Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Sklu_2401.222422411981e-170
AFR560W2292257561e-102
Kwal_26.91542322277242e-97
YOR289W2512286638e-88
Scas_692.462642346241e-81
CAGL0M04763g2342265967e-78
KLLA0D02464g2272205931e-77
Scas_718.6139492730.21
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Sklu_2401.2
         (224 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Sklu_2401.2 YOR289W, Contig c2401 1376-2050                           466   e-170
AFR560W [3752] [Homologous to ScYOR289W - SH] complement(1436468...   295   e-102
Kwal_26.9154                                                          283   2e-97
YOR289W (YOR289W) [5073] chr15 (853354..854109) Member of the DU...   259   8e-88
Scas_692.46                                                           244   1e-81
CAGL0M04763g 513555..514259 similar to tr|Q12012 Saccharomyces c...   234   7e-78
KLLA0D02464g complement(209705..210388) gi|5679592|emb|CAB51774....   233   1e-77
Scas_718.61                                                            33   0.21 

>Sklu_2401.2 YOR289W, Contig c2401 1376-2050
          Length = 224

 Score =  466 bits (1198), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 224/224 (100%), Positives = 224/224 (100%)

Query: 1   MPDSLKSSPFALYAFYQLYAHFYREQAKALTFDIICHDLFPTYPMTTSKPREMTSLFITW 60
           MPDSLKSSPFALYAFYQLYAHFYREQAKALTFDIICHDLFPTYPMTTSKPREMTSLFITW
Sbjct: 1   MPDSLKSSPFALYAFYQLYAHFYREQAKALTFDIICHDLFPTYPMTTSKPREMTSLFITW 60

Query: 61  KKKDSSGDYILRGCIGTFAKLPLLKGIEKYSLVSALQDTRFPPIAVNELKKLKVSCNILH 120
           KKKDSSGDYILRGCIGTFAKLPLLKGIEKYSLVSALQDTRFPPIAVNELKKLKVSCNILH
Sbjct: 61  KKKDSSGDYILRGCIGTFAKLPLLKGIEKYSLVSALQDTRFPPIAVNELKKLKVSCNILH 120

Query: 121 DFKTIFNDQKGDIFDWDVGVHGIELLFKHPKTSKLCSATFLPEVMPEQGWDKEDTFQNLI 180
           DFKTIFNDQKGDIFDWDVGVHGIELLFKHPKTSKLCSATFLPEVMPEQGWDKEDTFQNLI
Sbjct: 121 DFKTIFNDQKGDIFDWDVGVHGIELLFKHPKTSKLCSATFLPEVMPEQGWDKEDTFQNLI 180

Query: 181 EKAGCWEHIDIIMNNYEEYFLEVIRYKGDKSEIGYNEFKNLLEK 224
           EKAGCWEHIDIIMNNYEEYFLEVIRYKGDKSEIGYNEFKNLLEK
Sbjct: 181 EKAGCWEHIDIIMNNYEEYFLEVIRYKGDKSEIGYNEFKNLLEK 224

>AFR560W [3752] [Homologous to ScYOR289W - SH]
           complement(1436468..1437157) [690 bp, 229 aa]
          Length = 229

 Score =  295 bits (756), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 135/225 (60%), Positives = 175/225 (77%), Gaps = 3/225 (1%)

Query: 1   MPDS--LKSSPFALYAFYQLYAHFYREQAKALTFDIICHDLFPTYPMTTSKPREMTSLFI 58
           MP S  ++ SPF+ YAFYQLYA+F+++ A  +TF  + + L+  YPM   +  E +S+FI
Sbjct: 1   MPQSQGIERSPFSFYAFYQLYAYFHKD-APTVTFGAVKNKLYHHYPMAAGRENEHSSVFI 59

Query: 59  TWKKKDSSGDYILRGCIGTFAKLPLLKGIEKYSLVSALQDTRFPPIAVNELKKLKVSCNI 118
           TWKK D  G+Y LRGCIGTFAKLPLL+GIEKYSL++ALQD+RFPPI V EL KLK SCN+
Sbjct: 60  TWKKHDERGEYQLRGCIGTFAKLPLLRGIEKYSLIAALQDSRFPPIEVGELAKLKCSCNV 119

Query: 119 LHDFKTIFNDQKGDIFDWDVGVHGIELLFKHPKTSKLCSATFLPEVMPEQGWDKEDTFQN 178
           L  FKT+F +  G+I+DW VG HG+ L F+HP T + CSATFLPEVM EQGW + +TF+N
Sbjct: 120 LSHFKTVFEEGAGNIYDWKVGRHGVILRFRHPTTGRTCSATFLPEVMVEQGWSQLETFEN 179

Query: 179 LIEKAGCWEHIDIIMNNYEEYFLEVIRYKGDKSEIGYNEFKNLLE 223
           LIEKAGCW+H+D +M+NY+ YF+EVI Y+GDKSEI Y++F   L+
Sbjct: 180 LIEKAGCWQHVDELMDNYDRYFIEVITYRGDKSEITYDDFVKQLK 224

>Kwal_26.9154
          Length = 232

 Score =  283 bits (724), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 135/227 (59%), Positives = 172/227 (75%), Gaps = 4/227 (1%)

Query: 1   MPDSLKSSPFALYAFYQLYAHFYREQAKALTFDIICHDLFPTYPMTTSKPREMTSLFITW 60
           M D + SSPFA YAFYQLYAH + E    L F+ +  +LFP   + + +  E TSLFITW
Sbjct: 1   MTDEIGSSPFAFYAFYQLYAHLHGEDGAELRFEDV-QELFPEQRIESQELSEKTSLFITW 59

Query: 61  KKKDSS-GDYILRGCIGTFAKLPLLKGIEKYSLVSALQDTRFPPIAVNELKKLKVSCNIL 119
           KKK  S   Y LRGCIGTFAKLPLLKGI++YSL++AL+D RF PI  +EL  L+ SCNIL
Sbjct: 60  KKKSGSRTTYELRGCIGTFAKLPLLKGIQQYSLIAALEDHRFSPIKKSELASLRCSCNIL 119

Query: 120 HDFKTIFN--DQKGDIFDWDVGVHGIELLFKHPKTSKLCSATFLPEVMPEQGWDKEDTFQ 177
           H+F+TI++  D  GD +DW +GVHGIEL F+  ++++L SATFLPEV+PEQGWDK +TF+
Sbjct: 120 HNFRTIYSGGDSAGDAYDWKIGVHGIELKFRDARSNRLLSATFLPEVIPEQGWDKRETFR 179

Query: 178 NLIEKAGCWEHIDIIMNNYEEYFLEVIRYKGDKSEIGYNEFKNLLEK 224
           NLI+KAGCWE+ D I++N+ +YF+EVIRY+G KSEI Y EF  LL K
Sbjct: 180 NLIQKAGCWENADAILDNWAQYFVEVIRYEGSKSEISYKEFARLLPK 226

>YOR289W (YOR289W) [5073] chr15 (853354..854109) Member of the DUF51
           family of unknown function, has low similarity to
           uncharacterized C. albicans Orf6.5986p [756 bp, 251 aa]
          Length = 251

 Score =  259 bits (663), Expect = 8e-88,   Method: Compositional matrix adjust.
 Identities = 132/228 (57%), Positives = 162/228 (71%), Gaps = 14/228 (6%)

Query: 7   SSPFALYAFYQLYAHFYREQAKALTFDIICHDLFPTYPMTTSKPREMTSLFITWKKKDSS 66
           SSPFA YAFYQLY+H    ++ +L+ + I   L+P + +  +   E TSLFITWKKK + 
Sbjct: 23  SSPFAFYAFYQLYSHLNPGKSSSLSLEDIRRRLYPDFKIDYN---EKTSLFITWKKKSNK 79

Query: 67  G--------DYILRGCIGTFAKLPLLKGIEKYSLVSALQDTRFPPIAVNELKKLKVSCNI 118
                    +YILRGCIGTFAK+P+  GIEKYSL++AL+D RF PI   EL  LK SCNI
Sbjct: 80  HHTIDTNEENYILRGCIGTFAKMPIAHGIEKYSLIAALEDRRFSPIQKRELVDLKCSCNI 139

Query: 119 LHDFKTIF---NDQKGDIFDWDVGVHGIELLFKHPKTSKLCSATFLPEVMPEQGWDKEDT 175
           L +FKTIF    +  GDIFDW++G HGIEL FKHPKT   CSATFLP+VMPEQ W+KEDT
Sbjct: 140 LGNFKTIFRGGGNPNGDIFDWELGKHGIELYFKHPKTGTTCSATFLPDVMPEQHWNKEDT 199

Query: 176 FQNLIEKAGCWEHIDIIMNNYEEYFLEVIRYKGDKSEIGYNEFKNLLE 223
           F NLIEKAG W +I  +M+N+E YF+EVIRY+G KS I Y EF   L+
Sbjct: 200 FANLIEKAGYWGNISEVMDNFETYFIEVIRYEGKKSSITYEEFNKQLK 247

>Scas_692.46
          Length = 264

 Score =  244 bits (624), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 128/234 (54%), Positives = 166/234 (70%), Gaps = 20/234 (8%)

Query: 3   DSLKSSPFALYAFYQLYAHFYREQAKALTFDIICHDLFPTYPMTTSKPREMTSLFITWKK 62
           +SL SSP+A YAFY+LY +     AK  T + +   L+P + +    P+ +TSLFITWKK
Sbjct: 36  ESLASSPYAFYAFYELYKYLGL-TAKRHTLNQVGEILYPDFKLN---PKLITSLFITWKK 91

Query: 63  K--------DSSGDYILRGCIGTFAKLPLLKGIEKYSLVSALQDTRFPPIAVNELKKLKV 114
           +        D  G YILRGCIGTFAK+P+ KGIE++S+++A +D RFPP+   E+ KLK 
Sbjct: 92  QTKKYLQFADDDG-YILRGCIGTFAKMPIDKGIERFSIIAATEDNRFPPVGEEEISKLKC 150

Query: 115 SCNILHDFKTIF----NDQKGDIFDWDVGVHGIELLFKHPKTSKLCSATFLPEVMPEQGW 170
            CNIL +F+TIF    +D++GDIF+W++GVHGIEL FK+     + S+TFLPEVM EQ W
Sbjct: 151 CCNILQNFETIFSKNGDDKEGDIFNWELGVHGIELKFKY---KGIHSSTFLPEVMIEQDW 207

Query: 171 DKEDTFQNLIEKAGCWEHIDIIMNNYEEYFLEVIRYKGDKSEIGYNEFKNLLEK 224
           DKEDTF+NLIEKAGC  H+  IM+NYEEYF+EVIRY+G KS I Y  FK  L K
Sbjct: 208 DKEDTFRNLIEKAGCERHVTEIMDNYEEYFIEVIRYEGRKSAISYKTFKKELSK 261

>CAGL0M04763g 513555..514259 similar to tr|Q12012 Saccharomyces
           cerevisiae YOR289w, hypothetical start
          Length = 234

 Score =  234 bits (596), Expect = 7e-78,   Method: Compositional matrix adjust.
 Identities = 122/226 (53%), Positives = 156/226 (69%), Gaps = 16/226 (7%)

Query: 10  FALYAFYQLYAHFYREQAKALTFDIICHDLFPTYPMTTSKPREMTSLFITWKKKDSS--- 66
           +A YAF QLY H    Q +  +   +   L+ T    T   +E TSLFITWK+ DS    
Sbjct: 9   YAFYAFLQLYKHMGHVQ-RDYSLRQVAEALYDT----TLIIKEDTSLFITWKRLDSQKTS 63

Query: 67  ------GDYILRGCIGTFAKLPLLKGIEKYSLVSALQDTRFPPIAVNELKKLKVSCNILH 120
                   Y LRGCIGTFAKLP+  GI++YSL++AL+D+RF PI+  ELK LK SCNIL 
Sbjct: 64  IDSDDDDGYALRGCIGTFAKLPIEAGIQRYSLIAALEDSRFTPISERELKTLKCSCNILR 123

Query: 121 DFKTIFN--DQKGDIFDWDVGVHGIELLFKHPKTSKLCSATFLPEVMPEQGWDKEDTFQN 178
            F+ I++  D  GDI +W++G +GIELLFKHPK+ K CSATFLP+VM EQGWDK++TF N
Sbjct: 124 HFEKIYSSGDDHGDIDNWEIGKNGIELLFKHPKSGKTCSATFLPDVMVEQGWDKKETFLN 183

Query: 179 LIEKAGCWEHIDIIMNNYEEYFLEVIRYKGDKSEIGYNEFKNLLEK 224
           LI+KAGCW     I+N+YE+YFLEVI+Y+G KSEI Y+ F +  EK
Sbjct: 184 LIQKAGCWNEAGQILNDYEKYFLEVIKYEGKKSEITYDAFISGFEK 229

>KLLA0D02464g complement(209705..210388) gi|5679592|emb|CAB51774.1
           Kluyveromyces lactis hypothetical protein, start by
           similarity
          Length = 227

 Score =  233 bits (593), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 111/220 (50%), Positives = 159/220 (72%), Gaps = 9/220 (4%)

Query: 7   SSPFALYAFYQLYAHFYREQAKALTFDIICHDLFPTYPMTTSKPREMTSLFITWKKKDSS 66
           SSP+A YAFYQLY+ FYR     +T + +   L+    +     R  + LF+TWKK    
Sbjct: 6   SSPYAFYAFYQLYSQFYR--VPKITLETVNDFLYQGKGLKPEFAR--SPLFVTWKKLKK- 60

Query: 67  GDYILRGCIGTFAKLPLLKGIEKYSLVSALQDTRFPPIAVNELKKLKVSCNILHDFKTIF 126
           G+Y LRGCIGTF++  + +G+++Y+L+SALQD+RF PI   EL +L+  CN+L  FKTI+
Sbjct: 61  GEYQLRGCIGTFSEGKIEEGLKRYALISALQDSRFTPIEREELSQLRCGCNLLSQFKTIY 120

Query: 127 NDQ----KGDIFDWDVGVHGIELLFKHPKTSKLCSATFLPEVMPEQGWDKEDTFQNLIEK 182
           + +     GDI++W++G HGIE+ F+HPKT+   SATFLPEV+PEQGWD+ +TF+NLIEK
Sbjct: 121 SSEGTGNSGDIWNWEIGKHGIEIKFRHPKTNSRMSATFLPEVIPEQGWDQRETFENLIEK 180

Query: 183 AGCWEHIDIIMNNYEEYFLEVIRYKGDKSEIGYNEFKNLL 222
           AGCW +++ +M ++E+YF EVIRY+G KSEI ++EF+  L
Sbjct: 181 AGCWNYLEEVMKHWEKYFDEVIRYEGTKSEIAWDEFETGL 220

>Scas_718.61
          Length = 394

 Score = 32.7 bits (73), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 25/92 (27%), Positives = 44/92 (47%), Gaps = 4/92 (4%)

Query: 108 ELKKLKVSCNILHDFKTIFNDQKGDIFDWDVGVHGIELLFKHPKTSKLCSATFLPEVMPE 167
            L++LK S +IL+D    ++  K D  D+    +G++ +F   K  KL         + +
Sbjct: 260 SLQRLKPSLDILYDVTIGYSGVKQD--DYGENTYGLKSIFFEGKYPKLVDIYIRSYDIKD 317

Query: 168 QGWDKEDTFQNLIEKAGCWEHIDIIMNNYEEY 199
              D E+ F   I K   W+  D+++ NY +Y
Sbjct: 318 IPLDNEEEFIEWIYKV--WQEKDLLLENYYKY 347

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.322    0.140    0.434 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 8,005,660
Number of extensions: 348275
Number of successful extensions: 797
Number of sequences better than 10.0: 10
Number of HSP's gapped: 781
Number of HSP's successfully gapped: 10
Length of query: 224
Length of database: 16,596,109
Length adjustment: 98
Effective length of query: 126
Effective length of database: 13,203,545
Effective search space: 1663646670
Effective search space used: 1663646670
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 59 (27.3 bits)