254g 1045077..1046618 highly similar to sp|Q12460
           Saccharomyces cerevisiae YLR197w SIK1 involved in
           pre-rRNA processing, start by similarity
          Length = 513

 Score = 49.3 bits (116), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 43/221 (19%), Positives = 98/221 (44%), Gaps = 9/221 (4%)

Query: 113 IKSLYSKKFSELDSLVNPPRSYSKLIKFLE---TSDARDLSTLEGILSKEQILI--VSMS 167
           +K  Y   F EL  LV     ++KL+ F++   + +   L  L  IL  +  +   V  +
Sbjct: 194 VKEWYGWHFPELAKLVPDNYKFAKLVLFIKDKASLNEESLHDLSEILDNDAGISERVIDN 253

Query: 168 MKTGFKRDLALPSDEKTYLLTAIDMLIQLYDLQDEITSFIASQVINIAPNVCAIVGPQVA 227
            +    +DL+    E   +      ++ L + + ++  ++  ++  +APN+  ++G  + 
Sbjct: 254 ARISMGQDLSETDMENVTIFAK--RVVSLVEYRKQLYDYLCEKMHTVAPNLSELIGEVIG 311

Query: 228 SKILSAAGGLLELSQVPSCNLASIGKDRYMSHEINTDMSGVRQRGYVYSCSLIQDQPPHV 287
           ++++S +G L  LS+  +  +  +G ++ +   + T      + G +Y    I       
Sbjct: 312 ARLISHSGSLTNLSKQAASTVQILGAEKALFRALKTK-GNTPKYGLIYHSGFIAKASAKN 370

Query: 288 HKQALRMVCAKVSLAARVD-ISNNKDNSLGVKWANEISEKL 327
             +  R +  K S+A+R+D  S+   N  G     ++ ++L
Sbjct: 371 KGRISRYLANKCSMASRIDNYSDEPSNVFGQVLKKQVEQRL 411

>Scas_537.7
          Length = 510

 Score = 47.4 bits (111), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 43/226 (19%), Positives = 99/226 (43%), Gaps = 12/226 (5%)

Query: 86  NNKFSTVTLLSELQPVIQSELALLHNYIKSLYSKKFSELDSLVNPPRSYSKLIKFLE--- 142
           N+    + LL +L   I +        +K  Y   F EL  LV     +++L+ F++   
Sbjct: 171 NHIIQAIALLDQLDKDINT----FAMRVKEWYGWHFPELAKLVPDNYKFAQLVLFIKDKA 226

Query: 143 TSDARDLSTLEGILSKEQILI--VSMSMKTGFKRDLALPSDEKTYLLTAIDMLIQLYDLQ 200
           + +   L  L  IL+ +  +   V  + +    +D++    E   +      ++ L + +
Sbjct: 227 SLNDESLHDLAAILNDDAGIAERVIDNARISMGQDISETDMENVGVFA--QRVVSLVEYR 284

Query: 201 DEITSFIASQVINIAPNVCAIVGPQVASKILSAAGGLLELSQVPSCNLASIGKDRYMSHE 260
            ++  ++  ++  +APN+  ++G  + ++++S AG L  LS+  +  +  +G ++ +   
Sbjct: 285 KQLYDYLCEKMHTVAPNLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRA 344

Query: 261 INTDMSGVRQRGYVYSCSLIQDQPPHVHKQALRMVCAKVSLAARVD 306
           + T      + G +Y    I         +  R +  K S+A+R+D
Sbjct: 345 LKTK-GNTPKYGLIYHSGFIAKASAKNKGRISRYLANKCSMASRID 389

>CAGL0I09790g complement(934746..936287) highly similar to sp|Q12499
           Saccharomyces cerevisiae YOR310c, start by similarity
          Length = 513

 Score = 47.0 bits (110), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 35/168 (20%), Positives = 84/168 (50%), Gaps = 5/168 (2%)

Query: 114 KSLYSKKFSELDSLVNPPRSYSKLIKFLETSDARDLSTLEGILSKEQILIVSMSMKTGFK 173
           K  Y   F EL  +V    +Y++LI  +        + +  IL +E    V  + +    
Sbjct: 185 KEWYGWHFPELAKIVTDSVAYARLILTMGVRSKAAETDMSEILPEEIEERVKAAAEVSMG 244

Query: 174 RDLALPSDEKTYLLTAI-DMLIQLYDLQDEITSFIASQVINIAPNVCAIVGPQVASKILS 232
            ++   +D     + A+ D +++    +++++++++S++  IAPN+  +VG  V +++++
Sbjct: 245 TEI---TDVDLINIRALADQIVEFAAYREQLSNYLSSRMKAIAPNLTQLVGELVGARLIA 301

Query: 233 AAGGLLELSQVPSCNLASIGKDRYMSHEINTDMSGVRQRGYVYSCSLI 280
            AG L+ L++ P+  +  +G ++ +   + T      + G +Y  SL+
Sbjct: 302 HAGSLISLAKSPASTIQILGAEKALFRALKTK-HDTPKYGLLYHASLV 348

>CAGL0I01804g complement(149918..150568) highly similar to sp|P32904
           Saccharomyces cerevisiae YHR147c MRPL6, start by
           similarity
          Length = 216

 Score = 32.7 bits (73), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 25/50 (50%)

Query: 197 YDLQDEITSFIASQVINIAPNVCAIVGPQVASKILSAAGGLLELSQVPSC 246
           + +   + S + S  I +AP V   +GP   +K +    GLL L+QV S 
Sbjct: 11  FSVSRAVQSHVGSMPIYVAPEVNVSIGPMSVAKTIRKGRGLLSLAQVISV 60

>KLLA0B13948g 1222276..1229628 highly similar to sp|P32600
           Saccharomyces cerevisiae YKL203c TOR2
           phosphatidylinositol 3-kinase, start by similarity
          Length = 2450

 Score = 32.7 bits (73), Expect = 0.92,   Method: Compositional matrix adjust.
 Identities = 44/176 (25%), Positives = 71/176 (40%), Gaps = 41/176 (23%)

Query: 180 SDEKTYLLTAIDMLIQLYDLQDEITSFIASQVINIAPNVCAIVGPQVASKILSAAGGLLE 239
           S+EK   + A+D LI  Y   DE+     +Q   +A N   ++ P    +++ AA G L 
Sbjct: 127 SNEKLGGVLAVDTLIDFYSRTDEL----PNQTSRLA-NYLRVLIPSNDIEVMRAAAGTLG 181

Query: 240 LSQVPSCNLASIGKDRYMSHEINTDMSGV---------------RQRGYVYSCSLIQDQP 284
              VP   L S     ++  E+ T +  +               R+   +   S I D  
Sbjct: 182 KLAVPGGTLTS----EFVEFEVKTCIEWLTTSPENSSSNSKQEYRKHASLLIISAIADNS 237

Query: 285 PHVHK-----------QALR---MVC---AKVSLAARVDISNNKDNSLGVKWANEI 323
           P++             +ALR   +V    A V+L   + I NN+D+SL  KW   +
Sbjct: 238 PYLLYPFVNSILDNIWRALRDTKLVIRTDASVTLGKCLTIINNRDSSLTKKWVQRL 293

>ADR292W [2033] [Homologous to ScYDR325W (YCG1) - SH]
           complement(1203830..1206799) [2970 bp, 989 aa]
          Length = 989

 Score = 31.2 bits (69), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 19/41 (46%), Positives = 25/41 (60%), Gaps = 6/41 (14%)

Query: 419 SMKRRIADAEDNVRD---FVLL---DDRMGVAEGNKDIPTQ 453
           SM++R+ D E NVR    F L    DD +GVA+G  D+ TQ
Sbjct: 171 SMQKRVYDKEPNVRVQAIFCLTKLQDDDVGVADGAVDVATQ 211

>Sklu_2066.2 YJL128C, Contig c2066 5081-7000
          Length = 639

 Score = 30.4 bits (67), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 40/152 (26%), Positives = 65/152 (42%), Gaps = 23/152 (15%)

Query: 21  GELEESVLVDDTEQSETCTAIETEQLLRALAREYKPINLSTGALNGPKELCQLLPLQN-- 78
           G ++E  L   TE +  C   E + +   + R+ KP N+   A  G  +LC      N  
Sbjct: 425 GGIDEPQLAYITE-AVICGLKELKDVHNIIHRDVKPTNILCSAAQGTIKLCDFGVSGNLV 483

Query: 79  --------GIKKLM-------LNNKFSTVTLLSELQPVIQS--ELAL-LHNYIKSLYSKK 120
                   G +  M       LN   ST T+ S++  +  S  E+AL  + Y    Y   
Sbjct: 484 ASMAKTNIGCQSYMAPERIKSLNPDKSTYTVQSDIWSLGLSILEMALGAYPYPPETYDNI 543

Query: 121 FSELDSLVNPPRSYSKLIKFLETSDARDLSTL 152
           FS+L ++V+ P       KF  ++DA+D  ++
Sbjct: 544 FSQLSAIVDGPPPKLPQAKF--SADAQDFVSM 573

>Kwal_55.20434
          Length = 896

 Score = 30.4 bits (67), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 29/53 (54%), Gaps = 4/53 (7%)

Query: 138 IKFLETSDARDLSTLEGILSKEQILIVSMSMKTGFKRDLALPSDEKTYLLTAI 190
           IK L+  D++   TLEGIL     +IV+++     KR L +  DE   L+ AI
Sbjct: 675 IKMLDAGDSKQRKTLEGIL----YIIVNITAINENKRQLVIQQDELLQLIKAI 723

>Sklu_2394.3 YHR043C, Contig c2394 2120-2851 reverse complement
          Length = 243

 Score = 28.9 bits (63), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 34/134 (25%), Positives = 60/134 (44%), Gaps = 19/134 (14%)

Query: 57  INLSTGALNGPKELC--------QLLPLQNGIKKLMLNNKFSTVTLLSELQPVIQSELAL 108
           ++ +  A +  KELC        +L    +G +   + +KF      ++ Q V + ELA+
Sbjct: 18  VSTTIAAESAWKELCKKHGVDPEELFKCSHGARTSEIFSKFFPSIDNTDNQAVKKLELAI 77

Query: 109 LHNYIKSL-----YSKKFSELDSLVNPP-RSYSKLIKFLETSDARDL--STLEGIL---S 157
            H+Y+ S+      S+    LD   +PP  ++SK    + TS + DL  S  + IL    
Sbjct: 78  AHDYLDSVGLIPGASELLLSLDKCSDPPFDNFSKRKWAIVTSGSSDLAFSWFDTILQHIG 137

Query: 158 KEQILIVSMSMKTG 171
           K  + I +  +  G
Sbjct: 138 KPDVFITAFDVVKG 151

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.314    0.130    0.360 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 14,920,175
Number of extensions: 646971
Number of successful extensions: 1948
Number of sequences better than 10.0: 54
Number of HSP's gapped: 1930
Number of HSP's successfully gapped: 54
Length of query: 473
Length of database: 16,596,109
Length adjustment: 105
Effective length of query: 368
Effective length of database: 12,961,219
Effective search space: 4769728592
Effective search space used: 4769728592
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 63 (28.9 bits)