Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Sklu_2397.884884839710.0
Kwal_27.968884185324510.0
Scas_626.683986922150.0
KLLA0D10197g85667920590.0
AAL175W88367117630.0
YML099C (ARG81)88069617110.0
CAGL0H06875g7024978391e-100
YBR240C (THI2)450551453e-09
Scas_597.4475471411e-08
Kwal_14.1631443441321e-07
KLLA0F10373g348441301e-07
AFL033W382521302e-07
YDR421W (ARO80)950431204e-06
KLLA0A10329g639581196e-06
YDR213W (UPC2)913511171e-05
Scas_674.12*909361142e-05
Kwal_26.7095838441133e-05
Sklu_1373.2608531133e-05
YLR228C (ECM22)814581133e-05
YMR280C (CAT8)1433411133e-05
CAGL0C01199g922471115e-05
KLLA0F20680g787531115e-05
Kwal_56.24566755381107e-05
Scas_717.33904391107e-05
KLLA0F22990g1253361099e-05
Sklu_2434.10983521081e-04
Kwal_23.3178611431081e-04
AGL099C747381081e-04
CAGL0F05357g601471081e-04
CAGL0J07150g1022491081e-04
Scas_696.441164411081e-04
KLLA0C17050g955361071e-04
Scas_663.12944501071e-04
Kwal_55.20722827421072e-04
KLLA0E19701g681471062e-04
YDR207C (UME6)836331062e-04
CAGL0B03421g1355521062e-04
Scas_596.4701411052e-04
Sklu_1622.2778361052e-04
Kwal_26.6732676371053e-04
CAGL0F07865g844331053e-04
ABL121C1285371043e-04
YLR256W (HAP1)1502581043e-04
KLLA0D01452g1445291043e-04
ABL099W800411044e-04
Kwal_56.23058775421034e-04
Kwal_23.3122788471034e-04
Scas_550.5*832451035e-04
AFR096W852571025e-04
KLLA0F00572g597351026e-04
Kwal_27.102321209411027e-04
ADR405C807501017e-04
Kwal_26.6805944411017e-04
KLLA0A03421g880501018e-04
Scas_573.41478491018e-04
KLLA0C16489g728421008e-04
Scas_679.26775471000.001
AGL091W866331000.001
CAGL0D02904g887331000.001
Kwal_56.24670643361000.001
AGL206C735541000.001
Sklu_2064.2922421000.001
KLLA0A06039g65736990.001
ACL058W81739990.001
KLLA0F14322g71748990.001
CAGL0L04400g98748990.001
KLLA0F04213g76842990.001
Sklu_2296.691948990.001
Kwal_23.652959860980.001
AFR117C115235980.002
ADR199C94445980.002
YLR014C (PPR1)90438980.002
KLLA0D10153g65543970.002
CAGL0K05841g137246980.002
AGR061C61250970.002
KLLA0D00484g100444970.002
CAGL0H01507g79438960.002
Sklu_2376.692237960.003
KLLA0A01804g94539960.003
ADR404C87534960.003
KLLA0A04169g77533960.003
Kwal_55.2067425238930.004
Kwal_23.642573544950.004
YAL051W (OAF1)106249950.004
KLLA0F09559g65837940.004
Scas_521.289038940.004
Sklu_1973.177738940.005
KLLA0D05038g67338930.006
YLR266C (PDR8)70132930.006
Kwal_47.1723394836930.006
YGL013C (PDR1)106852930.007
ADR403C97052930.007
Scas_721.9486933930.007
AAL057C80938930.007
Kwal_23.290588156920.008
CAGL0M12298g99449920.008
Kwal_14.2619116738920.009
KLLA0F19602g60336910.009
YCR106W (RDS1)83240920.010
YJL206C75855910.010
KLLA0E14036g67842910.011
CAGL0F03025g92842910.011
KLLA0A09119g108238910.012
Kwal_23.653755252900.012
KLLA0F22880g116446910.013
YDL170W (UGA3)52829900.014
Scas_661.2374167900.014
YDR034C (LYS14)79036900.014
CAGL0K11902g83136900.014
CAGL0M03025g125441900.014
Scas_590.2117230900.015
CAGL0D03850g83433900.016
AFR171W61237890.016
Scas_688.1776929890.017
KLLA0A03443g97561900.017
AGL233C87248890.017
Sklu_2301.151738890.018
Scas_556.6102241890.018
AGR369W105136890.019
Sklu_2191.271845890.020
YLR278C134129890.020
KLLA0F18084g86029890.021
Kwal_47.1768185454890.021
YBR297W (MAL33)46843880.023
Scas_659.1075729880.023
Scas_625.5114146880.024
CAGL0A00451g110747880.025
CAGL0E05434g81644880.026
KLLA0F02387g72737880.027
YJL089W (SIP4)82933880.028
CAGL0A04455g109836880.028
ADR365W70167870.029
Sklu_2321.390638870.030
KLLA0F10835g75639870.031
Kwal_34.1575162838870.032
Scas_702.7111352870.033
KLLA0C10923g77551870.034
KLLA0D11286g67835860.037
YOR337W (TEA1)75937860.039
Kwal_26.810997038860.040
ACR241C79535860.041
Scas_699.793550860.041
YOR172W (YRM1)78641850.051
Kwal_23.475481242850.059
YOR363C (PIP2)99652850.061
KLLA0C14212g104039850.062
KLLA0C04620g126938850.064
Kwal_27.10852104648850.064
YBL066C (SEF1)105736850.065
YLL054C76941840.068
KLLA0E20405g113836840.071
CAGL0G08844g84736840.075
YHR056C (RSC30)88342840.082
CAGL0L03377g120933840.085
Scas_588.1183551830.086
KLLA0D12650g65133830.091
KLLA0E18194g86545830.094
KLLA0D09977g63433830.096
Scas_234.133733820.097
ACR028C60140820.11
YBL005W (PDR3)97633830.11
Scas_630.1470147830.11
Scas_657.385624830.11
KLLA0E02618g110949830.11
YKL038W (RGT1)117046830.11
YKL222C70537820.11
Scas_449.163645820.12
YDR303C (RSC3)88547820.12
Sklu_2268.287535820.12
Kwal_33.1393479740820.12
Scas_662.890636820.13
Scas_709.5175939820.13
CAGL0I07755g105342820.13
CAGL0L04576g86532820.13
YIL130W96450820.13
CAGL0L01903g128738820.13
Scas_720.5889029820.14
KLLA0F04609g91636820.14
Scas_711.3193229820.14
CAGL0G09757g142328820.16
YPL248C (GAL4)88129810.17
KLLA0C03201g65038810.18
YKL015W (PUT3)97938810.18
YPR196W47029800.18
Scas_526.3110929810.18
Scas_715.3111536810.19
Scas_542.890245800.20
Kwal_14.81956832800.22
Sklu_2207.453249800.22
KLLA0F13904g57954800.22
Sklu_1993.282336800.22
Sklu_2023.365829800.24
KLLA0F25630g100764790.27
Kwal_47.1750692440790.29
YOR162C (YRR1)81029790.29
AGL361C69639790.30
Kwal_33.1311877944790.30
KLLA0D15356g62453790.31
Kwal_26.744871439780.33
Kwal_14.163645640780.38
Sklu_2384.683144780.38
YOR380W (RDR1)54648780.38
YKR064W86339780.38
AGR280C110628770.54
YNR063W60734760.55
KLLA0C19228g59129760.55
Sklu_2411.1168736760.64
Scas_669.863735750.74
YMR019W (STB4)94941760.77
Kwal_23.351457931750.83
AER370W80136750.85
Kwal_26.666457943750.88
Kwal_47.1808974522750.88
Scas_605.941823740.96
AFL160C64845741.0
KLLA0C01023g63648741.1
CAGL0I03784g270117731.1
YJL103C61835741.1
Scas_638.14104340741.1
CAGL0F02519g83236741.3
Sklu_2311.53161134741.3
KLLA0F10417g50735731.3
YHR178W (STB5)74338731.3
YDR520C77244731.4
YGR288W (MAL13)47351721.6
CAGL0F07755g61138721.8
Scas_702.7d97838722.0
Kwal_47.1693966933722.1
CAGL0H00396g94032722.2
AFL031W51735712.6
YFL052W46549702.7
Kwal_8.58063844712.8
Scas_678.26d125448693.3
Scas_680.2573829703.4
CAGL0M03135g1073112694.1
KLLA0D00396g36151684.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Sklu_2397.8
         (848 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Sklu_2397.8 YML099C, Contig c2397 9784-12330                         1534   0.0  
Kwal_27.9688                                                          948   0.0  
Scas_626.6                                                            857   0.0  
KLLA0D10197g complement(861726..864296) similar to sp|P05085 Sac...   797   0.0  
AAL175W [12] [Homologous to ScYML099C (ARG81) - NSH] complement(...   683   0.0  
YML099C (ARG81) [3872] chr13 complement(74398..77040) Component ...   663   0.0  
CAGL0H06875g complement(682518..684626) some similarities with s...   327   e-100
YBR240C (THI2) [419] chr2 complement(700447..701799) Zinc-finger...    60   3e-09
Scas_597.4                                                             59   1e-08
Kwal_14.1631                                                           55   1e-07
KLLA0F10373g 957948..958994 some similarities with sp|P38141 Sac...    55   1e-07
AFL033W [3160] [Homologous to ScYBR240C (THI2) - SH] complement(...    55   2e-07
YDR421W (ARO80) [1245] chr4 (1312028..1314880) Positive transcri...    51   4e-06
KLLA0A10329g 903873..905792 some similarities with ca|CA6113|IPF...    50   6e-06
YDR213W (UPC2) [1051] chr4 (889744..892485) Sterol regulatory el...    50   1e-05
Scas_674.12*                                                           49   2e-05
Kwal_26.7095                                                           48   3e-05
Sklu_1373.2 YDR207C, Contig c1373 1069-2895                            48   3e-05
YLR228C (ECM22) [3628] chr12 complement(600021..602465) Sterol r...    48   3e-05
YMR280C (CAT8) [4234] chr13 complement(827027..831328) Transcrip...    48   3e-05
CAGL0C01199g complement(121944..124712) similar to tr|Q12151 Sac...    47   5e-05
KLLA0F20680g 1924148..1926511 weakly similar to sp|P39001 Saccha...    47   5e-05
Kwal_56.24566                                                          47   7e-05
Scas_717.33                                                            47   7e-05
KLLA0F22990g 2134385..2138146 similar to sp|P12351 Saccharomyces...    47   9e-05
Sklu_2434.10 YAL051W, Contig c2434 22765-25716                         46   1e-04
Kwal_23.3178                                                           46   1e-04
AGL099C [4213] [Homologous to ScYDR207C (UME6) - SH] (516587..51...    46   1e-04
CAGL0F05357g 541830..543635 some similarities with sp|P39001 Sac...    46   1e-04
CAGL0J07150g complement(686734..689802) similar to sp|P39720 Sac...    46   1e-04
Scas_696.44                                                            46   1e-04
KLLA0C17050g 1490472..1493339 some similarities with ca|CA3454|I...    46   1e-04
Scas_663.12                                                            46   1e-04
Kwal_55.20722                                                          46   2e-04
KLLA0E19701g complement(1739869..1741914) some similarities with...    45   2e-04
YDR207C (UME6) [1046] chr4 complement(865005..867515) Global tra...    45   2e-04
CAGL0B03421g complement(336071..340138) similar to sp|P12351 Sac...    45   2e-04
Scas_596.4                                                             45   2e-04
Sklu_1622.2 YDR034C, Contig c1622 1522-3858                            45   2e-04
Kwal_26.6732                                                           45   3e-04
CAGL0F07865g complement(768270..770804) similar to tr|Q12151 Sac...    45   3e-04
ABL121C [471] [Homologous to ScYMR280C (CAT8) - SH] (170784..174...    45   3e-04
YLR256W (HAP1) [3650] chr12 (646417..650925) Transcription facto...    45   3e-04
KLLA0D01452g 124018..128355 gi|3228691|gb|AAC23607.1 Kluyveromyc...    45   3e-04
ABL099W [493] [Homologous to ScYDR034C (LYS14) - SH] complement(...    45   4e-04
Kwal_56.23058                                                          44   4e-04
Kwal_23.3122                                                           44   4e-04
Scas_550.5*                                                            44   5e-04
AFR096W [3288] [Homologous to ScYJL089W (SIP4) - SH] complement(...    44   5e-04
KLLA0F00572g complement(42710..44503) some similarities with ca|...    44   6e-04
Kwal_27.10232                                                          44   7e-04
ADR405C [2145] [Homologous to ScYAL051W (OAF1) - SH; ScYOR363C (...    44   7e-04
Kwal_26.6805                                                           44   7e-04
KLLA0A03421g 308414..311056 weakly similar to sp|P39720 Saccharo...    44   8e-04
Scas_573.4                                                             44   8e-04
KLLA0C16489g 1444456..1446642 some similarities with ca|CA2184|I...    43   8e-04
Scas_679.26                                                            43   0.001
AGL091W [4220] [Homologous to ScYLR228C (ECM22) - SH; ScYDR213W ...    43   0.001
CAGL0D02904g complement(302952..305615) similar to sp|P07272 Sac...    43   0.001
Kwal_56.24670                                                          43   0.001
AGL206C [4106] [Homologous to NOHBY] (311846..314053) [2208 bp, ...    43   0.001
Sklu_2064.2 , Contig c2064 873-3641                                    43   0.001
KLLA0A06039g 557368..559341 weakly similar to sp|P36023 Saccharo...    43   0.001
ACL058W [991] [Homologous to NOHBY] complement(261723..264176) [...    43   0.001
KLLA0F14322g 1328925..1331078 gi|32440908|emb|CAE00852.1 Kluyver...    43   0.001
CAGL0L04400g complement(511762..514725) similar to tr|Q12340 Sac...    43   0.001
KLLA0F04213g 400673..402979 similar to sp|P40971 Saccharomyces c...    43   0.001
Sklu_2296.6 YJL089W, Contig c2296 12179-14938 reverse complement       43   0.001
Kwal_23.6529                                                           42   0.001
AFR117C [3309] [Homologous to ScYLR256W (HAP1) - SH] (646832..65...    42   0.002
ADR199C [1940] [Homologous to ScYDR421W (ARO80) - SH] (1048530.....    42   0.002
YLR014C (PPR1) [3432] chr12 complement(172267..174981) Transcrip...    42   0.002
KLLA0D10153g 858016..859983 weakly similar to sp|P35995 Saccharo...    42   0.002
CAGL0K05841g 572315..576433 similar to sp|P12351 Saccharomyces c...    42   0.002
AGR061C [4371] [Homologous to ScYLR098C (CHA4) - SH] (831058..83...    42   0.002
KLLA0D00484g 44879..47893 no similarity, hypothetical start            42   0.002
CAGL0H01507g complement(147689..150073) similar to sp|Q06639 Sac...    42   0.002
Sklu_2376.6 , Contig c2376 12573-15341 reverse complement              42   0.003
KLLA0A01804g complement(159689..162526) similar to sgd|S0002829 ...    42   0.003
ADR404C [2144] [Homologous to ScYAL051W (OAF1) - SH; ScYOR363C (...    42   0.003
KLLA0A04169g complement(376273..378600) similar to sgd|S0004218 ...    42   0.003
Kwal_55.20674                                                          40   0.004
Kwal_23.6425                                                           41   0.004
YAL051W (OAF1) [17] chr1 (48565..51753) Transcription factor req...    41   0.004
KLLA0F09559g complement(876719..878695) some similarities with s...    41   0.004
Scas_521.2                                                             41   0.004
Sklu_1973.1 YDR303C, Contig c1973 815-3148 reverse complement          41   0.005
KLLA0D05038g 433653..435674 weakly similar to sp|P40971 Saccharo...    40   0.006
YLR266C (PDR8) [3660] chr12 complement(675621..677726) Zn[2]-Cys...    40   0.006
Kwal_47.17233                                                          40   0.006
YGL013C (PDR1) [1960] chr7 complement(469095..472301) Zinc-finge...    40   0.007
ADR403C [2143] [Homologous to ScYAL051W (OAF1) - SH; ScYOR363C (...    40   0.007
Scas_721.94                                                            40   0.007
AAL057C [130] [Homologous to ScYDR303C (RSC3) - SH; ScYHR056C (R...    40   0.007
Kwal_23.2905                                                           40   0.008
CAGL0M12298g complement(1225753..1228737) similar to sp|P39720 S...    40   0.008
Kwal_14.2619                                                           40   0.009
KLLA0F19602g complement(1814949..1816760) similar to sp|P43634 S...    40   0.009
YCR106W (RDS1) [627] chr3 (310954..313452) Protein with similari...    40   0.010
YJL206C (YJL206C) [2722] chr10 complement(47659..49935) Protein ...    40   0.010
KLLA0E14036g complement(1239566..1241602) some similarities with...    40   0.011
CAGL0F03025g 295783..298569 similar to sp|Q04052 Saccharomyces c...    40   0.011
KLLA0A09119g complement(797533..800781) weakly similar to sp|P12...    40   0.012
Kwal_23.6537                                                           39   0.012
KLLA0F22880g 2123577..2127071 some similarities with ca|CA3639|I...    40   0.013
YDL170W (UGA3) [701] chr4 (156319..157905) Transcriptional activ...    39   0.014
Scas_661.23                                                            39   0.014
YDR034C (LYS14) [885] chr4 complement(509732..512104) Transcript...    39   0.014
CAGL0K11902g complement(1148381..1150876) similar to sp|P40971 S...    39   0.014
CAGL0M03025g complement(341849..345613) similar to sp|P39113 Sac...    39   0.014
Scas_590.2                                                             39   0.015
CAGL0D03850g 384689..387193 weakly similar to sp|Q06639 Saccharo...    39   0.016
AFR171W [3363] [Homologous to NOHBY] complement(752592..754430) ...    39   0.016
Scas_688.17                                                            39   0.017
KLLA0A03443g 311628..314555 weakly similar to sp|P39720 Saccharo...    39   0.017
AGL233C [4079] [Homologous to ScYKL222C - NSH; ScYOR172W - NSH] ...    39   0.017
Sklu_2301.1 , Contig c2301 1246-2795 reverse complement                39   0.018
Scas_556.6                                                             39   0.018
AGR369W [4680] [Homologous to ScYBL066C (SEF1) - SH] complement(...    39   0.019
Sklu_2191.2 YKL222C, Contig c2191 6517-8673 reverse complement         39   0.020
YLR278C (YLR278C) [3671] chr12 complement(700001..704026) Protei...    39   0.020
KLLA0F18084g complement(1652031..1654613) no similarity, hypothe...    39   0.021
Kwal_47.17681                                                          39   0.021
YBR297W (MAL33) [474] chr2 (800479..801885) Maltose fermentation...    39   0.023
Scas_659.10                                                            39   0.023
Scas_625.5                                                             39   0.024
CAGL0A00451g 47557..50880 similar to sp|P12383 Saccharomyces cer...    39   0.025
CAGL0E05434g 532577..535027 similar to sp|P47988 Saccharomyces c...    39   0.026
KLLA0F02387g complement(213669..215852) similar to sp|P47988 Sac...    39   0.027
YJL089W (SIP4) [2826] chr10 (265842..268331) Transcriptional act...    39   0.028
CAGL0A04455g 432854..436150 similar to sp|P34228 Saccharomyces c...    39   0.028
ADR365W [2106] [Homologous to ScYOR337W (TEA1) - SH] complement(...    38   0.029
Sklu_2321.3 YLR014C, Contig c2321 8747-11467                           38   0.030
KLLA0F10835g 997512..999782 no similarity, hypothetical start          38   0.031
Kwal_34.15751                                                          38   0.032
Scas_702.7                                                             38   0.033
KLLA0C10923g complement(939148..941475) similar to sp|P07272 Sac...    38   0.034
KLLA0D11286g complement(964642..966678) no similarity, hypotheti...    38   0.037
YOR337W (TEA1) [5116] chr15 (954339..956618) Ty1 enhancer activa...    38   0.039
Kwal_26.8109                                                           38   0.040
ACR241C [1288] [Homologous to ScYKR064W - SH] (784358..786745) [...    38   0.041
Scas_699.7                                                             38   0.041
YOR172W (YRM1) [4969] chr15 (654210..656570) Protein with simila...    37   0.051
Kwal_23.4754                                                           37   0.059
YOR363C (PIP2) [5140] chr15 complement(1020218..1023208) Transcr...    37   0.061
KLLA0C14212g complement(1229219..1232341) some similarities with...    37   0.062
KLLA0C04620g complement(422705..426514) weakly similar to sp|Q05...    37   0.064
Kwal_27.10852                                                          37   0.064
YBL066C (SEF1) [131] chr2 complement(96906..100079) Protein with...    37   0.065
YLL054C (YLL054C) [3369] chr12 complement(32894..35203) Protein ...    37   0.068
KLLA0E20405g <1805948..1809364 gi|3024604|sp|P87164|SEF1_KLULA K...    37   0.071
CAGL0G08844g complement(846590..849133) similar to sp|P40467 Sac...    37   0.075
YHR056C (RSC30) [2344] chr8 complement(215184..217835) Component...    37   0.082
CAGL0L03377g complement(382932..386561) some similarities with s...    37   0.085
Scas_588.11                                                            37   0.086
KLLA0D12650g complement(1073580..1075535) weakly similar to ca|C...    37   0.091
KLLA0E18194g 1613115..1615712 similar to sp|P25502 Saccharomyces...    37   0.094
KLLA0D09977g complement(841852..843756) weakly similar to sp|P40...    37   0.096
Scas_234.1                                                             36   0.097
ACR028C [1076] [Homologous to NOHBY] (408701..410506) [1806 bp, ...    36   0.11 
YBL005W (PDR3) [189] chr2 (217435..220365) Zinc-finger transcrip...    37   0.11 
Scas_630.14                                                            37   0.11 
Scas_657.3                                                             37   0.11 
KLLA0E02618g 244696..248025 no similarity, hypothetical start          37   0.11 
YKL038W (RGT1) [3220] chr11 (365248..368760) Protein involved in...    37   0.11 
YKL222C (YKL222C) [3053] chr11 complement(3504..5621) Protein wi...    36   0.11 
Scas_449.1                                                             36   0.12 
YDR303C (RSC3) [1131] chr4 complement(1068721..1071378) Componen...    36   0.12 
Sklu_2268.2 YKR064W, Contig c2268 4260-6887 reverse complement         36   0.12 
Kwal_33.13934                                                          36   0.12 
Scas_662.8                                                             36   0.13 
Scas_709.51                                                            36   0.13 
CAGL0I07755g complement(745315..748476) similar to tr|Q12180 Sac...    36   0.13 
CAGL0L04576g 526960..529557 similar to tr|Q12340 Saccharomyces c...    36   0.13 
YIL130W (YIL130W) [2546] chr9 (102782..105676) Protein that cont...    36   0.13 
CAGL0L01903g 218703..222566 similar to sp|P32862 Saccharomyces c...    36   0.13 
Scas_720.58                                                            36   0.14 
KLLA0F04609g complement(451579..454329) similar to sp|P40467 Sac...    36   0.14 
Scas_711.31                                                            36   0.14 
CAGL0G09757g 930351..934622 some similarities with sp|Q05854 Sac...    36   0.16 
YPL248C (GAL4) [5202] chr16 complement(79711..82356) Transcripti...    36   0.17 
KLLA0C03201g complement(286973..288925) similar to sp|P39529 Sac...    36   0.18 
YKL015W (PUT3) [3241] chr11 (408187..411126) Transcription facto...    36   0.18 
YPR196W (YPR196W) [5609] chr16 (931370..932782) Positive regulat...    35   0.18 
Scas_526.3                                                             36   0.18 
Scas_715.3                                                             36   0.19 
Scas_542.8                                                             35   0.20 
Kwal_14.819                                                            35   0.22 
Sklu_2207.4 YJL103C, Contig c2207 6715-8313 reverse complement         35   0.22 
KLLA0F13904g complement(1287758..1289497) some similarities with...    35   0.22 
Sklu_1993.2 YIL130W, Contig c1993 2139-4610 reverse complement         35   0.22 
Sklu_2023.3 YHR178W, Contig c2023 2677-4653 reverse complement         35   0.24 
KLLA0F25630g 2378464..2381487 some similarities with sp|P32862 S...    35   0.27 
Kwal_47.17506                                                          35   0.29 
YOR162C (YRR1) [4961] chr15 complement(639560..641992) Transcrip...    35   0.29 
AGL361C [3951] [Homologous to NOHBY] (24101..26191) [2091 bp, 69...    35   0.30 
Kwal_33.13118                                                          35   0.30 
KLLA0D15356g 1301848..1303722 no similarity, hypothetical start        35   0.31 
Kwal_26.7448                                                           35   0.33 
Kwal_14.1636                                                           35   0.38 
Sklu_2384.6 YKL015W, Contig c2384 10929-13424                          35   0.38 
YOR380W (RDR1) [5153] chr15 (1051286..1052926) Protein with simi...    35   0.38 
YKR064W (YKR064W) [3315] chr11 (562189..564780) Protein with sim...    35   0.38 
AGR280C [4591] [Homologous to ScYLR278C - SH] (1266918..1270238)...    34   0.54 
YNR063W (YNR063W) [4646] chr14 (746940..748763) Protein with sim...    34   0.55 
KLLA0C19228g 1713787..1715562 similar to sp|P53749 Saccharomyces...    34   0.55 
Sklu_2411.11 YMR019W, Contig c2411 20506-22569 reverse complement      34   0.64 
Scas_669.8                                                             33   0.74 
YMR019W (STB4) [3983] chr13 (312155..315004) Sin3p-binding prote...    34   0.77 
Kwal_23.3514                                                           33   0.83 
AER370W [2871] [Homologous to ScYIL130W (GIN1) - SH] complement(...    33   0.85 
Kwal_26.6664                                                           33   0.88 
Kwal_47.18089                                                          33   0.88 
Scas_605.9                                                             33   0.96 
AFL160C [3035] [Homologous to ScYPL248C (GAL4) - SH] (130842..13...    33   1.0  
KLLA0C01023g 76863..78773 similar to sgd|S0002928 Saccharomyces ...    33   1.1  
CAGL0I03784g complement(325276..326088) similar to sp|Q07560 Sac...    33   1.1  
YJL103C (YJL103C) [2812] chr10 complement(228942..230798) Protei...    33   1.1  
Scas_638.14                                                            33   1.1  
CAGL0F02519g 245120..247618 weakly similar to sp|P39529 Saccharo...    33   1.3  
Sklu_2311.5 YLL040C, Contig c2311 5178-14663 reverse complement        33   1.3  
KLLA0F10417g 961004..962527 similar to sp|P38140 Saccharomyces c...    33   1.3  
YHR178W (STB5) [2464] chr8 (459297..461528) Probable transcripti...    33   1.3  
YDR520C (YDR520C) [1333] chr4 complement(1481073..1483391) Prote...    33   1.4  
YGR288W (MAL13) [2233] chr7 (1070298..1071719) Maltose pathway r...    32   1.6  
CAGL0F07755g complement(755947..757782) similar to sp|P40969 Sac...    32   1.8  
Scas_702.7d                                                            32   2.0  
Kwal_47.16939                                                          32   2.1  
CAGL0H00396g complement(37005..39827) similar to sp|P08638 Sacch...    32   2.2  
AFL031W [3162] [Homologous to ScYBR239C - SH] complement(376161....    32   2.6  
YFL052W (YFL052W) [1632] chr6 (28232..29629) Protein with strong...    32   2.7  
Kwal_8.580                                                             32   2.8  
Scas_678.26d1                                                          31   3.3  
Scas_680.25                                                            32   3.4  
CAGL0M03135g complement(354638..357859) similar to sp|P47029 Sac...    31   4.1  
KLLA0D00396g complement(36277..37362) some similarities with ca|...    31   4.7  

>Sklu_2397.8 YML099C, Contig c2397 9784-12330
          Length = 848

 Score = 1534 bits (3971), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 747/848 (88%), Positives = 747/848 (88%)

Query: 1   MKVEKSDIRKPRRAKTFTGCWTCRSRKVKCDLGRPSCKRCERSGFECGGYDIKLRWSKPI 60
           MKVEKSDIRKPRRAKTFTGCWTCRSRKVKCDLGRPSCKRCERSGFECGGYDIKLRWSKPI
Sbjct: 1   MKVEKSDIRKPRRAKTFTGCWTCRSRKVKCDLGRPSCKRCERSGFECGGYDIKLRWSKPI 60

Query: 61  KFDRYGVQLXXXXXXXXXXXXXXQFQRRNIAFVRXXXXXXXXXXXXXXLSALHSPPLENI 120
           KFDRYGVQL              QFQRRNIAFVR              LSALHSPPLENI
Sbjct: 61  KFDRYGVQLPPSPNSPDSGSDEPQFQRRNIAFVRYQDEYEFYEDMDDELSALHSPPLENI 120

Query: 121 AGDKTWIINKFGVFRGTEXXXXXXXXXXXXXXXXSYNRXXXXXXXXXXXXXXXXXXXXXX 180
           AGDKTWIINKFGVFRGTE                SYNR                      
Sbjct: 121 AGDKTWIINKFGVFRGTEKVKKKYVPRKKRKRNVSYNRGGSVSSKLSSTTSVKSKGSSSI 180

Query: 181 XXXXPTDLFDFDFSSMNFTGHEWISNELRDDALLSASAVQGIPTNTFTFPAGGNHTESSA 240
               PTDLFDFDFSSMNFTGHEWISNELRDDALLSASAVQGIPTNTFTFPAGGNHTESSA
Sbjct: 181 SNSTPTDLFDFDFSSMNFTGHEWISNELRDDALLSASAVQGIPTNTFTFPAGGNHTESSA 240

Query: 241 TADFNDAKNAXXXXXXXXXXXXXXXXIQGTVNGGFASIDPIAEVSQVYRLLSHRNEDKDK 300
           TADFNDAKNA                IQGTVNGGFASIDPIAEVSQVYRLLSHRNEDKDK
Sbjct: 241 TADFNDAKNASGQHHGQHQHRNQQSNIQGTVNGGFASIDPIAEVSQVYRLLSHRNEDKDK 300

Query: 301 DVQEQQKHDTHQTIASQEDEFPSLVPLNNLISIHAPGGESRMPESVLEIVPSVVPDPSIF 360
           DVQEQQKHDTHQTIASQEDEFPSLVPLNNLISIHAPGGESRMPESVLEIVPSVVPDPSIF
Sbjct: 301 DVQEQQKHDTHQTIASQEDEFPSLVPLNNLISIHAPGGESRMPESVLEIVPSVVPDPSIF 360

Query: 361 NLQSDKNILLRLPTTGLHVHGLARFLLNYYLQNVADLMTVVALPTNPWKTIYFPRALKAL 420
           NLQSDKNILLRLPTTGLHVHGLARFLLNYYLQNVADLMTVVALPTNPWKTIYFPRALKAL
Sbjct: 361 NLQSDKNILLRLPTTGLHVHGLARFLLNYYLQNVADLMTVVALPTNPWKTIYFPRALKAL 420

Query: 421 GDLAGIGYTXXXXXXXXXXXXXXXCFNLQSKFPKNTPQMRFYLYLGIEFRSQASNFLKKC 480
           GDLAGIGYT               CFNLQSKFPKNTPQMRFYLYLGIEFRSQASNFLKKC
Sbjct: 421 GDLAGIGYTSNSRNSLLNALLAVSCFNLQSKFPKNTPQMRFYLYLGIEFRSQASNFLKKC 480

Query: 481 LNSSAHQERYKDILTAILSMNSIDVVWGTMADCQYHLTICEDFVEERMKTRPKISEKAKA 540
           LNSSAHQERYKDILTAILSMNSIDVVWGTMADCQYHLTICEDFVEERMKTRPKISEKAKA
Sbjct: 481 LNSSAHQERYKDILTAILSMNSIDVVWGTMADCQYHLTICEDFVEERMKTRPKISEKAKA 540

Query: 541 LHRIFSFLKLIQDSTALDKVREGEIVIKDDEDVTGEQLQESQTGQDLNIADGEFKESLNQ 600
           LHRIFSFLKLIQDSTALDKVREGEIVIKDDEDVTGEQLQESQTGQDLNIADGEFKESLNQ
Sbjct: 541 LHRIFSFLKLIQDSTALDKVREGEIVIKDDEDVTGEQLQESQTGQDLNIADGEFKESLNQ 600

Query: 601 KDGKIRIEFVKQPQSSSSGSTPIFTNITSETYYYPKMSTTTQDILSTDALYGLPNSLILC 660
           KDGKIRIEFVKQPQSSSSGSTPIFTNITSETYYYPKMSTTTQDILSTDALYGLPNSLILC
Sbjct: 601 KDGKIRIEFVKQPQSSSSGSTPIFTNITSETYYYPKMSTTTQDILSTDALYGLPNSLILC 660

Query: 661 FSDCVRLVRHREYYKMNKLPAPRKYAKLCTEFEKRLLNWKSEWDFYKPHTREFVNDTIEG 720
           FSDCVRLVRHREYYKMNKLPAPRKYAKLCTEFEKRLLNWKSEWDFYKPHTREFVNDTIEG
Sbjct: 661 FSDCVRLVRHREYYKMNKLPAPRKYAKLCTEFEKRLLNWKSEWDFYKPHTREFVNDTIEG 720

Query: 721 VYHHTMSFYYSLIIYYFTMARDLNNQLLQSYVEKVLSHLNQLSDLIDHKNVKVVPLIWQG 780
           VYHHTMSFYYSLIIYYFTMARDLNNQLLQSYVEKVLSHLNQLSDLIDHKNVKVVPLIWQG
Sbjct: 721 VYHHTMSFYYSLIIYYFTMARDLNNQLLQSYVEKVLSHLNQLSDLIDHKNVKVVPLIWQG 780

Query: 781 FIAGCSSVDSNLQLSFKKWAAKLASSGMGSYWGARQIMFEVWRRRMNGEENDNWCSVYKD 840
           FIAGCSSVDSNLQLSFKKWAAKLASSGMGSYWGARQIMFEVWRRRMNGEENDNWCSVYKD
Sbjct: 781 FIAGCSSVDSNLQLSFKKWAAKLASSGMGSYWGARQIMFEVWRRRMNGEENDNWCSVYKD 840

Query: 841 WEMNLMLS 848
           WEMNLMLS
Sbjct: 841 WEMNLMLS 848

>Kwal_27.9688
          Length = 841

 Score =  948 bits (2451), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 490/853 (57%), Positives = 580/853 (67%), Gaps = 36/853 (4%)

Query: 9   RKPRRAKTFTGCWTCRSRKVKCDLGRPSCKRCERSGFECGGYDIKLRWSKPIKFDRYGVQ 68
           ++ RR KTFTGCWTCRSRKVKCDLG+P+C+RCE+SG ECGGYDIKLRWS  IKF+++G  
Sbjct: 12  KEVRRVKTFTGCWTCRSRKVKCDLGKPNCQRCEKSGLECGGYDIKLRWSPSIKFNKFG-- 69

Query: 69  LXXXXXXXXXXXXXXQFQRRNIAFVRXXXXXXXXXXXXXXLSALHSPPLENIAGDKTWII 128
                          Q QRRN+ FV               LSALHSP  + I+ +KTWII
Sbjct: 70  QVDSNGSPANGTEEPQSQRRNVGFVTYKDEYEFYEDMDEELSALHSPSQDKISDNKTWII 129

Query: 129 NKFGVFRGTEXXXXXXXXXXXXXXXXSYNRXXXXXXXXXXXXXXXXXXXXXXXXXXP-TD 187
            KFGVFRGTE                  +                              +
Sbjct: 130 KKFGVFRGTENVKTKYTPRRKRRQAGRVSEDQIKKPPTTEIKRPHINADSEITSSQSLAN 189

Query: 188 LFDFDFSSMNFTGHEWISNELRDDALLSASAVQG-IPTNTFTFPAGGNHTESSATADFND 246
           LFDFDFSSMNF GHEWI+NELRDDALLSASA+QG    N F  P G   T  SA      
Sbjct: 190 LFDFDFSSMNFNGHEWIANELRDDALLSASAIQGGTMDNLFQRPQG--QTSFSANNRRQS 247

Query: 247 AKNAXXXXXXXXXXXXXXXXIQGTVN-GGFASIDPIAEVSQVYRLLSHRNEDKDKDVQEQ 305
           + N                     +   G A +D   ++S+VY+LL HRNED+ K  Q+ 
Sbjct: 248 SYNTLHLPRRLQPDQEESDQTNNQLQKAGPADVD---DISRVYKLLFHRNEDRSKVTQQA 304

Query: 306 QKHDTHQTIASQEDEFP-SLVPLNNLISIHAPGGESRMPESVLEIVPSVVPDPSIFNLQS 364
                   +   +   P ++VPL+N+I I++ G E RMP+ VLE+V S VPD +IFNL +
Sbjct: 305 P------VVPIDDQHVPRTIVPLDNVILINSSGTEGRMPKQVLEVVNSDVPDHTIFNLPT 358

Query: 365 DKNILLRLPTTGLHVHGLARFLLNYYLQNVADLMTVVALPTNPWKTIYFPRALKALGDLA 424
           + NILLRLPTTGL VHGL RFL+NYYLQNV DLMTVVALPTNPW+TIYFPRA +ALGD+A
Sbjct: 359 NDNILLRLPTTGLKVHGLTRFLMNYYLQNVVDLMTVVALPTNPWRTIYFPRAAQALGDIA 418

Query: 425 GIGYTXXXXXXXXXXXXXXXCFNLQSKFPKNTPQMRFYLYLGIEFRSQASNFLKKCLNSS 484
           G+GYT               CFNLQSKFP+N+P+MRFYL LGIEFR QAS+FLK CL SS
Sbjct: 419 GVGYTSNSRNSLLNAILAVSCFNLQSKFPRNSPEMRFYLQLGIEFRGQASDFLKACLASS 478

Query: 485 AHQERYKDILTAILSMNSIDVVWGTMADCQYHLTICEDFVEERMKTRPKISEKAKALHRI 544
           A QERYKDILTAILSMNSIDVVWGTMADCQYHLT+CE  VEERMKTRPK+S KA+ALHRI
Sbjct: 479 AKQERYKDILTAILSMNSIDVVWGTMADCQYHLTLCEGLVEERMKTRPKLSGKARALHRI 538

Query: 545 FSFLKLIQDSTALDKVREGEIVIKDDEDVTGEQLQESQTGQDLNIADGEFKESLNQKDGK 604
           FSFLKLIQDSTALDKV E EIVI         ++ ES    D++   GEFKESLN+ DGK
Sbjct: 539 FSFLKLIQDSTALDKVHEREIVID-------HRIPESVVENDVSDNGGEFKESLNKVDGK 591

Query: 605 IRIEFVKQPQSSSSGSTPIFTNITSETYYYP---------KMSTTTQDILSTDALYGLPN 655
           IRIE+VK  Q+  SGSTPIF ++ S+TYYYP           S    D+LSTDALYGLPN
Sbjct: 592 IRIEYVK--QNRKSGSTPIFDSVASQTYYYPGNRMGSGDYTKSLEGNDVLSTDALYGLPN 649

Query: 656 SLILCFSDCVRLVRHREYYKMNKLPAPRKYAKLCTEFEKRLLNWKSEWDFYKPHTREFVN 715
           S+IL FSDCVRL RHREYY+ +    P  Y  LC EFEK+L  W SEWDF+KP++ EFVN
Sbjct: 650 SIILLFSDCVRLARHREYYRKHDQDPPESYEILCAEFEKKLSGWTSEWDFHKPNSTEFVN 709

Query: 716 DTIEGVYHHTMSFYYSLIIYYFTMARDLNNQLLQSYVEKVLSHLNQLSDLIDHKNVKVVP 775
           DTIEGVY+HTMSFY SLIIYY TMAR   +Q +Q  V   L++LN+L++LI+ K VK+VP
Sbjct: 710 DTIEGVYYHTMSFYQSLIIYYNTMARGRRHQDIQENVRNALTYLNKLTELIN-KGVKIVP 768

Query: 776 LIWQGFIAGCSSVDSNLQLSFKKWAAKLASSGMGSYWGARQIMFEVWRRRMNGEENDNWC 835
           LIWQGFIAGCS++D++LQL +K+WAA+LA+SGMGSYWGARQIMFEVWRRR+NGE  DNW 
Sbjct: 769 LIWQGFIAGCSAIDTDLQLQYKEWAARLANSGMGSYWGARQIMFEVWRRRVNGENCDNWF 828

Query: 836 SVYKDWEMNLMLS 848
           +VY+DWEMNLMLS
Sbjct: 829 NVYRDWEMNLMLS 841

>Scas_626.6
          Length = 839

 Score =  857 bits (2215), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 449/869 (51%), Positives = 544/869 (62%), Gaps = 54/869 (6%)

Query: 2   KVEKSDIRKPRRAKTFTGCWTCRSRKVKCDLGRPSCKRCERSGFECGGYDIKLRWSKPIK 61
           K  K+  ++PRRAKTFTGCWTCRSRKVKCDL RP C RC++SG ECGGYDIKLRWSK +K
Sbjct: 3   KSAKTQTKRPRRAKTFTGCWTCRSRKVKCDLRRPGCVRCDKSGLECGGYDIKLRWSKLVK 62

Query: 62  FDRYGVQLXXXXXXXXXXXXXXQFQRRNIAFVRXXXXXXXXXXXXXXLSALHSPPLENIA 121
           FD YGVQL              Q+QRRNI FV+              LS LH+PP E IA
Sbjct: 63  FDPYGVQLPPSPNGNSASNEEPQYQRRNIDFVKYKEEYIFHEDMDDELSILHAPPTEKIA 122

Query: 122 GDKTWIINKFGVFRGTEXXXX-----------XXXXXXXXXXXXSYNRXXXXXXXXXXXX 170
             KTWII KFGVFRGT+                           + N+            
Sbjct: 123 DGKTWIIKKFGVFRGTDKIDKQYAPRKKRRKPAPSTVSKRKTLKTGNKLSAKESAGKPIN 182

Query: 171 XXXXXXXXXXXXXXPTD----LFDFDFSSMNFTGHEWISNELRDDALLSASAVQGIPTNT 226
                         P +      DFD +  N   +EWIS+ELRDD LLSA A+QG   N 
Sbjct: 183 IEDSPSKPMSNHQSPVNNIPSFVDFDLAMNNVPSYEWISSELRDDVLLSAFAIQGASIND 242

Query: 227 FTFPAGGNHTESSATADFNDAKNAXXXXXXXXXXXXXXXXIQGTVNGGFASIDPIAEVSQ 286
                    + +SA    N                      QGTV+ G  S  PI   + 
Sbjct: 243 VP------DSTTSAKTSIN----------------------QGTVSTGLFSNIPIDGTNS 274

Query: 287 VYRLLSHRNEDKDKDVQEQQKHDTHQTIASQEDEFPSLVPLNNLISIHAPGGESRMPESV 346
           +    +  + + D  +Q       H     Q    PS         + AP  +S MP ++
Sbjct: 275 IGDD-TQTSPNNDYTIQNALNLLFHN---KQTPTSPSTSKGMVKTLLDAPQSDSHMPRTI 330

Query: 347 LEIVPSVVPDPSIFNLQSDKNILLRLPTTGLHVHGLARFLLNYYLQNVADLMTVVALPTN 406
           +EI+     +  IF   +  N+   +P +G++VHG+ +FLLNYYL+NVADLMTVV L  N
Sbjct: 331 MEIINPSPLELEIFEALNKLNLSWNIPASGVNVHGIGKFLLNYYLENVADLMTVVPLSRN 390

Query: 407 PWKTIYFPRALKALGDLAGIGYTXXXXXXXXXXXXXXXCFNLQSKFPKNTPQMRFYLYLG 466
           PWK +YFPRAL+ALGDL G+GYT               CFNL+SKF KN+ +  ++L LG
Sbjct: 391 PWKKLYFPRALQALGDLVGLGYTTNSRNSLLNALLAVSCFNLKSKFEKNSKEYNYFLNLG 450

Query: 467 IEFRSQASNFLKKCLNSSAHQERYKDILTAILSMNSIDVVWGTMADCQYHLTICEDFVEE 526
           IE R QASNFL  CLNS+   E+YKD+LTAILSMNSIDVVWGTM DCQ HLTICEDFVE+
Sbjct: 451 IELRKQASNFLNICLNSTVTVEKYKDVLTAILSMNSIDVVWGTMEDCQRHLTICEDFVEK 510

Query: 527 RMKTRPKISEKAKALHRIFSFLKLIQDSTALDKVREGEIVIKDDEDVTGEQLQESQTGQD 586
           RM +RP IS KA+ LHRIFSFLKLIQDSTALDKVR+ EIVI   +D   +        +D
Sbjct: 511 RMNSRPHISGKARTLHRIFSFLKLIQDSTALDKVRDKEIVIYGKKDKPDKNKVADPFVKD 570

Query: 587 LNIADGEFKESLNQKDGKIRIEFVKQPQS------SSSGSTPIFTNITSETYYYP-KMST 639
            +   G+F+ESLN+ +GKI+IE+++   S      S+S S P+F NI SE+YY P + S 
Sbjct: 571 TSNNGGQFRESLNKLNGKIQIEYIRNDDSNDNNEQSASSSPPMFANIASESYYKPGQKSE 630

Query: 640 TTQDILSTDALYGLPNSLILCFSDCVRLVRHREYYKMNKLPAPRKYAKLCTEFEKRLLNW 699
           +  DILSTDALYGLPNSLIL FSDCVR+VRH EYY +  L  PR++ ++C  FEKRLL W
Sbjct: 631 SDYDILSTDALYGLPNSLILLFSDCVRIVRHNEYYNIKYLAVPREFTEICLNFEKRLLKW 690

Query: 700 KSEWDFYKPHTREFVNDTIEGVYHHTMSFYYSLIIYYFTMARDLNNQLLQSYVEKVLSHL 759
           K EW FYK +T EF++DTIEGVYHHTMSFYY L+IYYF+MA+ LNNQ LQSYVEKVL HL
Sbjct: 691 KPEWAFYKENTDEFIDDTIEGVYHHTMSFYYGLVIYYFSMAKHLNNQFLQSYVEKVLLHL 750

Query: 760 NQLSDLIDHKNVKVVPLIWQGFIAGCSSVDSNLQLSFKKWAAKLASSGMGSYWGARQIMF 819
           N+L+DLIDHK+VK+VPL+WQGFIAGCSS   +LQ  F+KWAAKLA SGMGSYWGARQ+MF
Sbjct: 751 NKLTDLIDHKSVKIVPLMWQGFIAGCSSNMQDLQQEFRKWAAKLAESGMGSYWGARQVMF 810

Query: 820 EVWRRRMNGEENDNWCSVYKDWEMNLMLS 848
           EVWRRRMN E NDNW SVYKDW+MNLMLS
Sbjct: 811 EVWRRRMNDEPNDNWYSVYKDWQMNLMLS 839

>KLLA0D10197g complement(861726..864296) similar to sp|P05085
           Saccharomyces cerevisiae YML099c ARG81 transcription
           factor involved in arginine metabolism singleton, start
           by similarity
          Length = 856

 Score =  797 bits (2059), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 409/679 (60%), Positives = 488/679 (71%), Gaps = 43/679 (6%)

Query: 188 LFDFDFSSMNFTGHEWISNELRDDALLSASAVQG--IPTNTFTFPAGGNHTESSATADFN 245
           LF+FD +S+ F G+EWISNELRDDALLSASAVQG  IP          +  ++  T D  
Sbjct: 203 LFEFDMNSLLFPGNEWISNELRDDALLSASAVQGETIPFMGIRQNNTPDTPQTPLTVDNM 262

Query: 246 DAKNAXXXXXXXXXXXXXXXXIQGTVNGGFAS-IDPIAEVSQVYRLLSHRNEDKDKDVQE 304
             KN                 + G  N G  S  D   E+++VYRLL HR    D   Q 
Sbjct: 263 GKKNGS---------------VNGNCNDGRTSGNDNEDELARVYRLLFHRRGSSD---QP 304

Query: 305 QQKHDTHQTIASQEDEFPSLVPLNNLISIHAPGGESRMPESVLEIVPSVVPDPSIFNLQS 364
                T +T +    E   +VPL N + ++ PG  S MP S +E++ S VPDPSIFN   
Sbjct: 305 PPPTITSETKSGHAKETIGIVPLRNFVELNVPG--STMPRSAIEVIHSQVPDPSIFNRPG 362

Query: 365 DKNILLRLPTTGLHVHGLARFLLNYYLQNVADLMTVVALPTNPWKTIYFPRALKALGDLA 424
           + N LL +PTTG+HVHGLARFLLNYYLQNVADLMTVV LPTN WKTIYFPRALKALGDL 
Sbjct: 363 NTNPLLDIPTTGVHVHGLARFLLNYYLQNVADLMTVVVLPTNSWKTIYFPRALKALGDLT 422

Query: 425 GIGYTXXXXXXXXXXXXXXXCFNLQSKFPKNTPQMRFYLYLGIEFRSQASNFLKKCLNSS 484
           GIGYT               CFNLQSKFPKN+P+M+F+L LGIEFR+QAS+FLK+CL+++
Sbjct: 423 GIGYTSNSRNSLLNALLAVSCFNLQSKFPKNSPEMKFFLTLGIEFRTQASSFLKRCLSNT 482

Query: 485 AHQERYKDILTAILSMNSIDVVWGTMADCQYHLTICEDFVEERMKTRPKISEKAKALHRI 544
            +QERYKDILTAILSMNSIDVVWGTMADCQ HL ICEDFVE RMKTRPKIS KAKALHRI
Sbjct: 483 VNQERYKDILTAILSMNSIDVVWGTMADCQVHLAICEDFVENRMKTRPKISAKAKALHRI 542

Query: 545 FSFLKLIQDSTALDKVREGEIVIKDDEDVTGEQLQESQTGQDLNIADGEFKESLNQKDGK 604
           FSFLKLIQDST+LDKVR  EIVI D+         +S     +++++GEFKESLN++DGK
Sbjct: 543 FSFLKLIQDSTSLDKVRTKEIVILDNNSSI-----DSHISSGISLSNGEFKESLNREDGK 597

Query: 605 IRIEFV--------------KQPQSSSSGSTPIFTNITSETYYYPKMSTTTQDILSTDAL 650
           I IEF               K    SS  +TPIF+NI SE+YYYPK + T  +ILSTDAL
Sbjct: 598 IVIEFFSSPSSGKPSPVAFPKGSHDSSGVTTPIFSNIASESYYYPKSNDTDNNILSTDAL 657

Query: 651 YGLPNSLILCFSDCVRLVRHREYYKMNKLPAPRKYAKLCTEFEKRLLNWKSEWDFYKPHT 710
           YGLPNSLIL FSDCVRL RH EYY+ + +  P+ + KLCTEFE+R+L+WKSEWDF  P +
Sbjct: 658 YGLPNSLILLFSDCVRLARHLEYYRQHNIVTPKAFKKLCTEFEQRILSWKSEWDFKVPGS 717

Query: 711 RE-FVNDTIEGVYHHTMSFYYSLIIYYFTMARDLNNQLLQSYVEKVLSHLNQLSDLIDHK 769
            + FVNDTIEGVYHHTMSFY  LIIYYFT+ + L  + ++ +V+ VL+ L QL++LI++K
Sbjct: 718 PDHFVNDTIEGVYHHTMSFYNGLIIYYFTVVKGLTYKYVKHHVQNVLNSLIQLTELIENK 777

Query: 770 NVKVVPLIWQGFIAGCSSVDSNLQLSFKKWAAKLASSGMGSYWGARQIMFEVWRRRMNGE 829
            VK+VPLIWQGF+AGC+ +DSNLQL FK+WAAKL  SGMGSYWGARQIMFEVWRRR+NGE
Sbjct: 778 GVKIVPLIWQGFMAGCACIDSNLQLEFKEWAAKLCKSGMGSYWGARQIMFEVWRRRLNGE 837

Query: 830 ENDNWCSVYKDWEMNLMLS 848
           +ND+W SVYKDWEMNLMLS
Sbjct: 838 QNDDWFSVYKDWEMNLMLS 856

 Score =  152 bits (383), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 71/126 (56%), Positives = 82/126 (65%), Gaps = 2/126 (1%)

Query: 13  RAKTFTGCWTCRSRKVKCDLGRPSCKRCERSGFECGGYDIKLRWSKPIKFDRYGVQLXXX 72
           R KTFTGCWTCRSRKVKCDL RP C+RCE+ G  CGGYD+KLRW++PI+FD  G      
Sbjct: 7   RVKTFTGCWTCRSRKVKCDLRRPGCERCEKGGLICGGYDVKLRWTRPIQFDTMGN--VTA 64

Query: 73  XXXXXXXXXXXQFQRRNIAFVRXXXXXXXXXXXXXXLSALHSPPLENIAGDKTWIINKFG 132
                      Q+QRRN+ FVR              LSAL SPPLE I+ DKTWII KFG
Sbjct: 65  TPTGIKDPDEPQYQRRNVDFVRYKEEYVYYEDMDDELSALSSPPLELISEDKTWIIKKFG 124

Query: 133 VFRGTE 138
           VF+GT+
Sbjct: 125 VFKGTD 130

>AAL175W [12] [Homologous to ScYML099C (ARG81) - NSH]
           complement(32874..35525) [2652 bp, 883 aa]
          Length = 883

 Score =  683 bits (1763), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 347/671 (51%), Positives = 452/671 (67%), Gaps = 36/671 (5%)

Query: 186 TDLFDFDFSSMNFTGHEWISNELRDDALLSASAVQGIPTNTFTFPAGGNHTESSATADFN 245
           T LFDFDFS+      EW++ EL+DD  LS++ ++    NT +FP G       + A   
Sbjct: 241 TPLFDFDFSTPGLVSSEWMAGELKDDTTLSSAMLR----NTLSFPTG------LSVAQHG 290

Query: 246 DAKNAXXXXXXXXXXXXXXXXIQGTVNGGFA--SIDPIAEVSQVYRLL-SHRNEDKDKDV 302
           D   A                +     G     S+D   EVS+VYRLL +++  D +   
Sbjct: 291 DGITADTAPPKSQSSIFPEQTLPLQSAGTMVPPSVD---EVSKVYRLLLNNQGTDCNSST 347

Query: 303 QEQQKHDTHQTIASQEDEFPSLVPLNNLISIHAPGGESRMPESVLEIVPSVVPDPSIFNL 362
             +     H          P  V   + ++IH P  ESRMP S +E VPS+VPDP+IF L
Sbjct: 348 GYKGLSGVHT---------PYTV---DNVAIHGP--ESRMPASAIESVPSIVPDPTIFTL 393

Query: 363 QSDKNILLRLPTTGLHVHGLARFLLNYYLQNVADLMTVVALPTNPWKTIYFPRALKALGD 422
               N L+RLP  G+ +HGL RFLL+YY QNVADLM+VVALP NPWKTIYFPRA+KALG+
Sbjct: 394 AEHTNSLIRLPRMGMQIHGLTRFLLSYYQQNVADLMSVVALPKNPWKTIYFPRAVKALGE 453

Query: 423 LAGIGYTXXXXXXXXXXXXXXXCFNLQSKFPKNTPQMRFYLYLGIEFRSQASNFLKKCLN 482
           L  +GYT               CF+LQSKFPKN+ +M++++ LG++FR+QAS FL  CL+
Sbjct: 454 LGALGYTSHSRNALLNALLAVSCFHLQSKFPKNSKEMKYFVSLGMDFRNQASGFLNACLS 513

Query: 483 SSAHQERYKDILTAILSMNSIDVVWGTMADCQYHLTICEDFVEERMKTRPKISEKAKALH 542
           S++ QE YKD+LTAILSMNSIDVVWGTM+DCQYHLTICE+F+E RMK+RP +SEKA+ LH
Sbjct: 514 STSRQEHYKDVLTAILSMNSIDVVWGTMSDCQYHLTICEEFIESRMKSRPLLSEKARCLH 573

Query: 543 RIFSFLKLIQDSTALDKVREGEIVIKD--DEDVTGEQLQESQTGQDLNIADGEFKESLNQ 600
           RIFSFLKLIQDSTALDKV+E EI++KD  D++             D +   G + E LN+
Sbjct: 574 RIFSFLKLIQDSTALDKVQEKEIIMKDAGDKEFQKNGSSTPPLSTDSSSFTGRYVEQLNK 633

Query: 601 KDGKIRIEFVKQPQS--SSSGSTPIFTNITSETYYYPKMSTTTQDILSTDALYGLPNSLI 658
            +G++ IEF+++      + GS P+F  I +++Y + +++ T  D LS D LYGLPNSLI
Sbjct: 634 DNGRVCIEFIEKDGQYFDTRGSVPLFNTIVTKSYPH-EINETRIDTLSMDVLYGLPNSLI 692

Query: 659 LCFSDCVRLVRHREYYKMNKLPAPRKYAKLCTEFEKRLLNWKSEWDFYKPHTR-EFVNDT 717
           L FSDCV LVRHR Y+K +    P  +   C + E+RLL+WK EW F+K  ++ EF+NDT
Sbjct: 693 LLFSDCVSLVRHRFYFKRHNTAQPTSFGLFCVKIEQRLLSWKPEWIFWKDDSKAEFINDT 752

Query: 718 IEGVYHHTMSFYYSLIIYYFTMARDLNNQLLQSYVEKVLSHLNQLSDLIDHKNVKVVPLI 777
           +EGVYHHTMSFYY L+IYYFTMAR L +  LQ+YV+KVLSHL +L ++I+HK+VK+VPL+
Sbjct: 753 VEGVYHHTMSFYYGLLIYYFTMARSLEDHTLQNYVQKVLSHLRELGNIIEHKDVKIVPLM 812

Query: 778 WQGFIAGCSSVDSNLQLSFKKWAAKLASSGMGSYWGARQIMFEVWRRRMNGEENDNWCSV 837
           WQGF+AGCS  DS++QL FKKW A+L + G+GSYWGARQIM EVWRRRM   + DNW SV
Sbjct: 813 WQGFMAGCSCTDSSMQLEFKKWTAQLVNFGIGSYWGARQIMLEVWRRRMTDGKCDNWYSV 872

Query: 838 YKDWEMNLMLS 848
           Y DWEMNLML+
Sbjct: 873 YCDWEMNLMLA 883

 Score =  173 bits (438), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 79/131 (60%), Positives = 92/131 (70%), Gaps = 1/131 (0%)

Query: 8   IRKPRRAKTFTGCWTCRSRKVKCDLGRPSCKRCERSGFECGGYDIKLRWSKPIKFDRYGV 67
           +R+PR AKTFTGCWTCR RKVKCDLG+PSC+RCE+SG +CGGYDIKLRWS PI+FD++G 
Sbjct: 33  VRRPR-AKTFTGCWTCRLRKVKCDLGKPSCQRCEKSGLDCGGYDIKLRWSNPIRFDKFGN 91

Query: 68  QLXXXXXXXXXXXXXXQFQRRNIAFVRXXXXXXXXXXXXXXLSALHSPPLENIAGDKTWI 127
           Q+               FQRRNI FVR              LSALHSPPLE IA  KTWI
Sbjct: 92  QMAGEDRDGDGEQPAQPFQRRNIMFVRYDEEYEYYEDMDDELSALHSPPLEMIADHKTWI 151

Query: 128 INKFGVFRGTE 138
           I +FGVF+GT+
Sbjct: 152 IKRFGVFKGTD 162

>YML099C (ARG81) [3872] chr13 complement(74398..77040) Component of
           the ARGR regulatory complex, contains a Zn[2]-Cys[6]
           fungal-type binuclear cluster domain [2643 bp, 880 aa]
          Length = 880

 Score =  663 bits (1711), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 361/696 (51%), Positives = 456/696 (65%), Gaps = 58/696 (8%)

Query: 185 PT-DLFDFDFSSMNFTGHEWISNELRDDALLSASAVQGIPTNTFTFPAGGNHTESSATAD 243
           PT +L D+D++++N TG+EWIS+ELRDDALLSA  +QG      T P   +  E+S    
Sbjct: 211 PTPNLLDYDWNNLNITGYEWISSELRDDALLSAVTLQGHHLG-HTQPQEISLEENSNVVS 269

Query: 244 FNDAKNAXXXXXXXXXXXXXXXXIQGTVNGGFASIDPIAEVSQVYRLLSHRNEDKDKDVQ 303
             +  NA                +    N   ++ D + +  Q  +LL  +N    ++  
Sbjct: 270 GEEHVNAKEHGCAFEADNQGSSTLP---NKAASANDKLYQ--QNLKLLFQKNSSNSEEPD 324

Query: 304 EQQKHDTHQTIASQEDEFPSLVPLN------NLISIHAPGGESRMPESVLEIVP--SVVP 355
            Q         A  +D F ++ P +      N I++  P  ESRMP+S+LE+    S +P
Sbjct: 325 PQ---------ALIDDVFVNIEPRSLPASDLNKITLAPPNEESRMPKSMLELTSYSSDLP 375

Query: 356 DPSIFNLQSDKNILLRLPTTGLHVHGLARFLLNYYLQNVADLMTVVALPTNPWKTIYFPR 415
            P + ++         +P T L VHGLARFLLN+Y  NVAD MTVV L  NPWKT+YFPR
Sbjct: 376 -PELVDI---------IPKTDLTVHGLARFLLNHYFNNVADKMTVVVLEKNPWKTLYFPR 425

Query: 416 ALKALGDLAGIGYTXXXXXXXXXXXXXXXCFNLQSKFPKNTPQMRFYLYLGIEFRSQASN 475
           AL ALGDLAG+G +               CF+LQSK+P+N    +++L LGIE R+QASN
Sbjct: 426 ALMALGDLAGLGQSSNSRNALLNALLAVSCFHLQSKYPRNYKLQKYFLGLGIELRNQASN 485

Query: 476 FLKKCLNS-SAHQERYKDILTAILSMNSIDVVWGTMADCQYHLTICEDFVEERMKTRPKI 534
           FL+ CLN+ S+  E+YKD+LTAILSMNSIDVVWGTMADCQ HL +CEDFVE RMK RP I
Sbjct: 486 FLRLCLNTKSSIPEKYKDVLTAILSMNSIDVVWGTMADCQDHLALCEDFVESRMKLRPNI 545

Query: 535 SEKAKALHRIFSFLKLIQDSTALDKVREGEIVI----KDDE----DVTGEQLQESQTGQD 586
           SEK K LHRIFSFLKLIQDSTALDKVR  EIVI    +DD     D +      S+   D
Sbjct: 546 SEKTKTLHRIFSFLKLIQDSTALDKVRAKEIVILPSEEDDNYKPLDTSNATTSSSEPRVD 605

Query: 587 LNIADGEFKESLNQKDGKIRIEFVKQP-------QSSSSGSTPIFTNITSETYYYPK--- 636
           + + +G F+E+LN+ DGKI IEFVK+P        + SS + PIFTNI +E+YY      
Sbjct: 606 V-VQEGLFREALNENDGKIHIEFVKEPITNVSADSTPSSTTPPIFTNIATESYYNKSDIS 664

Query: 637 --MSTTTQDILSTDALYGLPNSLILCFSDCVRLVRHREYYKMNKLPAPRKYAKLCTEFEK 694
             +S T ++I+ TD+LYGLPNSLIL FSDCVR+VRH EYY +  LP PRK+ +L   FEK
Sbjct: 665 KLVSKTDENIIGTDSLYGLPNSLILLFSDCVRIVRHNEYYNLTYLPVPRKFNELSLNFEK 724

Query: 695 RLLNWKSEWDFYKPHT--REFVNDTIEGVYHHTMSFYYSLIIYYFTMARDLNNQLLQSYV 752
           RLL WKSEW+F++ ++  + F+N T E +YHHTMSFY+SLIIYYFTMAR LN Q LQ+YV
Sbjct: 725 RLLKWKSEWNFHQENSEGKSFINSTAEALYHHTMSFYFSLIIYYFTMARSLNCQFLQNYV 784

Query: 753 EKVLSHLNQLSDLIDHKNVKVVPLIWQGFIAGCSSVDSNLQLSFKKWAAKLASSGMGSYW 812
            KVL HLN + +L+D K VK+VPLIWQGF+AGC+  D N Q  F++WAAKLA SG+GSYW
Sbjct: 785 AKVLDHLNAMEELVDQKKVKIVPLIWQGFMAGCACTDENRQQEFRRWAAKLAESGVGSYW 844

Query: 813 GARQIMFEVWRRRMNGEENDNWCSVYKDWEMNLMLS 848
           GARQ+M EVWRRR   E  DNW SVYKDWEMNLMLS
Sbjct: 845 GARQVMLEVWRRRKEDEPGDNWYSVYKDWEMNLMLS 880

 Score =  157 bits (398), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 73/138 (52%), Positives = 88/138 (63%), Gaps = 4/138 (2%)

Query: 5   KSDIRKPRRAKTFTGCWTCRSRKVKCDLGRPSCKRCERSGFECGGYDIKLRWSKPIKFDR 64
           K+  +K  RAKTFTGCWTCR RKVKCDL  P C+RCE+S   CGGYDIKLRWSKP++FD 
Sbjct: 6   KNGPKKMGRAKTFTGCWTCRGRKVKCDLRHPHCQRCEKSNLPCGGYDIKLRWSKPMQFDP 65

Query: 65  YGVQLXXXXXXXXXXXXXX----QFQRRNIAFVRXXXXXXXXXXXXXXLSALHSPPLENI 120
           YGV +                  Q+QRRNI FVR              L+ LH+PP+E I
Sbjct: 66  YGVPIPQNSPATTTNLSGSVDEPQYQRRNIDFVRYDEEYVYHEDMDDELTMLHTPPIEKI 125

Query: 121 AGDKTWIINKFGVFRGTE 138
           + +KTWII KFGVF+GT+
Sbjct: 126 SDNKTWIIKKFGVFKGTD 143

>CAGL0H06875g complement(682518..684626) some similarities with
           sp|05085 Saccharomyces cerevisiae YML099c ARG81,
           hypothetical start
          Length = 702

 Score =  327 bits (839), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 196/497 (39%), Positives = 267/497 (53%), Gaps = 70/497 (14%)

Query: 379 VHGLARFLLNYYLQNVADLMTVVALPT---NPWKTIYFPRALKALGDLAGIGYTXXXXXX 435
           VH   RFLL +YL+ V DLMT+  +P    NPW  IYFPRA+ ALG+L     +      
Sbjct: 249 VHNNVRFLLTHYLEKVPDLMTIAPIPNKNKNPWAKIYFPRAIAALGELIAFPNSQNYARI 308

Query: 436 XXXX-XXXXXCFNLQSKFPKNTPQMRFYLYLGIEFRSQASNFLKKCLN------------ 482
                     CFNL+     +     FYL L +E R++AS+FL   L             
Sbjct: 309 SLLNGCLSVSCFNLKDLLKYDPVSTDFYLNLAVELRTRASHFLNLALEQEEEYEEYRDIL 368

Query: 483 -----SSAHQERYKDILTAILSMNSIDVVWGTMADCQYHLTICEDFVEERMKTRPKISEK 537
                +  + + + D+L AIL+MNSID+VWGTM DC  +L ICE  + +  K R  +S+K
Sbjct: 369 EDDDIAEDYNKHFCDMLIAILTMNSIDIVWGTMVDCDNYLRICEQLISKN-KKRVVVSKK 427

Query: 538 AKALHRIFSFLKLIQDSTALDKVREGEIVIKDDEDVTGEQLQESQTGQDLNIADGEFKES 597
            K+L+ I++FLKL+Q+STA+             E +T E    S    + +I   ++   
Sbjct: 428 IKSLYTIYAFLKLMQNSTAM-------------ETITSEP---SLDFHNPDIIPYKYLRE 471

Query: 598 LNQKDGKIRIEFVKQPQSSSSGSTPIFTNITSETYYYPKMSTTTQDILSTDALYGLPNSL 657
             + D K                  IFT+    T    KM+T     L  DAL  LPNSL
Sbjct: 472 TYENDIKT-----------------IFTDHYGST----KMNT-----LGADALNALPNSL 505

Query: 658 ILCFSDCVRLVRHREYYKMNK--LPAPRKYAKLCTEFEKRLLNWKSEWDFYKPHTREFVN 715
           +L F DCV L R+  Y+K     +  P ++     EFE +L NWKSEWDF+    R F++
Sbjct: 506 VLLFYDCVSLTRYYFYHKKKSEGIELPTEFFMKTREFEDKLSNWKSEWDFFDSTGRNFLS 565

Query: 716 DTIEGVYHHTMSFYYSLIIYYFTMARDLNNQLLQSYVEKVLSHLNQLSDLID----HKNV 771
            TIEG+YHHTMSFYY L +YY+   ++ + + L   V KV+ HL Q+  L D     + +
Sbjct: 566 PTIEGIYHHTMSFYYGLCVYYYNFIKNQDYESLNVEVWKVIYHLQQIEFLKDSSAGKEGI 625

Query: 772 KVVPLIWQGFIAGCSSVDSNLQLSFKKWAAKLASSGMGSYWGARQIMFEVWRRRMNGEEN 831
           K++PLIWQGFIAGC   D  +Q  FK W   ++ +G GSY GA QIMFEVWRRR N E  
Sbjct: 626 KLIPLIWQGFIAGCLCSDPEVQSEFKTWFDTVSLTGAGSYRGAIQIMFEVWRRRDNNELG 685

Query: 832 DNWCSVYKDWEMNLMLS 848
           D+W SV +DWEMN+ML+
Sbjct: 686 DDWLSVSRDWEMNIMLT 702

 Score =  129 bits (323), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 65/135 (48%), Positives = 77/135 (57%), Gaps = 3/135 (2%)

Query: 7   DIRKPRRAKTFTGCWTCRSRKVKCDLGRPSCKRCERSGFECGGYDIKLRWSKPIKFDRYG 66
           D +  R  KT++GCWTCR+RKVKCDL RPSC RC RS  +CGGY IKLRWS  + FD YG
Sbjct: 2   DKKSTRSVKTYSGCWTCRARKVKCDLVRPSCLRCRRSKVQCGGYKIKLRWSPLLHFDLYG 61

Query: 67  VQLXXXXXXXXXXXXXXQFQ---RRNIAFVRXXXXXXXXXXXXXXLSALHSPPLENIAGD 123
           V +              +     RRN+  VR              LS LH+PP + IA +
Sbjct: 62  VPMPSNESITTTEGDDVETSTNLRRNVERVRYEEEYEYHEDMDEELSELHAPPEDKIANN 121

Query: 124 KTWIINKFGVFRGTE 138
           KTWII KFGVFR  E
Sbjct: 122 KTWIIKKFGVFRAIE 136

>YBR240C (THI2) [419] chr2 complement(700447..701799) Zinc-finger
          regulatory protein for thiamine pyrophosphokinase
          (THI80) expression [1353 bp, 450 aa]
          Length = 450

 Score = 60.5 bits (145), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 32/55 (58%), Gaps = 1/55 (1%)

Query: 2  KVEKSDIRKPRRAKTFTGCWTCRSRKVKCDLGRPSCKRCERSGFECGGYDIKLRW 56
          KV  S    P + +TFTGCW CR +K +CD  RP C  C + G  C  YDI+L W
Sbjct: 12 KVASSSKVPPTKGRTFTGCWACRFKKRRCDENRPICSLCAKHGDNC-SYDIRLMW 65

>Scas_597.4
          Length = 475

 Score = 58.9 bits (141), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 31/47 (65%), Gaps = 1/47 (2%)

Query: 10 KPRRAKTFTGCWTCRSRKVKCDLGRPSCKRCERSGFECGGYDIKLRW 56
          K  +A+TFTGCW CR +K +CD  +P+C  C R G  C  YDI+L W
Sbjct: 14 KLNKARTFTGCWACRLKKRRCDELKPTCSLCVRHGDTC-SYDIRLMW 59

>Kwal_14.1631
          Length = 443

 Score = 55.5 bits (132), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 21/44 (47%), Positives = 30/44 (68%), Gaps = 1/44 (2%)

Query: 13 RAKTFTGCWTCRSRKVKCDLGRPSCKRCERSGFECGGYDIKLRW 56
          +A++FTGCW CR +K +CD  +P C  C + G +C  YDI+L W
Sbjct: 8  KARSFTGCWACRFKKRRCDEAKPVCSLCLKHGDQC-SYDIRLVW 50

>KLLA0F10373g 957948..958994 some similarities with sp|P38141
          Saccharomyces cerevisiae YBR240c THI2 regulator of the
          thiamine biosynthetic genes singleton, hypothetical
          start
          Length = 348

 Score = 54.7 bits (130), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 21/44 (47%), Positives = 28/44 (63%), Gaps = 1/44 (2%)

Query: 13 RAKTFTGCWTCRSRKVKCDLGRPSCKRCERSGFECGGYDIKLRW 56
          + + FTGCW CR +K KCD  +P C  C + G EC  YD++L W
Sbjct: 3  KDRNFTGCWACRFKKRKCDERKPICSLCLKHGVEC-CYDVRLSW 45

>AFL033W [3160] [Homologous to ScYBR240C (THI2) - SH]
          complement(373485..374633) [1149 bp, 382 aa]
          Length = 382

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 24/52 (46%), Positives = 32/52 (61%), Gaps = 2/52 (3%)

Query: 5  KSDIRKPRRAKTFTGCWTCRSRKVKCDLGRPSCKRCERSGFECGGYDIKLRW 56
          ++  RKPR  + FTGCW CR +K +CD G P C  C + G  C  YD++L W
Sbjct: 10 RAGARKPR-IRCFTGCWACRFKKRRCDEGVPFCALCVKHGDAC-SYDVRLVW 59

>YDR421W (ARO80) [1245] chr4 (1312028..1314880) Positive
          transcription regulator of ARO9 and ARO10, member of
          the Zn2Cys6 transcription factor family [2853 bp, 950
          aa]
          Length = 950

 Score = 50.8 bits (120), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 21/43 (48%), Positives = 27/43 (62%), Gaps = 6/43 (13%)

Query: 11 PRRAKTFTGCWTCRSRKVKCDLG------RPSCKRCERSGFEC 47
          P+R +T+  C +CRSRKVKCDLG       P C RC+R   +C
Sbjct: 16 PKRRRTYQACISCRSRKVKCDLGPVDNPHDPPCARCKRELKKC 58

>KLLA0A10329g 903873..905792 some similarities with
          ca|CA6113|IPF100.3 Candida albicans zinc finger
          protein, 3-prime end (by homology), hypothetical start
          Length = 639

 Score = 50.4 bits (119), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 22/58 (37%), Positives = 34/58 (58%), Gaps = 2/58 (3%)

Query: 8  IRKPRRAKTFTGCWTCRSRKVKCDLGRPSCKRCERSGFECGGYDIKLRW-SKPIKFDR 64
          I   + A+++ GC  C+S K KCD  +P C  C++ GF+C  Y   L+W  +P K +R
Sbjct: 5  IEMKKVARSYMGCQKCKSLKKKCDEVKPHCGYCKKRGFQC-DYSRTLKWGGRPFKDNR 61

>YDR213W (UPC2) [1051] chr4 (889744..892485) Sterol regulatory
          element binding protein involved in the regulation of
          sterol biosynthetic gene expression and the uptake and
          intracellular esterification of sterols [2742 bp, 913
          aa]
          Length = 913

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 28/51 (54%)

Query: 15 KTFTGCWTCRSRKVKCDLGRPSCKRCERSGFECGGYDIKLRWSKPIKFDRY 65
          K+  GC  C+ R+VKCD G+P+C++C     EC    I LR  +     +Y
Sbjct: 46 KSKNGCDNCKRRRVKCDEGKPACRKCTNMKLECQYTPIHLRKGRGATVVKY 96

>Scas_674.12*
          Length = 909

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 18/36 (50%), Positives = 23/36 (63%)

Query: 12 RRAKTFTGCWTCRSRKVKCDLGRPSCKRCERSGFEC 47
          R+A+    C  CRS+KVKCD  RPSC RC ++   C
Sbjct: 7  RKARPSFVCLVCRSKKVKCDKARPSCGRCRKTNKLC 42

>Kwal_26.7095
          Length = 838

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 19/44 (43%), Positives = 26/44 (59%), Gaps = 1/44 (2%)

Query: 4  EKSDIRKPRRAKTFTGCWTCRSRKVKCDLGRPSCKRCERSGFEC 47
          E  + +K R  ++F  C  C+ RK+KCD  RPSC RC +   EC
Sbjct: 15 EPPEFKKSRMRQSFV-CRNCKKRKIKCDKARPSCGRCSKLELEC 57

>Sklu_1373.2 YDR207C, Contig c1373 1069-2895
          Length = 608

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 28/53 (52%), Gaps = 6/53 (11%)

Query: 5   KSDIRKPRR-----AKTFTGCWTCRSRKVKCDLGRPSCKRCERSGFECGGYDI 52
           K    +PRR     +++ TGCW CR RK KC   +P C  C R   EC  YDI
Sbjct: 521 KEQTERPRRKNTTGSRSRTGCWICRLRKKKCTEEKPHCNNCTRLNLEC-FYDI 572

>YLR228C (ECM22) [3628] chr12 complement(600021..602465) Sterol
          regulatory element binding protein involved in the
          regulation of sterol biosynthetic gene expression and
          may be involved in regulating sterol uptake [2445 bp,
          814 aa]
          Length = 814

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 23/58 (39%), Positives = 32/58 (55%), Gaps = 1/58 (1%)

Query: 2  KVEKSDIRKPR-RAKTFTGCWTCRSRKVKCDLGRPSCKRCERSGFECGGYDIKLRWSK 58
          KV K+   K +   K+ TGC  C+ R+VKCD G+P CK+C     +C    I+ R  K
Sbjct: 25 KVSKTSTGKRKFHNKSKTGCDNCKRRRVKCDEGKPFCKKCTNMKLDCVYSPIQPRRRK 82

>YMR280C (CAT8) [4234] chr13 complement(827027..831328)
           Transcription factor required for derepression of
           gluconeogenic enzymes, contains an N-terminal
           Zn[2]-Cys[6] fungal-type binuclear cluster domain [4302
           bp, 1433 aa]
          Length = 1433

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 19/41 (46%), Positives = 23/41 (56%)

Query: 19  GCWTCRSRKVKCDLGRPSCKRCERSGFECGGYDIKLRWSKP 59
            C  CRS+K +CD  RP C +C   GFEC   D  LR + P
Sbjct: 69  ACDRCRSKKTRCDGKRPQCSQCAAVGFECRISDKLLRKAYP 109

>CAGL0C01199g complement(121944..124712) similar to tr|Q12151
          Saccharomyces cerevisiae YDR213w UPC2, hypothetical
          start
          Length = 922

 Score = 47.4 bits (111), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 27/47 (57%), Gaps = 1/47 (2%)

Query: 2  KVEKSDIRKPR-RAKTFTGCWTCRSRKVKCDLGRPSCKRCERSGFEC 47
          +V K+   K +   K+ TGC  C+ R+VKCD G+P CK+C      C
Sbjct: 29 RVSKTSTGKRKFHKKSKTGCDNCKRRRVKCDEGKPGCKKCSNLNLVC 75

>KLLA0F20680g 1924148..1926511 weakly similar to sp|P39001
           Saccharomyces cerevisiae YDR207c UME6 negative
           transcriptional regulator singleton, hypothetical start
          Length = 787

 Score = 47.4 bits (111), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 25/53 (47%), Positives = 30/53 (56%), Gaps = 4/53 (7%)

Query: 3   VEKSDIRKPRRA---KTFTGCWTCRSRKVKCDLGRPSCKRCERSGFECGGYDI 52
           V+ SD  K R A   ++ TGCW CR RK KC   +P C+ C R   EC  YDI
Sbjct: 699 VKSSDQIKKRNATGARSRTGCWICRLRKKKCTEEKPQCQNCVRLHLEC-FYDI 750

>Kwal_56.24566
          Length = 755

 Score = 47.0 bits (110), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 24/38 (63%)

Query: 10 KPRRAKTFTGCWTCRSRKVKCDLGRPSCKRCERSGFEC 47
          +P+R ++  GC+TCR R+ KCD  RP C  C +   +C
Sbjct: 22 RPKRNRSRAGCFTCRLRRKKCDEARPKCGTCSKHMLKC 59

>Scas_717.33
          Length = 904

 Score = 47.0 bits (110), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 19/39 (48%), Positives = 23/39 (58%), Gaps = 6/39 (15%)

Query: 15 KTFTGCWTCRSRKVKCDLG------RPSCKRCERSGFEC 47
          ++F  C +CR RKVKCDLG      +P C RC R G  C
Sbjct: 29 RSFRACISCRMRKVKCDLGPLENPHKPPCVRCRREGKTC 67

>KLLA0F22990g 2134385..2138146 similar to sp|P12351 Saccharomyces
          cerevisiae YLR256w HAP1 transcription factor singleton,
          hypothetical start
          Length = 1253

 Score = 46.6 bits (109), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 17/36 (47%), Positives = 24/36 (66%)

Query: 9  RKPRRAKTFTGCWTCRSRKVKCDLGRPSCKRCERSG 44
          +K +R +    C  CR RKVKCD GRP C++C ++G
Sbjct: 14 QKRKRNRVPLSCTICRKRKVKCDKGRPQCQQCVKTG 49

>Sklu_2434.10 YAL051W, Contig c2434 22765-25716
          Length = 983

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 29/52 (55%), Gaps = 1/52 (1%)

Query: 2  KVEKSDIRKPRRAKTFTGCWTCRSRKVKCDLGRPSCKRCERSGFECGGYDIK 53
          K E+ +    +R +    C  CR  K KCD  +PSC RC ++G EC  YDI+
Sbjct: 10 KQEEQNSHSSKRNRISFVCKACRKSKTKCDREKPSCTRCIKNGIEC-VYDIE 60

>Kwal_23.3178
          Length = 611

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 20/43 (46%), Positives = 25/43 (58%), Gaps = 5/43 (11%)

Query: 10  KPRR-----AKTFTGCWTCRSRKVKCDLGRPSCKRCERSGFEC 47
           KPRR     +++ TGCW CR RK KC   +PSC  C R   +C
Sbjct: 530 KPRRKNNSGSRSRTGCWICRLRKKKCTEEKPSCHNCLRLNLQC 572

>AGL099C [4213] [Homologous to ScYDR207C (UME6) - SH]
           (516587..518830) [2244 bp, 747 aa]
          Length = 747

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 20/38 (52%), Positives = 22/38 (57%), Gaps = 1/38 (2%)

Query: 15  KTFTGCWTCRSRKVKCDLGRPSCKRCERSGFECGGYDI 52
           ++ TGCW CR RK KC   RP C  C R   EC  YDI
Sbjct: 675 RSRTGCWICRLRKKKCSEERPQCSNCLRLNLEC-VYDI 711

>CAGL0F05357g 541830..543635 some similarities with sp|P39001
           Saccharomyces cerevisiae YDR207c UME6, hypothetical
           start
          Length = 601

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 21/47 (44%), Positives = 29/47 (61%), Gaps = 1/47 (2%)

Query: 2   KVEKSDIRKPRRA-KTFTGCWTCRSRKVKCDLGRPSCKRCERSGFEC 47
           KV+K   RK + A ++ TGCW CR RK KC   +P+C  C+R   +C
Sbjct: 511 KVKKEGERKRKPATRSRTGCWICRLRKKKCSEEKPACFNCQRLNLDC 557

>CAGL0J07150g complement(686734..689802) similar to sp|P39720
          Saccharomyces cerevisiae YAL051w OAF1 peroxisome
          proliferating transcription factor or sp|P52960
          Saccharomyces cerevisiae YOR363c PIP2, hypothetical
          start
          Length = 1022

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 21/49 (42%), Positives = 27/49 (55%), Gaps = 2/49 (4%)

Query: 4  EKSDIRKPRRAKTFTGCWTCRSRKVKCDLGRPSCKRCERSGFECGGYDI 52
          + SDI K R   +F  C  CR  K KCD  +P+C RC + G  C  YD+
Sbjct: 8  DSSDISKKRNRLSFV-CQGCRKAKTKCDKEKPACSRCLKHGIRC-VYDL 54

>Scas_696.44
          Length = 1164

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 19/41 (46%), Positives = 22/41 (53%)

Query: 19  GCWTCRSRKVKCDLGRPSCKRCERSGFECGGYDIKLRWSKP 59
            C  CRS+K +CD  RP C +C   GFEC   D   R S P
Sbjct: 80  ACDRCRSKKTRCDGKRPQCSQCAIVGFECKISDKLQRKSFP 120

>KLLA0C17050g 1490472..1493339 some similarities with
          ca|CA3454|IPF10533.exon1 Candida albicans unknown
          function, exon 1, hypothetical start
          Length = 955

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 14/36 (38%), Positives = 22/36 (61%)

Query: 12 RRAKTFTGCWTCRSRKVKCDLGRPSCKRCERSGFEC 47
          +R +    C  C  RK+KCD  +P C+ C ++G+EC
Sbjct: 38 KRQRQILSCVACHKRKIKCDRAKPVCESCGKNGWEC 73

>Scas_663.12
          Length = 944

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 26/50 (52%), Gaps = 1/50 (2%)

Query: 3  VEKSDIRKPRRAKTFTGCWTCRSRKVKCDLGRPSCKRCERSGFECGGYDI 52
          +  S + K +R +    C  CR  KVKCD  +P C RC +   EC  YD+
Sbjct: 23 INDSQVTKKKRYRLSFVCQGCRRSKVKCDQEKPVCSRCSKHDLEC-VYDV 71

>Kwal_55.20722
          Length = 827

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 24/42 (57%)

Query: 7  DIRKPRRAKTFTGCWTCRSRKVKCDLGRPSCKRCERSGFECG 48
          D + PR  +    C  CR+RK+KCD  RP C RC+++   C 
Sbjct: 2  DRKSPRVNRPRLVCLECRNRKLKCDKARPKCTRCKQNLLTCS 43

>KLLA0E19701g complement(1739869..1741914) some similarities with
          sp|P26370 Saccharomyces cerevisiae YDL170w UGA3
          transcriptional activator for GABA catabolic genes
          singleton, hypothetical start
          Length = 681

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 25/47 (53%)

Query: 1  MKVEKSDIRKPRRAKTFTGCWTCRSRKVKCDLGRPSCKRCERSGFEC 47
          M V+ S+    RR  +  GC TC+ RK +C   RP CK C R   +C
Sbjct: 1  MAVDLSEGEPKRRRHSKKGCLTCKVRKKRCSEDRPICKDCARLSLDC 47

>YDR207C (UME6) [1046] chr4 complement(865005..867515) Global
           transcriptional regulator containing a zinc binuclear
           cluster domain involved in pathway specific repression
           or induction [2511 bp, 836 aa]
          Length = 836

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 17/33 (51%), Positives = 20/33 (60%)

Query: 15  KTFTGCWTCRSRKVKCDLGRPSCKRCERSGFEC 47
           ++ TGCW CR RK KC   RP C  CER   +C
Sbjct: 766 RSRTGCWICRLRKKKCTEERPHCFNCERLKLDC 798

>CAGL0B03421g complement(336071..340138) similar to sp|P12351
          Saccharomyces cerevisiae YLR256w HAP1 transcription
          factor, hypothetical start
          Length = 1355

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 28/52 (53%)

Query: 10 KPRRAKTFTGCWTCRSRKVKCDLGRPSCKRCERSGFECGGYDIKLRWSKPIK 61
          K +R +    C  CR RKVKCD  RP C +C ++G     + ++  W++  K
Sbjct: 13 KKKRNRIPLSCTICRKRKVKCDKTRPHCNQCTKTGVAHLCHYMEQNWAQDAK 64

>Scas_596.4
          Length = 701

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 17/41 (41%), Positives = 26/41 (63%), Gaps = 2/41 (4%)

Query: 7   DIRKPRRAKTFTGCWTCRSRKVKCDLGRPSCKRCERSGFEC 47
           + +K RR+++  GCW CR RK KC   +P+C  C+R   +C
Sbjct: 557 ETKKARRSRS--GCWICRLRKKKCTEEKPACFNCQRLNLDC 595

>Sklu_1622.2 YDR034C, Contig c1622 1522-3858
          Length = 778

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 23/36 (63%)

Query: 12  RRAKTFTGCWTCRSRKVKCDLGRPSCKRCERSGFEC 47
           +R  +  GC  C+ R++KCD G+PSC +C R   EC
Sbjct: 156 KRKYSRNGCTECKKRRMKCDEGKPSCWQCTRLNREC 191

>Kwal_26.6732
          Length = 676

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 16/37 (43%), Positives = 23/37 (62%)

Query: 11 PRRAKTFTGCWTCRSRKVKCDLGRPSCKRCERSGFEC 47
          P + ++ TGC TCR R+ KCD  +P C  CE +  +C
Sbjct: 3  PPKKRSVTGCLTCRKRRKKCDERKPVCTGCESNFLQC 39

>CAGL0F07865g complement(768270..770804) similar to tr|Q12151
          Saccharomyces cerevisiae YDR213w UPC2, start by
          similarity
          Length = 844

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 15/33 (45%), Positives = 21/33 (63%)

Query: 15 KTFTGCWTCRSRKVKCDLGRPSCKRCERSGFEC 47
          K+  GC  C+ R+VKCD G+P C +C +   EC
Sbjct: 49 KSKNGCDHCKRRRVKCDEGKPMCDKCVKMKLEC 81

>ABL121C [471] [Homologous to ScYMR280C (CAT8) - SH]
           (170784..174641) [3858 bp, 1285 aa]
          Length = 1285

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 16/37 (43%), Positives = 20/37 (54%)

Query: 11  PRRAKTFTGCWTCRSRKVKCDLGRPSCKRCERSGFEC 47
           P   +    C  CRS+K +CD  RP C +C   GFEC
Sbjct: 69  PTNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 105

>YLR256W (HAP1) [3650] chr12 (646417..650925) Transcription factor
           with heme-dependent DNA-binding activity, responsible
           for heme-dependent activation of many genes [4509 bp,
           1502 aa]
          Length = 1502

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 33/58 (56%), Gaps = 1/58 (1%)

Query: 1   MKVEKSDIRKPRRAKTFTGCWTCRSRKVKCDLGRPSCKRCERSGFECGGYDIKLRWSK 58
           M  + S I++ +R +    C  CR RKVKCD  RP C++C ++G     + ++  W++
Sbjct: 46  MSSDSSKIKR-KRNRIPLSCTICRKRKVKCDKLRPHCQQCTKTGVAHLCHYMEQTWAE 102

>KLLA0D01452g 124018..128355 gi|3228691|gb|AAC23607.1 Kluyveromyces
           lactis Cat8p, start by similarity
          Length = 1445

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 14/29 (48%), Positives = 19/29 (65%)

Query: 19  GCWTCRSRKVKCDLGRPSCKRCERSGFEC 47
            C  CR++K++CD  RP C +C   GFEC
Sbjct: 182 ACDRCRAKKIRCDGKRPQCTQCAAVGFEC 210

>ABL099W [493] [Homologous to ScYDR034C (LYS14) - SH]
           complement(212832..215234) [2403 bp, 800 aa]
          Length = 800

 Score = 44.7 bits (104), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 16/41 (39%), Positives = 25/41 (60%)

Query: 7   DIRKPRRAKTFTGCWTCRSRKVKCDLGRPSCKRCERSGFEC 47
           D ++ +R  +  GC  C+ R++KCD G+P C +C R   EC
Sbjct: 184 DPKRTKRKYSRNGCTECKRRRMKCDEGKPICWQCSRLNREC 224

>Kwal_56.23058
          Length = 775

 Score = 44.3 bits (103), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 16/42 (38%), Positives = 26/42 (61%)

Query: 6   SDIRKPRRAKTFTGCWTCRSRKVKCDLGRPSCKRCERSGFEC 47
           +D +  +R  +  GC  C+ R++KCD G+P+C +C R   EC
Sbjct: 135 ADGKTVKRKYSRNGCTECKRRRMKCDEGKPTCWQCARLNREC 176

>Kwal_23.3122
          Length = 788

 Score = 44.3 bits (103), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 27/47 (57%), Gaps = 1/47 (2%)

Query: 2  KVEKSDIRKPR-RAKTFTGCWTCRSRKVKCDLGRPSCKRCERSGFEC 47
          KV K+   K +   K+  GC  C+ R+VKCD  +PSC++C     EC
Sbjct: 31 KVSKTSTGKRKFHKKSKNGCDNCKRRRVKCDEDKPSCQKCLNMKLEC 77

>Scas_550.5*
          Length = 832

 Score = 44.3 bits (103), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 18/45 (40%), Positives = 26/45 (57%), Gaps = 3/45 (6%)

Query: 3  VEKSDIRKPRRAKTFTGCWTCRSRKVKCDLGRPSCKRCERSGFEC 47
          ++K  IR  R       C  CR++K++C+  RPSC RC+R G  C
Sbjct: 1  MQKKSIRGQRPTHV---CAACRTQKLRCNRERPSCSRCQRIGRTC 42

>AFR096W [3288] [Homologous to ScYJL089W (SIP4) - SH]
          complement(606993..609551) [2559 bp, 852 aa]
          Length = 852

 Score = 43.9 bits (102), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 32/57 (56%), Gaps = 5/57 (8%)

Query: 3  VEKSDIRKPRRAKTFTGCWTCRSRKVKCDLGRPSCKRCERSGFECGGYDIKLRWSKP 59
          +E S++++  +A     C  CR +K+KCD  RPSC  C++ G++C   D   R   P
Sbjct: 17 IELSNMKRSSQA-----CDRCRLKKIKCDGLRPSCTSCKKIGYQCKTSDKLTRRGFP 68

>KLLA0F00572g complement(42710..44503) some similarities with
          ca|CA2184|IPF6874.3 Candida albicans unknown function,
          3-prime end, hypothetical start
          Length = 597

 Score = 43.9 bits (102), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 16/35 (45%), Positives = 23/35 (65%)

Query: 13 RAKTFTGCWTCRSRKVKCDLGRPSCKRCERSGFEC 47
          + ++ TGC  CR RK KCD  +P+C  C+R+  EC
Sbjct: 4  KKRSSTGCLICRRRKKKCDEVKPTCTACKRNFLEC 38

>Kwal_27.10232
          Length = 1209

 Score = 43.9 bits (102), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 18/41 (43%), Positives = 22/41 (53%)

Query: 19  GCWTCRSRKVKCDLGRPSCKRCERSGFECGGYDIKLRWSKP 59
            C  CRS+K +CD  RP C +C   GFEC   D   R + P
Sbjct: 73  ACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFP 113

>ADR405C [2145] [Homologous to ScYAL051W (OAF1) - SH; ScYOR363C
          (PIP2) - SH] (1435705..1438128) [2424 bp, 807 aa]
          Length = 807

 Score = 43.5 bits (101), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 30/50 (60%), Gaps = 2/50 (4%)

Query: 10 KPRRAKTFTGCWTCRSRKVKCDLGRPSCKRCERSGFECGGYDIKLRWSKP 59
          K RR K    C +CR  K KCD  +PSC RC ++G  C  YD++ + +KP
Sbjct: 29 KGRRNKLSFVCQSCRRSKTKCDKVKPSCTRCVKNGSVC-VYDVETQ-TKP 76

>Kwal_26.6805
          Length = 944

 Score = 43.5 bits (101), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 18/41 (43%), Positives = 23/41 (56%), Gaps = 1/41 (2%)

Query: 12 RRAKTFTGCWTCRSRKVKCDLGRPSCKRCERSGFECGGYDI 52
          RR +    C +CR  K KCD  +PSC RC + G  C  YD+
Sbjct: 21 RRNRLSFVCQSCRKGKTKCDRAKPSCSRCLKHGIRC-VYDV 60

>KLLA0A03421g 308414..311056 weakly similar to sp|P39720
          Saccharomyces cerevisiae YAL051w OAF1 peroxisome
          proliferating transcription factor, start by similarity
          Length = 880

 Score = 43.5 bits (101), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 29/50 (58%), Gaps = 1/50 (2%)

Query: 4  EKSDIRKPRRAKTFTGCWTCRSRKVKCDLGRPSCKRCERSGFECGGYDIK 53
          ++++++  +R K    C  CR  K KCD  +PSC RC+R    C  YD++
Sbjct: 5  QEANLKAKKRYKLSFVCQLCRKSKTKCDRKKPSCARCQRLNKPC-IYDLE 53

>Scas_573.4
          Length = 1478

 Score = 43.5 bits (101), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 28/49 (57%)

Query: 10 KPRRAKTFTGCWTCRSRKVKCDLGRPSCKRCERSGFECGGYDIKLRWSK 58
          K +R +    C  CR RKVKCD  RP C++C ++G     + ++  W++
Sbjct: 33 KRKRNRVPLSCTICRKRKVKCDKIRPHCQQCTKTGVAHLCHYMEQSWAE 81

>KLLA0C16489g 1444456..1446642 some similarities with
          ca|CA2184|IPF6874.3 Candida albicans unknown function,
          3-prime end, hypothetical start
          Length = 728

 Score = 43.1 bits (100), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 30/42 (71%)

Query: 6  SDIRKPRRAKTFTGCWTCRSRKVKCDLGRPSCKRCERSGFEC 47
          SD++K ++ ++ +GC+TCR +++KCD   P C RC+R+   C
Sbjct: 29 SDLKKKKKTRSKSGCFTCRLKRMKCDEQHPICGRCKRNLLTC 70

>Scas_679.26
          Length = 775

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 27/47 (57%), Gaps = 1/47 (2%)

Query: 2  KVEKSDIRKPR-RAKTFTGCWTCRSRKVKCDLGRPSCKRCERSGFEC 47
          KV K+   K +   K+  GC  C+ R+VKCD  +P+C++C     EC
Sbjct: 39 KVSKTSTGKRKFHNKSKNGCDNCKRRRVKCDELKPTCQKCINMNLEC 85

>AGL091W [4220] [Homologous to ScYLR228C (ECM22) - SH; ScYDR213W
           (UPC2) - SH] complement(535317..537917) [2601 bp, 866
           aa]
          Length = 866

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 21/33 (63%)

Query: 15  KTFTGCWTCRSRKVKCDLGRPSCKRCERSGFEC 47
           K+  GC  C+ R+VKCD G+P C++C +    C
Sbjct: 84  KSKNGCDNCKRRRVKCDEGKPGCQKCLKMRLSC 116

>CAGL0D02904g complement(302952..305615) similar to sp|P07272
          Saccharomyces cerevisiae YLR014c PPR1 transcription
          factor regulating pyrimidine pathway, hypothetical
          start
          Length = 887

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 17/33 (51%), Positives = 19/33 (57%)

Query: 19 GCWTCRSRKVKCDLGRPSCKRCERSGFECGGYD 51
           C  CR +KVKCD G PSCK C R+   C   D
Sbjct: 24 ACKLCRRKKVKCDQGYPSCKGCLRNNVPCVSVD 56

>Kwal_56.24670
          Length = 643

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 21/36 (58%)

Query: 12 RRAKTFTGCWTCRSRKVKCDLGRPSCKRCERSGFEC 47
          +R    TGC  C+ RK +C   +P+C  CER GF C
Sbjct: 19 KRTHRKTGCIPCKIRKKRCSEHKPTCTDCERLGFTC 54

>AGL206C [4106] [Homologous to NOHBY] (311846..314053) [2208 bp,
          735 aa]
          Length = 735

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 28/54 (51%), Gaps = 6/54 (11%)

Query: 4  EKSDIRKPRRAKTFTGCWTCRSRKVKCDLGRPSCKRCERSGFEC------GGYD 51
          + S + K    ++  GC TCR+R+ KCD  RP C  C+R+   C      G YD
Sbjct: 34 DDSRVLKKTEKRSRNGCLTCRARRKKCDETRPKCIGCQRNLLLCHWADDDGNYD 87

>Sklu_2064.2 , Contig c2064 873-3641
          Length = 922

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 18/42 (42%), Positives = 23/42 (54%), Gaps = 1/42 (2%)

Query: 12 RRAKTFTGCWTCRSRKVKCDLGRPSCKRCERSGFECGGYDIK 53
          +R +    C  CR RK+KCD  RP C +C   G  C  YDI+
Sbjct: 17 KRNRLSFVCLECRRRKIKCDKQRPCCIQCAEQGLTC-VYDIE 57

>KLLA0A06039g 557368..559341 weakly similar to sp|P36023
          Saccharomyces cerevisiae YKR064w singleton, start by
          similarity
          Length = 657

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 20/36 (55%)

Query: 12 RRAKTFTGCWTCRSRKVKCDLGRPSCKRCERSGFEC 47
          +R +    C  CR RK KCD G+PSC  C + G  C
Sbjct: 13 KRHRPTLVCLNCRRRKTKCDRGKPSCSNCLKLGETC 48

>ACL058W [991] [Homologous to NOHBY] complement(261723..264176)
          [2454 bp, 817 aa]
          Length = 817

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 14/39 (35%), Positives = 21/39 (53%)

Query: 12 RRAKTFTGCWTCRSRKVKCDLGRPSCKRCERSGFECGGY 50
          +R +    C  C  RKVKC+  RP C  CE++ + C  +
Sbjct: 30 KRQRRVLNCMPCHKRKVKCNRARPVCDHCEKNRYACAYF 68

>KLLA0F14322g 1328925..1331078 gi|32440908|emb|CAE00852.1
           Kluyveromyces lactis Sip4 protein, start by similarity
          Length = 717

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 26/48 (54%), Gaps = 1/48 (2%)

Query: 13  RAKTFT-GCWTCRSRKVKCDLGRPSCKRCERSGFECGGYDIKLRWSKP 59
           + K F+  C  CR +K+KCD  +PSC  C++ G+ C   D   R   P
Sbjct: 55  KVKRFSQACDRCRLKKIKCDGIKPSCSNCKKIGYHCSTSDKLTRRGFP 102

>CAGL0L04400g complement(511762..514725) similar to tr|Q12340
          Saccharomyces cerevisiae YOR172w, hypothetical start
          Length = 987

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 24/48 (50%), Gaps = 1/48 (2%)

Query: 4  EKSDIRKPR-RAKTFTGCWTCRSRKVKCDLGRPSCKRCERSGFECGGY 50
          + SD ++P+ R K    C  CR RK+KCD  +P C  C R       Y
Sbjct: 20 KNSDCKRPKKRFKPLKSCAFCRKRKLKCDKQKPRCSSCARRNLPVCVY 67

>KLLA0F04213g 400673..402979 similar to sp|P40971 Saccharomyces
           cerevisiae YDR034c LYS14 transcriptional activator of
           lysine pathway genes singleton, start by similarity
          Length = 768

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 15/42 (35%), Positives = 26/42 (61%)

Query: 6   SDIRKPRRAKTFTGCWTCRSRKVKCDLGRPSCKRCERSGFEC 47
           +D +  +R  +  GC  C+ R++KCD G+P+C +C R   +C
Sbjct: 141 ADGKIVKRKYSRNGCLECKKRRMKCDEGKPTCWQCARLNRKC 182

>Sklu_2296.6 YJL089W, Contig c2296 12179-14938 reverse complement
          Length = 919

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 26/48 (54%)

Query: 12 RRAKTFTGCWTCRSRKVKCDLGRPSCKRCERSGFECGGYDIKLRWSKP 59
          R+ ++   C  CR +K+KCD  +P+C  C++ GF C   D   R   P
Sbjct: 21 RQERSSQACDRCRLKKIKCDGLKPNCTSCKKVGFHCQTSDKLTRRGFP 68

>Kwal_23.6529
          Length = 598

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 18/60 (30%), Positives = 31/60 (51%), Gaps = 1/60 (1%)

Query: 8  IRKPRRAKTFTGCWTCRSRKVKCDLGRPSCKRCERSGFECGGYDIKLRW-SKPIKFDRYG 66
          I   +  ++  GC  C+  K+KCD  +P C +C + G +   Y + L+W  +P K  + G
Sbjct: 2  IMSTKNQRSRGGCINCKKSKIKCDEKKPMCGQCAKKGRDDCAYALVLQWGGRPYKNAKKG 61

>AFR117C [3309] [Homologous to ScYLR256W (HAP1) - SH]
          (646832..650290) [3459 bp, 1152 aa]
          Length = 1152

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 16/35 (45%), Positives = 21/35 (60%)

Query: 10 KPRRAKTFTGCWTCRSRKVKCDLGRPSCKRCERSG 44
          K +R +    C  CR RKVKCD  RP C +C ++G
Sbjct: 9  KRKRNRVPLSCTICRKRKVKCDKTRPHCNQCTKTG 43

>ADR199C [1940] [Homologous to ScYDR421W (ARO80) - SH]
          (1048530..1051364) [2835 bp, 944 aa]
          Length = 944

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 21/45 (46%), Positives = 24/45 (53%), Gaps = 8/45 (17%)

Query: 9  RKPRRAKTFTGCWTCRSRKVKCDLG------RPSCKRCERSGFEC 47
          RK RR   +  C  CR+RKV+CDLG       P C RC R   EC
Sbjct: 23 RKWRR--IYKACLNCRTRKVRCDLGPVDKPREPPCVRCSRERKEC 65

>YLR014C (PPR1) [3432] chr12 complement(172267..174981)
          Transcription factor regulating pyrimidine pathway,
          contains a Zn[2]-Cys[6] fungal-type binuclear cluster
          domain in the N-terminal region [2715 bp, 904 aa]
          Length = 904

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 17/38 (44%), Positives = 22/38 (57%)

Query: 14 AKTFTGCWTCRSRKVKCDLGRPSCKRCERSGFECGGYD 51
          +K+ T C  CR +K+KCD   PSCKRC +    C   D
Sbjct: 28 SKSRTACKRCRLKKIKCDQEFPSCKRCAKLEVPCVSLD 65

>KLLA0D10153g 858016..859983 weakly similar to sp|P35995
          Saccharomyces cerevisiae YKL222c, hypothetical start
          Length = 655

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 18/43 (41%), Positives = 24/43 (55%), Gaps = 1/43 (2%)

Query: 13 RAKTFTGCWTCRSRKVKCDLGRPSCKRCERSGFECGGYDIKLR 55
          R K    C  C+ RK KCD   PSC  C + G+EC  Y++ L+
Sbjct: 5  RNKPTRSCLMCQRRKKKCDRKAPSCSACLKKGYEC-IYNVNLQ 46

>CAGL0K05841g 572315..576433 similar to sp|P12351 Saccharomyces
           cerevisiae YLR256w HAP1 transcription factor,
           hypothetical start
          Length = 1372

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 16/46 (34%), Positives = 26/46 (56%)

Query: 13  RAKTFTGCWTCRSRKVKCDLGRPSCKRCERSGFECGGYDIKLRWSK 58
           R +    C  CR RKVKCD  RP+C +C ++G     + ++  W++
Sbjct: 64  RNRVPLSCTICRRRKVKCDKSRPNCTQCVKTGVAHLCHYMEQAWAE 109

>AGR061C [4371] [Homologous to ScYLR098C (CHA4) - SH]
          (831058..832896) [1839 bp, 612 aa]
          Length = 612

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 28/50 (56%), Gaps = 6/50 (12%)

Query: 6  SDIRKPRRAKTFTGCWTCRSRKVKCDLGRPSCKRCERSGFECGGYDIKLR 55
          SD++K + A     C TCR R+ KCDL  P C  C++ G EC   D  LR
Sbjct: 5  SDLKKLKLA-----CQTCRKRRRKCDLQVP-CVNCQKFGVECLPVDQDLR 48

>KLLA0D00484g 44879..47893 no similarity, hypothetical start
          Length = 1004

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 15/44 (34%), Positives = 22/44 (50%)

Query: 4  EKSDIRKPRRAKTFTGCWTCRSRKVKCDLGRPSCKRCERSGFEC 47
          EK   +K +   +  GC  C+    KCD  +P C RCE+   +C
Sbjct: 55 EKLSTKKRKSTYSRKGCLQCKKAHTKCDERKPKCSRCEKRSIDC 98

>CAGL0H01507g complement(147689..150073) similar to sp|Q06639
          Saccharomyces cerevisiae YDR303c RSC3, start by
          similarity
          Length = 794

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 19/38 (50%), Positives = 21/38 (55%), Gaps = 1/38 (2%)

Query: 7  DIRKPRRAKTFTGCWTCRSRKVKCDLGRPSCKRCERSG 44
          DIR  R+ K    C  CR RKV CD  RP C  C R+G
Sbjct: 2  DIRG-RKMKKPPACAQCRRRKVGCDRVRPVCGNCARAG 38

>Sklu_2376.6 , Contig c2376 12573-15341 reverse complement
          Length = 922

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 15/37 (40%), Positives = 20/37 (54%)

Query: 4  EKSDIRKPRRAKTFTGCWTCRSRKVKCDLGRPSCKRC 40
          E     K +R +T   C  C+ RK+KCD  RP+C  C
Sbjct: 12 ESEHFPKKKRQRTTVVCTNCKKRKIKCDRKRPACSNC 48

>KLLA0A01804g complement(159689..162526) similar to sgd|S0002829
          Saccharomyces cerevisiae YDR421w positive transcription
          regulator of ARO9 and ARO10, start by similarity
          Length = 945

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 17/39 (43%), Positives = 21/39 (53%), Gaps = 6/39 (15%)

Query: 15 KTFTGCWTCRSRKVKCDLGR------PSCKRCERSGFEC 47
          + +  C  C+ RKVKCDLG       P C RC+R   EC
Sbjct: 19 RGYKACLNCKMRKVKCDLGPFDNPHGPPCVRCKRESREC 57

>ADR404C [2144] [Homologous to ScYAL051W (OAF1) - SH; ScYOR363C
          (PIP2) - SH] (1432323..1434950) [2628 bp, 875 aa]
          Length = 875

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 17/34 (50%), Positives = 20/34 (58%), Gaps = 1/34 (2%)

Query: 20 CWTCRSRKVKCDLGRPSCKRCERSGFECGGYDIK 53
          C  CR  K KCD  +P+C RC   G  C GYDI+
Sbjct: 24 CIPCRKCKTKCDKLKPTCSRCAELGLYC-GYDIE 56

>KLLA0A04169g complement(376273..378600) similar to sgd|S0004218
          Saccharomyces cerevisiae YLR228c ECM22, start by
          similarity
          Length = 775

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 20/33 (60%)

Query: 15 KTFTGCWTCRSRKVKCDLGRPSCKRCERSGFEC 47
          K+  GC  C+ R+VKCD  RP C  C++   +C
Sbjct: 52 KSKNGCDHCKRRRVKCDETRPHCLNCKKMSLDC 84

>Kwal_55.20674
          Length = 252

 Score = 40.4 bits (93), Expect = 0.004,   Method: Composition-based stats.
 Identities = 17/38 (44%), Positives = 20/38 (52%), Gaps = 1/38 (2%)

Query: 10 KPRRAKTFTGCWTCRSRKVKCDLGRPSCKRCERSGFEC 47
          K R    FT C +CR RK KC   +P C+RC R    C
Sbjct: 12 KDRSGAMFT-CKSCRQRKRKCSREKPQCQRCARLSIPC 48

>Kwal_23.6425
          Length = 735

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 24/44 (54%), Gaps = 1/44 (2%)

Query: 5  KSDIRKPRRAKTFTGCWTCRSRKVKCDLGRPSCKRCERSGF-EC 47
          ++++   +R K+   C  CR RK+KCD  RP C  C   G  EC
Sbjct: 21 EAELGSRKRRKSIKQCLFCRKRKLKCDKNRPVCGTCASRGLTEC 64

>YAL051W (OAF1) [17] chr1 (48565..51753) Transcription factor
          required for induction of SPS19 and POX1 on
          oleate-containing medium, plays a role in peroxisome
          proliferation [3189 bp, 1062 aa]
          Length = 1062

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 24/49 (48%), Gaps = 1/49 (2%)

Query: 4  EKSDIRKPRRAKTFTGCWTCRSRKVKCDLGRPSCKRCERSGFECGGYDI 52
          E S+    +R +    C  C   K KCD  +P C RC + G +C  YD+
Sbjct: 50 ENSETHNRKRNRILFVCQACWKSKTKCDREKPECGRCVKHGLKC-VYDV 97

>KLLA0F09559g complement(876719..878695) some similarities with
           sgd|S0005698 Saccharomyces cerevisiae YOR172w,
           hypothetical start
          Length = 658

 Score = 40.8 bits (94), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 17/37 (45%), Positives = 20/37 (54%), Gaps = 1/37 (2%)

Query: 12  RRAKTFTGCWTCRSRKVKCDLGRPSCKRCERSGF-EC 47
           +R K    C  CR RK+KCD  RP C  C+  G  EC
Sbjct: 82  KRRKVIKSCTFCRKRKLKCDRKRPMCTGCKMRGLSEC 118

>Scas_521.2
          Length = 890

 Score = 40.8 bits (94), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 21/38 (55%)

Query: 14 AKTFTGCWTCRSRKVKCDLGRPSCKRCERSGFECGGYD 51
          +K+ + C  CRS+K+KCD   PSC RC      C   D
Sbjct: 35 SKSKSACKRCRSKKIKCDQKFPSCDRCAHLKVPCVSVD 72

>Sklu_1973.1 YDR303C, Contig c1973 815-3148 reverse complement
          Length = 777

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 17/38 (44%), Positives = 21/38 (55%), Gaps = 1/38 (2%)

Query: 7  DIRKPRRAKTFTGCWTCRSRKVKCDLGRPSCKRCERSG 44
          DIR  R+ K    C  CR RK+ CD  +P C  C R+G
Sbjct: 4  DIRG-RKMKKPPACVQCRKRKIGCDRAKPICGNCLRNG 40

>KLLA0D05038g 433653..435674 weakly similar to sp|P40971
          Saccharomyces cerevisiae YDR034c LYS14 transcriptional
          activator of lysine pathway genes singleton, start by
          similarity
          Length = 673

 Score = 40.4 bits (93), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 21/38 (55%)

Query: 10 KPRRAKTFTGCWTCRSRKVKCDLGRPSCKRCERSGFEC 47
          K +R  +  GC  C+ +KVKCD  +P C +C     EC
Sbjct: 18 KKKRKYSKNGCLECKRKKVKCDETKPMCWQCTHLSLEC 55

>YLR266C (PDR8) [3660] chr12 complement(675621..677726)
          Zn[2]-Cys[6] zinc finger transcription factor, likely
          involved in pleiotropic drug response [2106 bp, 701 aa]
          Length = 701

 Score = 40.4 bits (93), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 14/32 (43%), Positives = 19/32 (59%)

Query: 9  RKPRRAKTFTGCWTCRSRKVKCDLGRPSCKRC 40
          +K +R K    C  CR RK+KC   RP C++C
Sbjct: 20 KKGKRRKVIKSCAFCRKRKLKCSQARPMCQQC 51

>Kwal_47.17233
          Length = 948

 Score = 40.4 bits (93), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 14/36 (38%), Positives = 19/36 (52%)

Query: 12 RRAKTFTGCWTCRSRKVKCDLGRPSCKRCERSGFEC 47
          RR +    C  C  RK+KC    PSC +C +  +EC
Sbjct: 27 RRQRKILSCVPCHKRKIKCTRETPSCSKCLKKNWEC 62

>YGL013C (PDR1) [1960] chr7 complement(469095..472301) Zinc-finger
          transcription factor, in conjunction with Pdr3p
          regulates the expression of a network of genes involved
          in multiple drug resistance [3207 bp, 1068 aa]
          Length = 1068

 Score = 40.4 bits (93), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 23/52 (44%), Positives = 27/52 (51%), Gaps = 8/52 (15%)

Query: 8  IRKPRRAKTFTGCWTCRSRKVKCDLGRPSCKRCERSGFEC------GGYDIK 53
          IRKPR +K    C  CR RK+KC+ G+  C  CE    EC      GG  IK
Sbjct: 35 IRKPR-SKVSKACDNCRKRKIKCN-GKFPCASCEIYSCECTFSTRQGGARIK 84

>ADR403C [2143] [Homologous to ScYAL051W (OAF1) - SH; ScYOR363C
          (PIP2) - SH] (1429118..1432030) [2913 bp, 970 aa]
          Length = 970

 Score = 40.4 bits (93), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 28/52 (53%), Gaps = 3/52 (5%)

Query: 4  EKSDIRK--PRRAKTFTGCWTCRSRKVKCDLGRPSCKRCERSGFECGGYDIK 53
          E+S  RK   +R +    C  CR  K KCD  +P C RC ++  +C  YDI+
Sbjct: 14 EESPDRKYVSKRNRISFVCQACRKSKTKCDREKPRCSRCAKNNVKC-VYDIE 64

>Scas_721.94
          Length = 869

 Score = 40.4 bits (93), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 20/33 (60%)

Query: 15 KTFTGCWTCRSRKVKCDLGRPSCKRCERSGFEC 47
          K+  GC  C+ R+VKCD  +P+C+RC      C
Sbjct: 50 KSKQGCTHCKRRRVKCDELKPACRRCLNWNVPC 82

>AAL057C [130] [Homologous to ScYDR303C (RSC3) - SH; ScYHR056C
          (RSC30) - SH] (246899..249328) [2430 bp, 809 aa]
          Length = 809

 Score = 40.4 bits (93), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 17/38 (44%), Positives = 21/38 (55%), Gaps = 1/38 (2%)

Query: 7  DIRKPRRAKTFTGCWTCRSRKVKCDLGRPSCKRCERSG 44
          DIR  R+ K    C  CR RK+ CD  +P C  C R+G
Sbjct: 4  DIRG-RKMKKPPACVQCRKRKIGCDRAKPLCGNCVRNG 40

>Kwal_23.2905
          Length = 881

 Score = 40.0 bits (92), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 27/56 (48%), Gaps = 5/56 (8%)

Query: 1  MKVEKSDIRKPRRA-----KTFTGCWTCRSRKVKCDLGRPSCKRCERSGFECGGYD 51
          +K + +  R+P  A     ++   C  CR RKVKCD   PSC RC  +   C   D
Sbjct: 25 LKEQSNRKRRPTSAIMGISRSIAACKRCRIRKVKCDQKFPSCSRCVSANEPCVSID 80

>CAGL0M12298g complement(1225753..1228737) similar to sp|P39720
          Saccharomyces cerevisiae YAL051w OAF1 peroxisome
          proliferating transcription factor or sp|P52960
          Saccharomyces cerevisiae YOR363c PIP2, hypothetical
          start
          Length = 994

 Score = 40.0 bits (92), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 25/49 (51%), Gaps = 1/49 (2%)

Query: 4  EKSDIRKPRRAKTFTGCWTCRSRKVKCDLGRPSCKRCERSGFECGGYDI 52
          E +  R  +R +    C  CR  K +CD  +P C RC++   EC  YD+
Sbjct: 11 EGNAARTRKRNRISFVCQACRRSKTRCDKEKPICTRCKKLKLEC-VYDM 58

>Kwal_14.2619
          Length = 1167

 Score = 40.0 bits (92), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 19/38 (50%), Positives = 23/38 (60%), Gaps = 3/38 (7%)

Query: 18 TGCWTCRSRKVKCDLGRPSCKRC--ERSGFECGGYDIK 53
          T C TCR RKVKCD  +P C  C   +S  EC  Y++K
Sbjct: 10 TSCLTCRRRKVKCDRSKPVCLACIKYKSISEC-SYEVK 46

>KLLA0F19602g complement(1814949..1816760) similar to sp|P43634
          Saccharomyces cerevisiae YLR098c CHA4 transcription
          factor, start by similarity
          Length = 603

 Score = 39.7 bits (91), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 15/36 (41%), Positives = 20/36 (55%), Gaps = 1/36 (2%)

Query: 12 RRAKTFTGCWTCRSRKVKCDLGRPSCKRCERSGFEC 47
          R+ K    C  CR ++ KCD+ RP C  C + G EC
Sbjct: 9  RKRKAHLACQNCRIKRRKCDMERP-CSNCLKYGIEC 43

>YCR106W (RDS1) [627] chr3 (310954..313452) Protein with
          similarity to transcription factors, has Zn[2]-Cys[6]
          fungal-type binuclear cluster domain in the N-terminal
          region, involved in resistance to cycloheximide [2499
          bp, 832 aa]
          Length = 832

 Score = 40.0 bits (92), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 15/40 (37%), Positives = 23/40 (57%), Gaps = 3/40 (7%)

Query: 8  IRKPRRAKTFTGCWTCRSRKVKCDLGRPSCKRCERSGFEC 47
          ++KPR       C  C+  K KCD  RP+C RC+++  +C
Sbjct: 6  VKKPRLRLV---CLQCKKIKRKCDKLRPACSRCQQNSLQC 42

>YJL206C (YJL206C) [2722] chr10 complement(47659..49935) Protein
          with weak similarity to Put3p and other transcription
          factors, has a Zn[2]-Cys[6] fungal-type binuclear
          cluster domain in the N-terminal region [2277 bp, 758
          aa]
          Length = 758

 Score = 39.7 bits (91), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 28/55 (50%), Gaps = 4/55 (7%)

Query: 10 KPRRAKTFTGCWTCRSRKVKCDLGRPSCKRCERSGFECGGYDIKLRWSKPIKFDR 64
          KP + +    C  CR RKV+C  G   C+ C+ + +EC  YD   R S    FDR
Sbjct: 37 KPTKGRAHRACIACRKRKVRCS-GNIPCRLCQTNSYEC-KYDRPPRNSS--VFDR 87

>KLLA0E14036g complement(1239566..1241602) some similarities with
          ca|CA4758|CaPPR1 Candida albicans transcription factor
          regulating pyrimidine pathway (by homology),
          hypothetical start
          Length = 678

 Score = 39.7 bits (91), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 15/42 (35%), Positives = 20/42 (47%)

Query: 10 KPRRAKTFTGCWTCRSRKVKCDLGRPSCKRCERSGFECGGYD 51
          K RR      C  C+ R+ +CD G P C  C  +G +C   D
Sbjct: 57 KKRRKNQGVACCFCKRRRKRCDGGFPQCGACVNAGIQCTFVD 98

>CAGL0F03025g 295783..298569 similar to sp|Q04052 Saccharomyces
          cerevisiae YDR421w positive transcription regulator of
          ARO9 and ARO10, hypothetical start
          Length = 928

 Score = 39.7 bits (91), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 16/42 (38%), Positives = 20/42 (47%), Gaps = 6/42 (14%)

Query: 12 RRAKTFTGCWTCRSRKVKCDLG------RPSCKRCERSGFEC 47
          +   TF  C  C+ +K+KCDLG       P C  C RS   C
Sbjct: 30 KHKNTFGACLRCKYKKIKCDLGPADRPVSPPCAACRRSRSHC 71

>KLLA0A09119g complement(797533..800781) weakly similar to
          sp|P12383 Saccharomyces cerevisiae YGL013c PDR1
          transcription factor, start by similarity
          Length = 1082

 Score = 39.7 bits (91), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 19/38 (50%), Positives = 22/38 (57%), Gaps = 2/38 (5%)

Query: 10 KPRRAKTFTGCWTCRSRKVKCDLGRPSCKRCERSGFEC 47
          KPRR K    C +CR +K+KC  G   CK CE  G EC
Sbjct: 46 KPRR-KVSRACDSCRKKKIKCS-GTLPCKSCETYGCEC 81

>Kwal_23.6537
          Length = 552

 Score = 39.3 bits (90), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 25/52 (48%), Gaps = 1/52 (1%)

Query: 1  MKVEKSDIRKPRRAKTFTGCWTCRSRKVKCDLGRPSCKRCERSGFECGGYDI 52
          M    +D+ + +R +    C  CR RK KCD G P C  C   G+ C   D+
Sbjct: 1  MVATGADVPRNKRLRVRKACLPCRQRKRKCDSGFP-CGMCTSYGYNCQYDDV 51

>KLLA0F22880g 2123577..2127071 some similarities with
          ca|CA3639|IPF9251 Candida albicans unknown function,
          hypothetical start
          Length = 1164

 Score = 39.7 bits (91), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 24/46 (52%), Gaps = 3/46 (6%)

Query: 15 KTFTGCWTCRSRKVKCDLGRPSCKRCERSG--FECGGYDIKLRWSK 58
          K    C  CR RKV+CD  +P C  C + G   EC  Y+++ R  K
Sbjct: 4  KNGKSCLVCRRRKVRCDRAKPVCLVCVKHGSNMEC-NYEVQKREVK 48

>YDL170W (UGA3) [701] chr4 (156319..157905) Transcriptional
          activator for 4-aminobutyric acid (GABA) catabolic
          genes, including UGA4, UGA1, and UGS2, contains a
          Zn[2]-Cys[6] fungal-type binuclear cluster domain [1587
          bp, 528 aa]
          Length = 528

 Score = 39.3 bits (90), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 13/29 (44%), Positives = 17/29 (58%)

Query: 19 GCWTCRSRKVKCDLGRPSCKRCERSGFEC 47
          GC TC+ RK +C   +P C+ C R  F C
Sbjct: 16 GCITCKIRKKRCSEDKPVCRDCRRLSFPC 44

>Scas_661.23
          Length = 741

 Score = 39.3 bits (90), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 20/67 (29%), Positives = 29/67 (43%), Gaps = 15/67 (22%)

Query: 12  RRAKTFTGCWTCRSRKVKCDLGRPSCKRCERSGFEC---------------GGYDIKLRW 56
           +R  +  GC  C+ R++KCD  +P C +C R   EC                G   + R 
Sbjct: 124 KRKYSRNGCAECKRRRMKCDETKPICWQCARLSRECVYIVKSGNKKRKSKSAGESAEKRC 183

Query: 57  SKPIKFD 63
            KP+K D
Sbjct: 184 KKPMKED 190

>YDR034C (LYS14) [885] chr4 complement(509732..512104)
           Transcriptional activator of lysine pathway genes with
           2-aminoadipate semialdehyde as coinducer [2373 bp, 790
           aa]
          Length = 790

 Score = 39.3 bits (90), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 13/36 (36%), Positives = 22/36 (61%)

Query: 12  RRAKTFTGCWTCRSRKVKCDLGRPSCKRCERSGFEC 47
           +R  +  GC  C+ R++KCD  +P+C +C R   +C
Sbjct: 151 KRKYSRNGCSECKRRRMKCDETKPTCWQCARLNRQC 186

>CAGL0K11902g complement(1148381..1150876) similar to sp|P40971
           Saccharomyces cerevisiae YDR034c LYS14 transcriptional
           activator of lysine pathway genes, hypothetical start
          Length = 831

 Score = 39.3 bits (90), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 13/36 (36%), Positives = 21/36 (58%)

Query: 12  RRAKTFTGCWTCRSRKVKCDLGRPSCKRCERSGFEC 47
           +R  +  GC  C+ R++KCD  +P C +C R   +C
Sbjct: 196 KRKYSRNGCAECKRRRMKCDESKPKCWQCTRLNRDC 231

>CAGL0M03025g complement(341849..345613) similar to sp|P39113
          Saccharomyces cerevisiae YMR280c CAT8 transcription
          factor involved in gluconeogenesis, hypothetical start
          Length = 1254

 Score = 39.3 bits (90), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 18/41 (43%), Positives = 20/41 (48%)

Query: 19 GCWTCRSRKVKCDLGRPSCKRCERSGFECGGYDIKLRWSKP 59
           C  CR +K KCD   P C +C   GFEC   D   R S P
Sbjct: 59 ACDRCRLKKTKCDGKIPQCSQCALVGFECKISDRLNRKSFP 99

>Scas_590.2
          Length = 1172

 Score = 39.3 bits (90), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 14/30 (46%), Positives = 17/30 (56%)

Query: 18 TGCWTCRSRKVKCDLGRPSCKRCERSGFEC 47
          T C  CR RK KCD   PSC  C ++  +C
Sbjct: 39 TACLLCRRRKQKCDHQLPSCTACLKAAVKC 68

>CAGL0D03850g 384689..387193 weakly similar to sp|Q06639
          Saccharomyces cerevisiae YDR303c RSC3 or sp|P38781
          Saccharomyces cerevisiae YHR056c, hypothetical start
          Length = 834

 Score = 39.3 bits (90), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 13/33 (39%), Positives = 18/33 (54%)

Query: 12 RRAKTFTGCWTCRSRKVKCDLGRPSCKRCERSG 44
          ++ K    C  CR RK+ CD G+P C  C + G
Sbjct: 8  KKVKKPPACQQCRRRKIGCDRGKPICGNCLKQG 40

>AFR171W [3363] [Homologous to NOHBY] complement(752592..754430)
          [1839 bp, 612 aa]
          Length = 612

 Score = 38.9 bits (89), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 17/37 (45%), Positives = 23/37 (62%), Gaps = 1/37 (2%)

Query: 12 RRAK-TFTGCWTCRSRKVKCDLGRPSCKRCERSGFEC 47
          RR+K +  GC  C+ RKVKCD  +P+C +C   G  C
Sbjct: 13 RRSKYSKNGCSECKRRKVKCDETKPACWQCSHLGKRC 49

>Scas_688.17
          Length = 769

 Score = 38.9 bits (89), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 13/29 (44%), Positives = 15/29 (51%)

Query: 12 RRAKTFTGCWTCRSRKVKCDLGRPSCKRC 40
          R+ K    C  CR RK+ CD G P C  C
Sbjct: 9  RKPKKNPACIQCRKRKIGCDRGHPKCGNC 37

>KLLA0A03443g 311628..314555 weakly similar to sp|P39720
          Saccharomyces cerevisiae YAL051w OAF1 peroxisome
          proliferating transcription factor, start by similarity
          Length = 975

 Score = 39.3 bits (90), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 20/61 (32%), Positives = 28/61 (45%), Gaps = 11/61 (18%)

Query: 3  VEKSDIRKPRRAKTFTG----------CWTCRSRKVKCDLGRPSCKRCERSGFECGGYDI 52
          +E +D  K R  +T  G          C  CR  K KCD  +P C RC +   +C  YD+
Sbjct: 8  IEPADDEKSREDQTSNGACKRQRISFVCQACRKNKTKCDREKPRCGRCVKYHLKC-VYDV 66

Query: 53 K 53
          +
Sbjct: 67 E 67

>AGL233C [4079] [Homologous to ScYKL222C - NSH; ScYOR172W - NSH]
          (260414..263032) [2619 bp, 872 aa]
          Length = 872

 Score = 38.9 bits (89), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 20/48 (41%), Positives = 22/48 (45%), Gaps = 2/48 (4%)

Query: 1  MKVEKSDIRKPRRAKTFTGCWTCRSRKVKCDLGRPSCKRCERSGF-EC 47
          M      I K RR K    C  CR R+VKC+  RP C  C   G  EC
Sbjct: 1  MAESDGKIVKTRR-KVSKSCVFCRKRRVKCNKARPKCSTCIGKGLPEC 47

>Sklu_2301.1 , Contig c2301 1246-2795 reverse complement
          Length = 517

 Score = 38.9 bits (89), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 20/38 (52%)

Query: 14 AKTFTGCWTCRSRKVKCDLGRPSCKRCERSGFECGGYD 51
          +++   C  CR++K KCD   PSC RC   G  C   D
Sbjct: 34 SRSIVACERCRTKKTKCDQNFPSCARCASLGEPCISVD 71

>Scas_556.6
          Length = 1022

 Score = 38.9 bits (89), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 15/41 (36%), Positives = 21/41 (51%), Gaps = 1/41 (2%)

Query: 12 RRAKTFTGCWTCRSRKVKCDLGRPSCKRCERSGFECGGYDI 52
          +R +    C  CR  K KCD  +P+C RC +    C  YD+
Sbjct: 38 KRNRISFVCQECRKAKTKCDKEKPACTRCVKQNLAC-VYDV 77

>AGR369W [4680] [Homologous to ScYBL066C (SEF1) - SH]
           complement(1412347..1415502) [3156 bp, 1051 aa]
          Length = 1051

 Score = 38.9 bits (89), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 15/36 (41%), Positives = 19/36 (52%), Gaps = 3/36 (8%)

Query: 15  KTFTGCWTCRSRKVKCDLGR---PSCKRCERSGFEC 47
           +  T C  CR  K+KC+       SC RCER G +C
Sbjct: 87  RPVTSCTHCRQHKIKCNASENFPSSCSRCERMGLQC 122

>Sklu_2191.2 YKL222C, Contig c2191 6517-8673 reverse complement
          Length = 718

 Score = 38.9 bits (89), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 20/45 (44%), Positives = 24/45 (53%), Gaps = 3/45 (6%)

Query: 4  EKSDIRKPRRAKTFTGCWTCRSRKVKCDLGRPSCKRC-ERSGFEC 47
          + S IRK  R K    C  CR RK+KCD  +P C  C  R+  EC
Sbjct: 5  QASVIRK--RRKVIKSCLFCRKRKLKCDHKKPKCSTCAARNLPEC 47

>YLR278C (YLR278C) [3671] chr12 complement(700001..704026) Protein
          with similarity to transcription factors, contains an
          N-terminal Zn[2]-Cys[6] fungal-type binuclear cluster
          domain [4026 bp, 1341 aa]
          Length = 1341

 Score = 38.9 bits (89), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 13/29 (44%), Positives = 17/29 (58%)

Query: 19 GCWTCRSRKVKCDLGRPSCKRCERSGFEC 47
           C  CR RK +CD   PSC  C ++G +C
Sbjct: 40 SCLLCRRRKQRCDHKLPSCTACLKAGIKC 68

>KLLA0F18084g complement(1652031..1654613) no similarity,
          hypothetical start
          Length = 860

 Score = 38.9 bits (89), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 17/29 (58%)

Query: 19 GCWTCRSRKVKCDLGRPSCKRCERSGFEC 47
           C  CR  + KCD G+P+C RC +   +C
Sbjct: 4  SCQNCRKTRRKCDRGKPTCARCIKYKIDC 32

>Kwal_47.17681
          Length = 854

 Score = 38.9 bits (89), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 26/54 (48%), Gaps = 2/54 (3%)

Query: 1  MKVEKSDIRKPRRAKTFTGCWTCRSRKVKCDLG-RPSCKRCERSGFECGGYDIK 53
          M  E+S  R  R+ +T   C  C  RKV+CD   R  C  C+  G  C   D+K
Sbjct: 1  MNTERSGYRV-RKPRTNRACEVCHDRKVRCDANIRVPCTSCQTFGLVCRLRDVK 53

>YBR297W (MAL33) [474] chr2 (800479..801885) Maltose fermentation
          regulatory protein, has a Zn[2]-Cys[6] fungal-type
          binuclear cluster domain [1407 bp, 468 aa]
          Length = 468

 Score = 38.5 bits (88), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 20/43 (46%), Positives = 24/43 (55%), Gaps = 2/43 (4%)

Query: 19 GCWTCRSRKVKCDLGRPSCKRCERSGFECGGYD-IKLRWSKPI 60
           C  CR R+VKCD G+  C RC    F+C     +K R SKPI
Sbjct: 7  ACDYCRVRRVKCD-GKKPCSRCIEHNFDCTYQQPLKKRGSKPI 48

>Scas_659.10
          Length = 757

 Score = 38.5 bits (88), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 14/29 (48%), Positives = 17/29 (58%)

Query: 12 RRAKTFTGCWTCRSRKVKCDLGRPSCKRC 40
          RR K    C  CR RK+KCD  +P C +C
Sbjct: 13 RRRKPIKSCAFCRGRKLKCDKNKPICNQC 41

>Scas_625.5
          Length = 1141

 Score = 38.5 bits (88), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 15/46 (32%), Positives = 24/46 (52%), Gaps = 2/46 (4%)

Query: 12  RRAKTFTGCWTCRSRKVKCDLG--RPSCKRCERSGFECGGYDIKLR 55
           +R K    C  CR +K+KCD    +  C  C+R+G +C    + L+
Sbjct: 67  KRTKASRACDQCRKKKIKCDFSEEKTLCSNCQRNGEKCTFERVPLK 112

>CAGL0A00451g 47557..50880 similar to sp|P12383 Saccharomyces
          cerevisiae YGL013c PDR1 transcription factor,
          hypothetical start
          Length = 1107

 Score = 38.5 bits (88), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 20/47 (42%), Positives = 25/47 (53%), Gaps = 3/47 (6%)

Query: 9  RKP--RRAKTFTGCWTCRSRKVKCDLGRPSCKRCERSGFECGGYDIK 53
          +KP  RR K    C +CR RK+KC+  +P C  C   G EC   D K
Sbjct: 18 QKPSTRRTKVGKACDSCRRRKIKCNGLKP-CPSCTIYGCECTYTDAK 63

>CAGL0E05434g 532577..535027 similar to sp|P47988 Saccharomyces
           cerevisiae YOR337w TEA1 TY1 enhancer activator,
           hypothetical start
          Length = 816

 Score = 38.5 bits (88), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 18/44 (40%), Positives = 22/44 (50%), Gaps = 1/44 (2%)

Query: 12  RRAKTFTGCWTCRSRKVKCDLGRPSCKRCERSGFECGGYDIKLR 55
           R  K    C  CR R+ KCDL  P C  C++ G EC   +  LR
Sbjct: 68  RPTKKRLACSNCRRRRKKCDLQYP-CFTCDKLGLECNINEEDLR 110

>KLLA0F02387g complement(213669..215852) similar to sp|P47988
          Saccharomyces cerevisiae YOR337w TEA1 TY1 enhancer
          activator, start by similarity
          Length = 727

 Score = 38.5 bits (88), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 16/37 (43%), Positives = 19/37 (51%), Gaps = 1/37 (2%)

Query: 19 GCWTCRSRKVKCDLGRPSCKRCERSGFECGGYDIKLR 55
           C  CR R+ KCDL  P C RC+  G  C    + LR
Sbjct: 40 ACANCRRRRKKCDLEYP-CGRCQELGLGCNINKVDLR 75

>YJL089W (SIP4) [2826] chr10 (265842..268331) Transcriptional
          activator of gluconeogenic genes through CSRE elements,
          activated by Snf1p kinase, contains a Zn[2]-Cys[6]
          fungal-type binuclear cluster domain [2490 bp, 829 aa]
          Length = 829

 Score = 38.5 bits (88), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 13/33 (39%), Positives = 18/33 (54%)

Query: 19 GCWTCRSRKVKCDLGRPSCKRCERSGFECGGYD 51
           C  CR +K+KCD  +P+C  C +  F C   D
Sbjct: 45 ACDRCRLKKIKCDGLKPNCSNCAKIDFPCKTSD 77

>CAGL0A04455g 432854..436150 similar to sp|P34228 Saccharomyces
           cerevisiae YBL066c SEF1, hypothetical start
          Length = 1098

 Score = 38.5 bits (88), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 14/36 (38%), Positives = 19/36 (52%), Gaps = 3/36 (8%)

Query: 15  KTFTGCWTCRSRKVKCDLGR---PSCKRCERSGFEC 47
           +  T C  CR  K+KCD  +     C RC ++GF C
Sbjct: 82  RPVTSCTHCRQHKIKCDASQNFPAPCTRCAKNGFHC 117

>ADR365W [2106] [Homologous to ScYOR337W (TEA1) - SH]
          complement(1355410..1357515) [2106 bp, 701 aa]
          Length = 701

 Score = 38.1 bits (87), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 23/67 (34%), Positives = 31/67 (46%), Gaps = 13/67 (19%)

Query: 1  MKVEKSDIR-----KPRRAKTFTG-------CWTCRSRKVKCDLGRPSCKRCERSGFECG 48
          ++ E S +R     +P   +++TG       C  CR R+ KCDL  P C  C R   EC 
Sbjct: 16 IRCEASPVRGPLTEEPAERESYTGVSKKRLACTNCRRRRKKCDLNYP-CSSCLRLKLECN 74

Query: 49 GYDIKLR 55
            D  LR
Sbjct: 75 VNDEDLR 81

>Sklu_2321.3 YLR014C, Contig c2321 8747-11467
          Length = 906

 Score = 38.1 bits (87), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 14/38 (36%), Positives = 20/38 (52%)

Query: 14 AKTFTGCWTCRSRKVKCDLGRPSCKRCERSGFECGGYD 51
          +++   C  CR +KVKCD   PSC +C  +   C   D
Sbjct: 37 SRSIAACKRCRLKKVKCDQKFPSCSKCASANEPCVSLD 74

>KLLA0F10835g 997512..999782 no similarity, hypothetical start
          Length = 756

 Score = 38.1 bits (87), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 14/39 (35%), Positives = 21/39 (53%), Gaps = 2/39 (5%)

Query: 9  RKPRRAKTFTGCWTCRSRKVKCDLGRPSCKRCERSGFEC 47
          RK R ++   GC  C+   +KCD G+P C +C +    C
Sbjct: 15 RKTRYSRK--GCLQCKRSHLKCDEGQPKCGKCVKRNISC 51

>Kwal_34.15751
          Length = 628

 Score = 38.1 bits (87), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 14/38 (36%), Positives = 22/38 (57%)

Query: 10 KPRRAKTFTGCWTCRSRKVKCDLGRPSCKRCERSGFEC 47
          K ++ +    C  CR RK+KC+  +PSC RC +   +C
Sbjct: 5  KSKKNRISHVCDACRIRKLKCNKQKPSCSRCVKHDLQC 42

>Scas_702.7
          Length = 1113

 Score = 38.1 bits (87), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 25/52 (48%), Gaps = 2/52 (3%)

Query: 8  IRKPRRAKTFTGCWTCRSRKVKCDLGRPSCKRCERSGFECGGYDIKLRWSKP 59
          I++PR+ K    C  CR RK+KC  G   C  C     EC   D+K   S P
Sbjct: 26 IKRPRK-KVSKACANCRRRKIKCT-GTYPCSNCAAYQCECIFDDLKEDSSNP 75

>KLLA0C10923g complement(939148..941475) similar to sp|P07272
          Saccharomyces cerevisiae YLR014c PPR1 transcription
          factor regulating pyrimidine pathway, hypothetical
          start
          Length = 775

 Score = 38.1 bits (87), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 24/51 (47%)

Query: 15 KTFTGCWTCRSRKVKCDLGRPSCKRCERSGFECGGYDIKLRWSKPIKFDRY 65
          ++   C  CR RK+KCD   PSC +C ++   C   D   R   P  +  Y
Sbjct: 15 RSVAACKRCRIRKIKCDNKFPSCTKCIQAQEPCITIDPSTRREIPRSYVVY 65

>KLLA0D11286g complement(964642..966678) no similarity,
          hypothetical start
          Length = 678

 Score = 37.7 bits (86), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 15/35 (42%), Positives = 18/35 (51%)

Query: 13 RAKTFTGCWTCRSRKVKCDLGRPSCKRCERSGFEC 47
          R +T   C  C S K KCD  +PSC RC +    C
Sbjct: 19 RKRTPKSCIRCYSIKRKCDHKKPSCTRCFKKSLPC 53

>YOR337W (TEA1) [5116] chr15 (954339..956618) Ty1 enhancer activator
           of the Gal4p-type family of DNA-binding proteins [2280
           bp, 759 aa]
          Length = 759

 Score = 37.7 bits (86), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 17/37 (45%), Positives = 19/37 (51%), Gaps = 1/37 (2%)

Query: 19  GCWTCRSRKVKCDLGRPSCKRCERSGFECGGYDIKLR 55
            C  CR+R+ KCDLG P C  C R    C   D  LR
Sbjct: 69  ACTNCRNRRKKCDLGFP-CGNCSRLELVCNVNDEDLR 104

>Kwal_26.8109
          Length = 970

 Score = 37.7 bits (86), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 19/38 (50%), Gaps = 2/38 (5%)

Query: 12 RRAKTFTGCWTCRSRKVKCDLG--RPSCKRCERSGFEC 47
          RR+KT   C  CR +K +CD     P C  C+R    C
Sbjct: 31 RRSKTSRACDQCRGKKTRCDFSDENPVCTSCQRMSKTC 68

>ACR241C [1288] [Homologous to ScYKR064W - SH] (784358..786745)
          [2388 bp, 795 aa]
          Length = 795

 Score = 37.7 bits (86), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 15/35 (42%), Positives = 21/35 (60%), Gaps = 1/35 (2%)

Query: 10 KPRRAKTFTGCWTCRSRKVKCDLGRPSCKRCERSG 44
          K R+ +T   C  C+ RK +CD G+P+C  C R G
Sbjct: 5  KKRQRQTLV-CSNCKRRKSRCDRGKPACGNCIRLG 38

>Scas_699.7
          Length = 935

 Score = 37.7 bits (86), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 26/50 (52%), Gaps = 1/50 (2%)

Query: 8  IRKPRRAKTFTGCWTCRSRKVKCDLGRPSCKRCERSGFECGGYDIKLRWS 57
          +R P    +   C  CR +K+KC   +P C +C ++ +EC  Y  K R S
Sbjct: 1  MRYPFIPNSDQACDLCRVKKLKCSKEKPKCAKCLKNNWEC-CYSPKTRRS 49

>YOR172W (YRM1) [4969] chr15 (654210..656570) Protein with
          similarity to transcription factors, has Zn[2]-Cys[6]
          fungal-type binuclear cluster domain in the N-terminal
          region [2361 bp, 786 aa]
          Length = 786

 Score = 37.4 bits (85), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 22/41 (53%)

Query: 4  EKSDIRKPRRAKTFTGCWTCRSRKVKCDLGRPSCKRCERSG 44
          E++  +  +R K    C  CR RK++CD  +P C  C+  G
Sbjct: 15 EETVKKAQKRRKPIKSCAFCRKRKLRCDQQKPMCSTCKTRG 55

>Kwal_23.4754
          Length = 812

 Score = 37.4 bits (85), Expect = 0.059,   Method: Compositional matrix adjust.
 Identities = 18/42 (42%), Positives = 23/42 (54%), Gaps = 2/42 (4%)

Query: 6  SDIRKPRRAKTFTGCWTCRSRKVKCDLGRPSCKRCERSGFEC 47
          SD++  RR  T   C  CR +KVKCD G+  C  C    +EC
Sbjct: 2  SDLQNKRRRVT-RACDECRKKKVKCD-GQQPCIHCTVYSYEC 41

>YOR363C (PIP2) [5140] chr15 complement(1020218..1023208)
          Transcription factor required for induction of
          peroxisomal proteins in response to oleic acid [2991
          bp, 996 aa]
          Length = 996

 Score = 37.4 bits (85), Expect = 0.061,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 25/52 (48%), Gaps = 3/52 (5%)

Query: 8  IRKPRRAKTFTGCWTCRSRKVKCDLGRPSCKRCERSGFECGGYDIKLRWSKP 59
          + K R   +F  C  CR  K KCD  +P C RC +    C  YD+  R + P
Sbjct: 14 VGKKRNRLSFV-CQACRKAKTKCDQEKPRCGRCTKQNLFC-IYDVA-RQAAP 62

>KLLA0C14212g complement(1229219..1232341) some similarities with
           sp|P25611 Saccharomyces cerevisiae YCR106w, hypothetical
           start
          Length = 1040

 Score = 37.4 bits (85), Expect = 0.062,   Method: Compositional matrix adjust.
 Identities = 15/39 (38%), Positives = 20/39 (51%), Gaps = 1/39 (2%)

Query: 9   RKPRRAKTFTGCWTCRSRKVKCDLGRPSCKRCERSGFEC 47
           R  +R +    C+ CR RK +CD G P C +C     EC
Sbjct: 64  RVMKRNRVSYVCYACRRRKTRCDRGNP-CSKCVALSTEC 101

>KLLA0C04620g complement(422705..426514) weakly similar to
          sp|Q05854 Saccharomyces cerevisiae YLR278c, start by
          similarity
          Length = 1269

 Score = 37.4 bits (85), Expect = 0.064,   Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 20/38 (52%), Gaps = 5/38 (13%)

Query: 19 GCWTCRSRKVKCDLGRPSCKRCERSGFEC-----GGYD 51
           C  C+ RK KCD   PSC  C ++G +C      GYD
Sbjct: 40 ACLLCQRRKQKCDHKIPSCTACLKAGVKCIQPAKYGYD 77

>Kwal_27.10852
          Length = 1046

 Score = 37.4 bits (85), Expect = 0.064,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 20/48 (41%), Gaps = 3/48 (6%)

Query: 3   VEKSDIRKPRRAKTFTGCWTCRSRKVKCDLG---RPSCKRCERSGFEC 47
            E   +  P   +  T C  CR  K+KC+        C RCER G  C
Sbjct: 83  AESKAVSVPTGHRPVTSCTHCRQHKIKCNANDNFPAPCSRCERMGLHC 130

>YBL066C (SEF1) [131] chr2 complement(96906..100079) Protein with
          similarity to transcription factors, has Zn[2]-Cys[6]
          fungal-type binuclear cluster domain in the N-terminal
          region [3174 bp, 1057 aa]
          Length = 1057

 Score = 37.4 bits (85), Expect = 0.065,   Method: Compositional matrix adjust.
 Identities = 14/36 (38%), Positives = 18/36 (50%), Gaps = 3/36 (8%)

Query: 15 KTFTGCWTCRSRKVKCDLGR---PSCKRCERSGFEC 47
          +  T C  CR  K+KCD  +     C RCE+ G  C
Sbjct: 52 RPVTSCTHCRQHKIKCDASQNFPHPCSRCEKIGLHC 87

>YLL054C (YLL054C) [3369] chr12 complement(32894..35203) Protein
          with similarity to transcription factors, has
          Zn[2]-Cys[6] fungal-type binuclear cluster domain in
          the N-terminal region [2310 bp, 769 aa]
          Length = 769

 Score = 37.0 bits (84), Expect = 0.068,   Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 21/41 (51%)

Query: 8  IRKPRRAKTFTGCWTCRSRKVKCDLGRPSCKRCERSGFECG 48
          I   ++ K    C  C+ RK+KCD   P+C +C+ S   C 
Sbjct: 3  IASQKKVKPSFVCLRCKQRKIKCDKLWPTCSKCKASSSICS 43

>KLLA0E20405g <1805948..1809364 gi|3024604|sp|P87164|SEF1_KLULA
           Kluyveromyces lactis SUPPRESSOR PROTEIN SEF1, start by
           similarity
          Length = 1138

 Score = 37.0 bits (84), Expect = 0.071,   Method: Compositional matrix adjust.
 Identities = 14/36 (38%), Positives = 17/36 (47%), Gaps = 3/36 (8%)

Query: 15  KTFTGCWTCRSRKVKCDLGR---PSCKRCERSGFEC 47
           +  T C  CR  K+KC+        C RCER G  C
Sbjct: 132 RPVTSCTHCRQHKIKCNASEKFPAPCSRCERMGLHC 167

>CAGL0G08844g complement(846590..849133) similar to sp|P40467
          Saccharomyces cerevisiae YIL130w, hypothetical start
          Length = 847

 Score = 37.0 bits (84), Expect = 0.075,   Method: Compositional matrix adjust.
 Identities = 15/36 (41%), Positives = 19/36 (52%), Gaps = 1/36 (2%)

Query: 12 RRAKTFTGCWTCRSRKVKCDLGRPSCKRCERSGFEC 47
          +R K    C  CR +KVKCD  +P C  C    +EC
Sbjct: 12 KRRKVTRACDDCRKKKVKCDGNQP-CIHCTVYSYEC 46

>YHR056C (RSC30) [2344] chr8 complement(215184..217835) Component
          of the abundant RSC chromatin remodeling complex [2652
          bp, 883 aa]
          Length = 883

 Score = 37.0 bits (84), Expect = 0.082,   Method: Compositional matrix adjust.
 Identities = 14/42 (33%), Positives = 20/42 (47%), Gaps = 6/42 (14%)

Query: 1  MKVEKSDIRKPRRAKTFTGCWTCRSRKVKCDLGRPSCKRCER 42
          M ++   +RKP        C  CR RK+ CD  +P C  C +
Sbjct: 2  MDMQVRKVRKP------PACTQCRKRKIGCDRAKPICGNCVK 37

>CAGL0L03377g complement(382932..386561) some similarities with
          sp|P46954 Saccharomyces cerevisiae YJL089w SIP4
          interacts with SNF1 protein kinase, hypothetical start
          Length = 1209

 Score = 37.0 bits (84), Expect = 0.085,   Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 19/33 (57%), Gaps = 1/33 (3%)

Query: 19 GCWTCRSRKVKCDLGRPSCKRCERSGFECGGYD 51
           C  CRS+K+KCD  +P C  C + G+ C   D
Sbjct: 28 ACDRCRSKKIKCDGLQP-CSNCAKIGYNCVTSD 59

>Scas_588.11
          Length = 835

 Score = 36.6 bits (83), Expect = 0.086,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 26/51 (50%), Gaps = 2/51 (3%)

Query: 7  DIRKPRRAKTFTGCWTCRSRKVKCDLGRPSCKRCERSG-FECGGYDIKLRW 56
          DIR  R+ +    C  CR RK+ CD  +P C  C ++   +C   DI  R+
Sbjct: 2  DIRG-RKMRKPPACVQCRKRKIGCDRVKPICGNCRKTNKGDCFFPDIPGRY 51

>KLLA0D12650g complement(1073580..1075535) weakly similar to
          ca|CA2184|IPF6874.3 Candida albicans unknown function,
          3-prime end, hypothetical start
          Length = 651

 Score = 36.6 bits (83), Expect = 0.091,   Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 17/33 (51%)

Query: 19 GCWTCRSRKVKCDLGRPSCKRCERSGFECGGYD 51
          GC TCR R  KCD  +P C  C+ +   C   D
Sbjct: 31 GCLTCRDRHKKCDEKKPLCSGCKENFLRCVWRD 63

>KLLA0E18194g 1613115..1615712 similar to sp|P25502 Saccharomyces
          cerevisiae YKL015w PUT3 positive activator of the
          proline utilisation pathway, start by similarity
          Length = 865

 Score = 36.6 bits (83), Expect = 0.094,   Method: Compositional matrix adjust.
 Identities = 15/45 (33%), Positives = 24/45 (53%), Gaps = 1/45 (2%)

Query: 3  VEKSDIRKPRRAKTFTGCWTCRSRKVKCDLGRPSCKRCERSGFEC 47
          VE  + +K +  ++   C  CR R +KC  G P C +C ++G  C
Sbjct: 29 VELLNDKKKKVKRSSLACTRCRRRHIKCPGGNP-CSKCLKAGVAC 72

>KLLA0D09977g complement(841852..843756) weakly similar to
          sp|P40969 Saccharomyces cerevisiae YMR168c CEP3
          kinetochore protein complex, 71 KD subunit singleton,
          start by similarity
          Length = 634

 Score = 36.6 bits (83), Expect = 0.096,   Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 21/33 (63%), Gaps = 1/33 (3%)

Query: 20 CWTCRSRKVKCDLGRPSCKRC-ERSGFECGGYD 51
          C  C++RKVKCD   P+C+ C ER+  E   YD
Sbjct: 15 CTFCQARKVKCDRSLPACQNCIERNVTELCEYD 47

>Scas_234.1
          Length = 337

 Score = 36.2 bits (82), Expect = 0.097,   Method: Compositional matrix adjust.
 Identities = 15/33 (45%), Positives = 18/33 (54%), Gaps = 1/33 (3%)

Query: 12 RRAKTFTGCWTCRSRKVKCDLGRPSCKRCERSG 44
          +R +    C  C+ RK KCD GRP C  C R G
Sbjct: 25 KRNRPTVVCTNCKKRKSKCDRGRP-CSTCARLG 56

>ACR028C [1076] [Homologous to NOHBY] (408701..410506) [1806 bp,
          601 aa]
          Length = 601

 Score = 36.2 bits (82), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 12/40 (30%), Positives = 21/40 (52%)

Query: 8  IRKPRRAKTFTGCWTCRSRKVKCDLGRPSCKRCERSGFEC 47
          ++K +   +  GC  C+    KCD  +P+C +C +   EC
Sbjct: 9  MKKRKSPYSRKGCLQCKKSHTKCDETKPACLKCVKRNVEC 48

>YBL005W (PDR3) [189] chr2 (217435..220365) Zinc-finger
          transcription factor, in conjunction with Pdr1p
          regulates the expression of a network of genes involved
          in multiple drug resistance [2931 bp, 976 aa]
          Length = 976

 Score = 36.6 bits (83), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 19/33 (57%), Gaps = 1/33 (3%)

Query: 8  IRKPRRAKTFTGCWTCRSRKVKCDLGRPSCKRC 40
          ++K  R+K  T C  CR RK+KC  G+  C  C
Sbjct: 3  VKKSTRSKVSTACVNCRKRKIKCT-GKYPCTNC 34

>Scas_630.14
          Length = 701

 Score = 36.6 bits (83), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 22/47 (46%), Gaps = 2/47 (4%)

Query: 5  KSDIRKPRRAKTFTGCWTCRSRKVKCDLGRPSCKRCERSGFECGGYD 51
          K  IRK  R +    C  CR RK KCD  +P C  C   G +   YD
Sbjct: 13 KDGIRK--RNRVPKSCTVCRLRKSKCDRIKPYCSSCVLHGIKECRYD 57

>Scas_657.3
          Length = 856

 Score = 36.6 bits (83), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 13/24 (54%), Positives = 14/24 (58%)

Query: 17 FTGCWTCRSRKVKCDLGRPSCKRC 40
           T C  CR RK+KCD  RP C  C
Sbjct: 42 ITSCAFCRQRKLKCDQKRPICSTC 65

>KLLA0E02618g 244696..248025 no similarity, hypothetical start
          Length = 1109

 Score = 36.6 bits (83), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 21/49 (42%), Positives = 23/49 (46%), Gaps = 10/49 (20%)

Query: 7  DIRKPRRAKTFTGCWTCRSRKVKCD-------LGRPS-CKRCERSGFEC 47
          D RK + AK    C  CR RK+KCD        G P  C  C RS  EC
Sbjct: 16 DSRKRKVAKR--ACLACRERKIKCDGEANPDPSGGPGKCTNCVRSTLEC 62

>YKL038W (RGT1) [3220] chr11 (365248..368760) Protein involved in
          regulation of glucose transporters, acts as a
          transcriptional repressor that is converted to an
          activator upon glucose-induced phosphorylation [3513
          bp, 1170 aa]
          Length = 1170

 Score = 36.6 bits (83), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 15/46 (32%), Positives = 23/46 (50%), Gaps = 2/46 (4%)

Query: 12 RRAKTFTGCWTCRSRKVKCDLG--RPSCKRCERSGFECGGYDIKLR 55
          +R K    C  CR +K+KCD    +  C  C+R+G  C    + L+
Sbjct: 39 KRTKASRACDQCRKKKIKCDYKDEKGVCSNCQRNGDRCSFDRVPLK 84

>YKL222C (YKL222C) [3053] chr11 complement(3504..5621) Protein
          with similarity to transcription factors, has
          Zn[2]-Cys[6] fungal-type binuclear cluster domain in
          the N-terminal region [2118 bp, 705 aa]
          Length = 705

 Score = 36.2 bits (82), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 15/37 (40%), Positives = 19/37 (51%)

Query: 4  EKSDIRKPRRAKTFTGCWTCRSRKVKCDLGRPSCKRC 40
          +K  + +  R K    C  CR RK+KCD  RP C  C
Sbjct: 8  QKKKLDRQSRRKPAKSCHFCRVRKLKCDRVRPFCGSC 44

>Scas_449.1
          Length = 636

 Score = 36.2 bits (82), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 17/45 (37%), Positives = 22/45 (48%), Gaps = 3/45 (6%)

Query: 11 PRRAKTFTGCWTCRSRKVKCDLGRPSCKRCERSGFECGGYDIKLR 55
          P+R +    C  CR R+ KCDL  P C  C R G  C   +  +R
Sbjct: 30 PKRKRL--ACSNCRRRRKKCDLNFP-CANCIRLGLNCNVNEEDMR 71

>YDR303C (RSC3) [1131] chr4 complement(1068721..1071378) Component
          of the abundant RSC chromatin remodeling complex [2658
          bp, 885 aa]
          Length = 885

 Score = 36.2 bits (82), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 24/47 (51%), Gaps = 2/47 (4%)

Query: 7  DIRKPRRAKTFTGCWTCRSRKVKCDLGRPSCKRC-ERSGFECGGYDI 52
          DIR  R+ K    C  CR RK+ CD  +P C  C + +  +C   D+
Sbjct: 2  DIRG-RKMKKPPACVQCRKRKIGCDRVKPICGNCMKHNKMDCFYPDV 47

>Sklu_2268.2 YKR064W, Contig c2268 4260-6887 reverse complement
          Length = 875

 Score = 36.2 bits (82), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 15/35 (42%), Positives = 19/35 (54%)

Query: 12 RRAKTFTGCWTCRSRKVKCDLGRPSCKRCERSGFE 46
          RR +    C  C+ RK KCD  +P+C  C R G E
Sbjct: 5  RRNRPTVVCSNCKRRKSKCDKQKPACSNCVRLGDE 39

>Kwal_33.13934
          Length = 797

 Score = 36.2 bits (82), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 14/40 (35%), Positives = 22/40 (55%)

Query: 5  KSDIRKPRRAKTFTGCWTCRSRKVKCDLGRPSCKRCERSG 44
          ++++R  +R +    C  C+ RK KCD  +P C  C R G
Sbjct: 8  ENELRTKKRRRPTVVCTNCKRRKSKCDRLKPICGNCSRLG 47

>Scas_662.8
          Length = 906

 Score = 36.2 bits (82), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 14/36 (38%), Positives = 19/36 (52%), Gaps = 1/36 (2%)

Query: 12 RRAKTFTGCWTCRSRKVKCDLGRPSCKRCERSGFEC 47
          +R +    C  CR +KVKCD G+  C  C    +EC
Sbjct: 29 KRRRVTRACDECRKKKVKCD-GQQPCIHCTVYSYEC 63

>Scas_709.51
          Length = 759

 Score = 36.2 bits (82), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 15/39 (38%), Positives = 21/39 (53%), Gaps = 1/39 (2%)

Query: 9  RKPRRAKTFTGCWTCRSRKVKCDLGRPSCKRCERSGFEC 47
          RK +R +    C  C+ RKVKCD  +P C  C +   +C
Sbjct: 23 RKKQRIRVQRACNICKRRKVKCDGNKP-CLNCIKKEIDC 60

>CAGL0I07755g complement(745315..748476) similar to tr|Q12180
           Saccharomyces cerevisiae YOL089c HAL9, hypothetical
           start
          Length = 1053

 Score = 36.2 bits (82), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 16/42 (38%), Positives = 21/42 (50%), Gaps = 5/42 (11%)

Query: 9   RKPRRAKTFTGCWTCRSRKVKCDLGRP---SCKRCERSGFEC 47
           ++ RRA     C  CR RK KCD   P    C  C ++G +C
Sbjct: 169 KEKRRAAK--ACEYCRKRKTKCDEVSPYTNKCSNCSKAGVDC 208

>CAGL0L04576g 526960..529557 similar to tr|Q12340 Saccharomyces
          cerevisiae YOR172w, hypothetical start
          Length = 865

 Score = 36.2 bits (82), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 14/32 (43%), Positives = 16/32 (50%)

Query: 20 CWTCRSRKVKCDLGRPSCKRCERSGFECGGYD 51
          C  CR RK+KCD  RP C  C    F    Y+
Sbjct: 40 CAFCRRRKLKCDNARPMCSTCVSRKFSTCIYE 71

>YIL130W (YIL130W) [2546] chr9 (102782..105676) Protein that
          contains a Zn[2]-Cys[6] fungal-type binuclear cluster
          domain in the N-terminal region, putative transcription
          factor [2895 bp, 964 aa]
          Length = 964

 Score = 36.2 bits (82), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 23/50 (46%), Gaps = 8/50 (16%)

Query: 12 RRAKTFTGCWTCRSRKVKCDLGRPSCKRCERSGFECGGYDIKLRWSKPIK 61
          +R +    C  CR +KVKCD G+  C  C    +EC        + KP K
Sbjct: 13 KRRRVTRACDECRKKKVKCD-GQQPCIHCTVYSYECT-------YKKPTK 54

>CAGL0L01903g 218703..222566 similar to sp|P32862 Saccharomyces
          cerevisiae YKL038w RGT1, hypothetical start
          Length = 1287

 Score = 36.2 bits (82), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 14/38 (36%), Positives = 19/38 (50%), Gaps = 2/38 (5%)

Query: 12 RRAKTFTGCWTCRSRKVKCDLG--RPSCKRCERSGFEC 47
          +R      C  CR +K+KCD    R  C  C+R+G  C
Sbjct: 8  KRTNVSRACDQCRRKKIKCDRNQERNICTSCQRNGERC 45

>Scas_720.58
          Length = 890

 Score = 36.2 bits (82), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 11/29 (37%), Positives = 17/29 (58%)

Query: 19 GCWTCRSRKVKCDLGRPSCKRCERSGFEC 47
           C  CR +K+KC    P C +C ++G +C
Sbjct: 19 ACDNCRLKKLKCSKETPKCSKCLKNGMKC 47

>KLLA0F04609g complement(451579..454329) similar to sp|P40467
          Saccharomyces cerevisiae YIL130w, start by similarity
          Length = 916

 Score = 36.2 bits (82), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 14/36 (38%), Positives = 19/36 (52%), Gaps = 1/36 (2%)

Query: 12 RRAKTFTGCWTCRSRKVKCDLGRPSCKRCERSGFEC 47
          +R +    C  CR +KVKCD G+  C  C    +EC
Sbjct: 6  KRRRVTRACDECRKKKVKCD-GKQPCIHCTVYNYEC 40

>Scas_711.31
          Length = 932

 Score = 36.2 bits (82), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 16/29 (55%)

Query: 19 GCWTCRSRKVKCDLGRPSCKRCERSGFEC 47
           C  CR +K+KCD   P C  C ++G  C
Sbjct: 44 ACDRCRLKKIKCDDRTPDCTPCMKAGIPC 72

>CAGL0G09757g 930351..934622 some similarities with sp|Q05854
          Saccharomyces cerevisiae YLR278c, hypothetical start
          Length = 1423

 Score = 36.2 bits (82), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 12/28 (42%), Positives = 16/28 (57%)

Query: 20 CWTCRSRKVKCDLGRPSCKRCERSGFEC 47
          C  CR RK +CD   PSC  C ++  +C
Sbjct: 41 CLLCRRRKQRCDHKLPSCTACLKAAVKC 68

>YPL248C (GAL4) [5202] chr16 complement(79711..82356)
          Transcription factor involved in expression of
          galactose-induced genes, phosphorylation correlates
          with activity [2646 bp, 881 aa]
          Length = 881

 Score = 35.8 bits (81), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 11/29 (37%), Positives = 18/29 (62%)

Query: 19 GCWTCRSRKVKCDLGRPSCKRCERSGFEC 47
           C  CR +K+KC   +P C +C ++ +EC
Sbjct: 10 ACDICRLKKLKCSKEKPKCAKCLKNNWEC 38

>KLLA0C03201g complement(286973..288925) similar to sp|P39529
          Saccharomyces cerevisiae YJL206c, start by similarity
          Length = 650

 Score = 35.8 bits (81), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 14/38 (36%), Positives = 21/38 (55%), Gaps = 1/38 (2%)

Query: 10 KPRRAKTFTGCWTCRSRKVKCDLGRPSCKRCERSGFEC 47
          +P R K    C +C+ RKV+CD G+  C  C  +  +C
Sbjct: 26 EPVRHKVKHACSSCKERKVRCD-GQSPCASCINARVKC 62

>YKL015W (PUT3) [3241] chr11 (408187..411126) Transcription factor
          that activates the proline utilization pathway genes,
          contains a Zn[2]-Cys[6] fungal-type binuclear cluster
          domain in the N-terminal region [2940 bp, 979 aa]
          Length = 979

 Score = 35.8 bits (81), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 13/38 (34%), Positives = 21/38 (55%), Gaps = 1/38 (2%)

Query: 10 KPRRAKTFTGCWTCRSRKVKCDLGRPSCKRCERSGFEC 47
          + R+ ++   C +CR R +KC  G P C++C  S   C
Sbjct: 24 QKRQQRSSVACLSCRKRHIKCPGGNP-CQKCVTSNAIC 60

>YPR196W (YPR196W) [5609] chr16 (931370..932782) Positive
          regulator of the maltose pathway MAL genes, contains a
          Zn[2]-Cys[6] fungal-type binuclear cluster domain in
          the N-terminal region [1413 bp, 470 aa]
          Length = 470

 Score = 35.4 bits (80), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 14/29 (48%), Positives = 16/29 (55%), Gaps = 1/29 (3%)

Query: 19 GCWTCRSRKVKCDLGRPSCKRCERSGFEC 47
           C  CR R+VKCD  RP C RC +    C
Sbjct: 7  SCDCCRVRRVKCDRNRP-CDRCRQRNLRC 34

>Scas_526.3
          Length = 1109

 Score = 35.8 bits (81), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 16/29 (55%)

Query: 19 GCWTCRSRKVKCDLGRPSCKRCERSGFEC 47
           C  CR RK +CD   PSC  C ++  +C
Sbjct: 40 SCLLCRRRKQRCDHKMPSCTACLKAAVKC 68

>Scas_715.3
          Length = 1115

 Score = 35.8 bits (81), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 12/36 (33%), Positives = 19/36 (52%), Gaps = 3/36 (8%)

Query: 15  KTFTGCWTCRSRKVKCDLGR---PSCKRCERSGFEC 47
           +  T C  CR +K+KCD  +     C RC++   +C
Sbjct: 101 RPVTSCSHCRQQKIKCDASQNFPAPCSRCQKMALQC 136

>Scas_542.8
          Length = 902

 Score = 35.4 bits (80), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 16/45 (35%), Positives = 21/45 (46%), Gaps = 5/45 (11%)

Query: 3  VEKSDIRKPRRAKTFTGCWTCRSRKVKCDLGRPSCKRCERSGFEC 47
           E S  R+P+       C  CR R +KC  G P C RC +   +C
Sbjct: 16 TEPSSKRRPKSL----ACILCRKRHIKCSGGNP-CARCIKHDLKC 55

>Kwal_14.819
          Length = 568

 Score = 35.4 bits (80), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 13/32 (40%), Positives = 16/32 (50%)

Query: 16 TFTGCWTCRSRKVKCDLGRPSCKRCERSGFEC 47
          +   C  CR RKV+C    P CK C +   EC
Sbjct: 12 SIISCRQCRDRKVRCSRQIPKCKSCTKRNCEC 43

>Sklu_2207.4 YJL103C, Contig c2207 6715-8313 reverse complement
          Length = 532

 Score = 35.4 bits (80), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 26/49 (53%), Gaps = 7/49 (14%)

Query: 1  MKVEKSDIRKPRRAKTFTGCWTCRSRKVKCDLGRPSCKRCERS--GFEC 47
          + VE+   RKP +      C  C  + ++CD+GRP C+ C R   G EC
Sbjct: 5  LSVEEKQTRKPIQK----ACVFCHEKHLQCDVGRP-CQNCLRRNIGHEC 48

>KLLA0F13904g complement(1287758..1289497) some similarities with
          sp|P42950 Saccharomyces cerevisiae YJL103c,
          hypothetical start
          Length = 579

 Score = 35.4 bits (80), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 25/54 (46%), Gaps = 3/54 (5%)

Query: 13 RAKTFTGCWTCRSRKVKCDLGRPSCKRCERSGF--ECGGYDIKLRWSKPIKFDR 64
          R    T C  C  + ++CDLGRP C+ C + G    C   + K R   P K  +
Sbjct: 13 RKPIPTACVFCHEKHLQCDLGRP-CQNCSKRGIGDTCRDKERKPRKRGPRKVKK 65

>Sklu_1993.2 YIL130W, Contig c1993 2139-4610 reverse complement
          Length = 823

 Score = 35.4 bits (80), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 14/36 (38%), Positives = 19/36 (52%), Gaps = 1/36 (2%)

Query: 12 RRAKTFTGCWTCRSRKVKCDLGRPSCKRCERSGFEC 47
          +R +    C  CR +KVKCD G+  C  C    +EC
Sbjct: 7  KRRRVTRACDECRKKKVKCD-GQQPCIHCTVYSYEC 41

>Sklu_2023.3 YHR178W, Contig c2023 2677-4653 reverse complement
          Length = 658

 Score = 35.4 bits (80), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 13/29 (44%), Positives = 16/29 (55%)

Query: 19 GCWTCRSRKVKCDLGRPSCKRCERSGFEC 47
           C  CR  K KC    P+C+ C R+G EC
Sbjct: 23 SCSRCRRLKKKCSKELPACRNCSRAGEEC 51

>KLLA0F25630g 2378464..2381487 some similarities with sp|P32862
           Saccharomyces cerevisiae YKL038w RGT1 regulator of
           glucose-induced genes, hypothetical start
          Length = 1007

 Score = 35.0 bits (79), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 19/64 (29%), Positives = 26/64 (40%), Gaps = 7/64 (10%)

Query: 12  RRAKTFTGCWTCRSRKVKCDL-------GRPSCKRCERSGFECGGYDIKLRWSKPIKFDR 64
           RR+K    C  CR +K+KCD           SC  C + G +C    I L+      + R
Sbjct: 109 RRSKVSRACDQCRKKKIKCDFIEGHDINPDQSCTGCRKIGEKCSFERIPLKRGPSKGYTR 168

Query: 65  YGVQ 68
              Q
Sbjct: 169 SNSQ 172

>Kwal_47.17506
          Length = 924

 Score = 35.0 bits (79), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 15/40 (37%), Positives = 21/40 (52%), Gaps = 1/40 (2%)

Query: 8  IRKPRRAKTFTGCWTCRSRKVKCDLGRPSCKRCERSGFEC 47
          + K +R+K    C  CR RK+KC   +P C  C+    EC
Sbjct: 7  VVKKKRSKVSRACNNCRRRKIKCTGAQP-CLNCQTYRCEC 45

>YOR162C (YRR1) [4961] chr15 complement(639560..641992)
          Transcription factor involved in drug-induced
          transcriptional regulation, including activation of
          multidrug transporter gene SNQ2, has a Zn[2]-Cys[6]
          fungal-type binuclear cluster domain [2433 bp, 810 aa]
          Length = 810

 Score = 35.0 bits (79), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 16/29 (55%)

Query: 12 RRAKTFTGCWTCRSRKVKCDLGRPSCKRC 40
          +R K    C  CR RK++CD  +P C  C
Sbjct: 46 KRNKLIKSCGFCRRRKLRCDQQKPMCSTC 74

>AGL361C [3951] [Homologous to NOHBY] (24101..26191) [2091 bp, 696
          aa]
          Length = 696

 Score = 35.0 bits (79), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 12/39 (30%), Positives = 19/39 (48%)

Query: 9  RKPRRAKTFTGCWTCRSRKVKCDLGRPSCKRCERSGFEC 47
          +KP+   +  GC  C+   +KCD  +P C  C +    C
Sbjct: 50 KKPKVQYSRKGCSQCKKSHIKCDKVQPLCTTCAKKNILC 88

>Kwal_33.13118
          Length = 779

 Score = 35.0 bits (79), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 16/44 (36%), Positives = 21/44 (47%), Gaps = 6/44 (13%)

Query: 9  RKPRRAKTFTGCWTCRSRKVKCD----LGRPSCKRCERSGFECG 48
          RKPR+ +    C  CR  K +CD    +GR  C RC     +C 
Sbjct: 46 RKPRKKRKTYSCEVCRKFKTRCDFEPLVGR--CHRCSVLKLQCS 87

>KLLA0D15356g 1301848..1303722 no similarity, hypothetical start
          Length = 624

 Score = 35.0 bits (79), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 26/53 (49%), Gaps = 6/53 (11%)

Query: 1  MKVEKSDIRKPRRAK----TFTGCWTCRSRKVKC--DLGRPSCKRCERSGFEC 47
          M +E  D R  +RA+    T T C +C   K KC  +  R  C+ CE  G EC
Sbjct: 17 MIIEFGDGRGKKRARASGRTPTSCRSCAKSKKKCTRESDRGPCQLCENRGIEC 69

>Kwal_26.7448
          Length = 714

 Score = 34.7 bits (78), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 14/39 (35%), Positives = 20/39 (51%)

Query: 3   VEKSDIRKPRRAKTFTGCWTCRSRKVKCDLGRPSCKRCE 41
           V K  I + R   +  GC  C+ R++KCD   P C  C+
Sbjct: 78  VLKKRITRRRHRNSRLGCDECKRRRIKCDETLPECNNCK 116

>Kwal_14.1636
          Length = 456

 Score = 34.7 bits (78), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 16/40 (40%), Positives = 17/40 (42%), Gaps = 1/40 (2%)

Query: 12 RRAKTFTGCWTCRSRKVKCDLGRPSCKRCERSGFECGGYD 51
          RR KT   C  C    V C   RP C RC + G E    D
Sbjct: 4  RRQKTSVACINCSKSHVTCQAERP-CTRCVKKGLEASCVD 42

>Sklu_2384.6 YKL015W, Contig c2384 10929-13424
          Length = 831

 Score = 34.7 bits (78), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 16/44 (36%), Positives = 22/44 (50%), Gaps = 2/44 (4%)

Query: 4  EKSDIRKPRRAKTFTGCWTCRSRKVKCDLGRPSCKRCERSGFEC 47
          E   +RK R+ ++   C  CR R VKC  G P C +C  +   C
Sbjct: 33 EGGQLRK-RQKRSSMACVRCRRRHVKCPGGNP-CSKCIAANIAC 74

>YOR380W (RDR1) [5153] chr15 (1051286..1052926) Protein with
          similarity to transcription factors, has Zn[2]-Cys[6]
          fungal-type binuclear cluster domain in the N-terminal
          region [1641 bp, 546 aa]
          Length = 546

 Score = 34.7 bits (78), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 15/48 (31%), Positives = 24/48 (50%), Gaps = 1/48 (2%)

Query: 12 RRAKTFTGCWTCRSRKVKCDLGRPSCKRCERSGFECGGYDIKLRWSKP 59
          +R +    C  CR RK KC+ G+  C+ C   G+ C   D ++  + P
Sbjct: 12 KRQRVRKACVPCRERKRKCN-GKSPCEMCVAYGYVCHYIDGRVPSASP 58

>YKR064W (YKR064W) [3315] chr11 (562189..564780) Protein with
          similarity to transcription factors, has Zn[2]-Cys[6]
          fungal-type binuclear cluster domain in the N-terminal
          region [2592 bp, 863 aa]
          Length = 863

 Score = 34.7 bits (78), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 15/39 (38%), Positives = 20/39 (51%), Gaps = 1/39 (2%)

Query: 6  SDIRKPRRAKTFTGCWTCRSRKVKCDLGRPSCKRCERSG 44
          S +R  +R +    C  C+ RK KCD  +P C  C R G
Sbjct: 5  SQVRTKKRHRITVVCTNCKKRKSKCDRTKP-CGTCVRLG 42

>AGR280C [4591] [Homologous to ScYLR278C - SH] (1266918..1270238)
          [3321 bp, 1106 aa]
          Length = 1106

 Score = 34.3 bits (77), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 12/28 (42%), Positives = 16/28 (57%)

Query: 20 CWTCRSRKVKCDLGRPSCKRCERSGFEC 47
          C  C+ RK +CD   PSC  C ++G  C
Sbjct: 41 CLLCQRRKQRCDHKIPSCTACLKAGVRC 68

>YNR063W (YNR063W) [4646] chr14 (746940..748763) Protein with
          similarity to transcription factors, has Zn[2]-Cys[6]
          fungal-type binuclear cluster domain in the N-terminal
          region [1824 bp, 607 aa]
          Length = 607

 Score = 33.9 bits (76), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 14/34 (41%), Positives = 18/34 (52%), Gaps = 1/34 (2%)

Query: 9  RKPRRAKTFTGCWTCRSRKVKCDLGRPSCKRCER 42
          +  R+      C  CR RK+KCD  +P C RC R
Sbjct: 5  KDARKRSISLACTVCRKRKLKCDGNKP-CGRCIR 37

>KLLA0C19228g 1713787..1715562 similar to sp|P53749 Saccharomyces
          cerevisiae YNR063w singleton, hypothetical start
          Length = 591

 Score = 33.9 bits (76), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 17/29 (58%), Gaps = 1/29 (3%)

Query: 19 GCWTCRSRKVKCDLGRPSCKRCERSGFEC 47
           C  C+ RK KCD G+  C+RC +   +C
Sbjct: 2  ACLECKKRKQKCD-GQKPCRRCTKLNVKC 29

>Sklu_2411.11 YMR019W, Contig c2411 20506-22569 reverse complement
          Length = 687

 Score = 33.9 bits (76), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 12/36 (33%), Positives = 19/36 (52%), Gaps = 1/36 (2%)

Query: 12 RRAKTFTGCWTCRSRKVKCDLGRPSCKRCERSGFEC 47
          +R +    C  C+ RK+KCD G   C  C ++  +C
Sbjct: 20 QRLRVRKACEICKKRKIKCD-GHQPCTSCTKNSVQC 54

>Scas_669.8
          Length = 637

 Score = 33.5 bits (75), Expect = 0.74,   Method: Compositional matrix adjust.
 Identities = 16/35 (45%), Positives = 18/35 (51%), Gaps = 1/35 (2%)

Query: 12 RRAKTFTGCWTCRSRKVKCDLGRPSCKRCERSGFE 46
           R KT   C  C+ RKVKCD   P C  C + G E
Sbjct: 8  ERRKTPYACNVCKKRKVKCDKLIP-CTSCIQKGLE 41

>YMR019W (STB4) [3983] chr13 (312155..315004) Sin3p-binding protein,
           contains a Zn[2]-Cys[6] fungal-type binuclear cluster
           domain in the N-terminal region [2850 bp, 949 aa]
          Length = 949

 Score = 33.9 bits (76), Expect = 0.77,   Method: Compositional matrix adjust.
 Identities = 17/41 (41%), Positives = 20/41 (48%), Gaps = 2/41 (4%)

Query: 13  RAKTFTGCWTCRSRKVKCDLGRPSCKRCERSGFECGGYDIK 53
           R +    C  C+ RKVKCD   P C  C +   EC  YD K
Sbjct: 80  RLRVQKACELCKKRKVKCDGNNP-CLNCSKHQKEC-RYDFK 118

>Kwal_23.3514
          Length = 579

 Score = 33.5 bits (75), Expect = 0.83,   Method: Compositional matrix adjust.
 Identities = 15/31 (48%), Positives = 17/31 (54%), Gaps = 1/31 (3%)

Query: 14 AKTFTGCWTCRSRKVKCDLGRPSCKRCERSG 44
          +KT T C  C  RKVKCD   P C  C + G
Sbjct: 6  SKTRTPCVVCTKRKVKCDRNIP-CSNCVKRG 35

>AER370W [2871] [Homologous to ScYIL130W (GIN1) - SH]
          complement(1320487..1322892) [2406 bp, 801 aa]
          Length = 801

 Score = 33.5 bits (75), Expect = 0.85,   Method: Compositional matrix adjust.
 Identities = 14/36 (38%), Positives = 18/36 (50%), Gaps = 1/36 (2%)

Query: 12 RRAKTFTGCWTCRSRKVKCDLGRPSCKRCERSGFEC 47
          +R +    C  CR +KVKCD   P C  C    +EC
Sbjct: 10 KRRRVTRACDECRKKKVKCDSRHP-CIHCTVYSYEC 44

>Kwal_26.6664
          Length = 579

 Score = 33.5 bits (75), Expect = 0.88,   Method: Compositional matrix adjust.
 Identities = 15/43 (34%), Positives = 21/43 (48%), Gaps = 1/43 (2%)

Query: 13 RAKTFTGCWTCRSRKVKCDLGRPSCKRCERSGFECGGYDIKLR 55
          R +    C  C + K KC+  +P C RC R   +C  Y  +LR
Sbjct: 8  RNRPVKACIKCYNGKRKCNKAKPVCGRCARLHLQC-LYSAELR 49

>Kwal_47.18089
          Length = 745

 Score = 33.5 bits (75), Expect = 0.88,   Method: Compositional matrix adjust.
 Identities = 12/22 (54%), Positives = 13/22 (59%)

Query: 19 GCWTCRSRKVKCDLGRPSCKRC 40
           C  CR RK+KCD  RP C  C
Sbjct: 28 SCTFCRHRKLKCDHKRPMCGSC 49

>Scas_605.9
          Length = 418

 Score = 33.1 bits (74), Expect = 0.96,   Method: Compositional matrix adjust.
 Identities = 14/23 (60%), Positives = 16/23 (69%)

Query: 42 RSGFECGGYDIKLRWSKPIKFDR 64
          RSG + GGY I+    KPIKFDR
Sbjct: 18 RSGVKTGGYQIRSSRDKPIKFDR 40

>AFL160C [3035] [Homologous to ScYPL248C (GAL4) - SH]
          (130842..132788) [1947 bp, 648 aa]
          Length = 648

 Score = 33.1 bits (74), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 16/45 (35%), Positives = 20/45 (44%), Gaps = 1/45 (2%)

Query: 13 RAKTFTGCWTCRSRKVKCDLGRPSCKRCERSGFECGGYDIKLRWS 57
          R      C +CR RK+KC    P C +C      C  Y  K+R S
Sbjct: 2  RPPVIQACDSCRRRKMKCSKTFPKCAKCREDNRVC-LYSPKIRRS 45

>KLLA0C01023g 76863..78773 similar to sgd|S0002928 Saccharomyces
          cerevisiae YDR520c, hypothetical start
          Length = 636

 Score = 33.1 bits (74), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 21/48 (43%), Gaps = 4/48 (8%)

Query: 4  EKSDIRKPRRAKTFTGCWTCRSRKVKCDLGRPS---CKRCERSGFECG 48
          EK    +PR+ +    C  CR  K +CD   PS   C RC     +C 
Sbjct: 5  EKQTTIRPRKKRKTYSCELCRKFKTRCDF-EPSEGKCYRCRMLNLDCS 51

>CAGL0I03784g complement(325276..326088) similar to sp|Q07560
           Saccharomyces cerevisiae YDL142c PGS1 cardiolipin
           synthase, hypothetical start
          Length = 270

 Score = 32.7 bits (73), Expect = 1.1,   Method: Composition-based stats.
 Identities = 30/117 (25%), Positives = 44/117 (37%), Gaps = 12/117 (10%)

Query: 684 KYAKLCTEFEKRLLNWKSEWDFYKPHTREFVNDTIEGVYHHTMSFYYSLIIYYFTMARDL 743
           +YA L  ++    + WKS WDF+K  +      TI          Y  L ++        
Sbjct: 159 RYASLKQKYH--FVTWKSFWDFFKYPSAVVKPLTISKWNTFLQMIYLGLAVFIM------ 210

Query: 744 NNQLLQSYVEKVLSHLNQLSDLIDHKNVKVVPLIWQGFIAGCSSVDSNLQLSFKKWA 800
              +L  Y  KV     Q    +D   +K     W G+I G ++V S     F K A
Sbjct: 211 ---ILDQYDTKVQEANEQKDTTLDINTLK-TGFSWLGYIVGATTVISGTSYVFSKSA 263

>YJL103C (YJL103C) [2812] chr10 complement(228942..230798) Protein
          with similarity to transcription factors, contains a
          Zn[2]-Cys[6] fungal-type binuclear cluster domain in
          the N-terminal region [1857 bp, 618 aa]
          Length = 618

 Score = 33.1 bits (74), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 12/35 (34%), Positives = 24/35 (68%), Gaps = 2/35 (5%)

Query: 6  SDIRKPRRAKTFTGCWTCRSRKVKCDLGRPSCKRC 40
          S++++ R++   T C  C ++ ++CD+GRP C+ C
Sbjct: 7  SELKQTRKSIQ-TACEFCHTKHIQCDVGRP-CQNC 39

>Scas_638.14
          Length = 1043

 Score = 33.1 bits (74), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 16/40 (40%), Positives = 21/40 (52%), Gaps = 4/40 (10%)

Query: 8  IRKPRRAKTFTGCWTCRSRKVKCDLGRPSCKRCERSGFEC 47
          +RKP   K    C  CR RK+KC  G+  C  CE   ++C
Sbjct: 37 VRKPTN-KVSKACDNCRKRKIKCT-GKQPCATCE--AYQC 72

>CAGL0F02519g 245120..247618 weakly similar to sp|P39529
          Saccharomyces cerevisiae YJL206c, hypothetical start
          Length = 832

 Score = 33.1 bits (74), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 12/36 (33%), Positives = 18/36 (50%), Gaps = 1/36 (2%)

Query: 12 RRAKTFTGCWTCRSRKVKCDLGRPSCKRCERSGFEC 47
          R  +    C  C+ RK KC  G P C+ C ++  +C
Sbjct: 28 RTQRLSRACDLCKKRKTKCQGGNP-CQSCRKANIQC 62

>Sklu_2311.5 YLL040C, Contig c2311 5178-14663 reverse complement
          Length = 3161

 Score = 33.1 bits (74), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 37/134 (27%), Positives = 60/134 (44%), Gaps = 12/134 (8%)

Query: 594 FKESLNQKDGKIRIEFVKQPQSSS-------SGSTPIFTNITSETYYYPKMSTTTQDILS 646
           FKES+  K+G    +F+ +P S S       +GST    ++ ++  ++ +      D   
Sbjct: 287 FKESIADKNGVPDHQFLLRPVSGSGRLTLNKTGSTNTQPHVDAQ-LFFEEFGFDLDDCQY 345

Query: 647 TDALYGLPNSLILCFSDCVRLVRHREYYKMNKLPAP-RKYAKLCTEFEKRLLNWKSEWDF 705
            D LY +  S +  +   ++  R R  Y +N+ P    +YA  C   E    N+K  WDF
Sbjct: 346 KDILYTV--SKLHWYQKTLKYKRLRPEYSVNQNPKGWFEYAARCVLQEIHDKNYKWSWDF 403

Query: 706 YKPHTREFVNDTIE 719
            K   RE  N  +E
Sbjct: 404 IKAK-REKRNKYVE 416

>KLLA0F10417g 961004..962527 similar to sp|P38140 Saccharomyces
          cerevisiae YBR239c, start by similarity
          Length = 507

 Score = 32.7 bits (73), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 15/35 (42%), Positives = 15/35 (42%), Gaps = 1/35 (2%)

Query: 12 RRAKTFTGCWTCRSRKVKCDLGRPSCKRCERSGFE 46
          R  K    C  C    V CD  RP C RC R G E
Sbjct: 5  RNKKVSVACVHCAKSHVTCDDNRP-CTRCIRKGLE 38

>YHR178W (STB5) [2464] chr8 (459297..461528) Probable
          transcriptional activator of multidrug resistance genes
          such as PDR5 and SNQ2 [2232 bp, 743 aa]
          Length = 743

 Score = 32.7 bits (73), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 12/38 (31%), Positives = 18/38 (47%)

Query: 10 KPRRAKTFTGCWTCRSRKVKCDLGRPSCKRCERSGFEC 47
          + +R      C  CR  K KC    P+C  C+++G  C
Sbjct: 12 RSQRTTELYSCARCRKLKKKCGKQIPTCANCDKNGAHC 49

>YDR520C (YDR520C) [1333] chr4 complement(1481073..1483391) Protein
           containing a fungal Zn(2)-Cys(6) binuclear cluster
           domain, which act as transcriptional regulators [2319
           bp, 772 aa]
          Length = 772

 Score = 32.7 bits (73), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 15/44 (34%), Positives = 22/44 (50%), Gaps = 6/44 (13%)

Query: 9   RKPRRAKTFTGCWTCRSRKVKCD----LGRPSCKRCERSGFECG 48
           +KPR+ +    C TCR  K +CD    +G+  C RC     +C 
Sbjct: 61  KKPRKKRKTFSCDTCRRVKTRCDFEPFIGK--CYRCNVLQLDCS 102

>YGR288W (MAL13) [2233] chr7 (1070298..1071719) Maltose pathway
          regulatory protein, contains a Zn[2]-Cys[6] fungal-type
          binuclear cluster domain [1422 bp, 473 aa]
          Length = 473

 Score = 32.3 bits (72), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 24/51 (47%), Gaps = 10/51 (19%)

Query: 19 GCWTCRSRKVKCDLGRPSCKRCERSGFEC---------GGYDIKLRWSKPI 60
           C  CR R+VKCD  RP C  C ++  +C         G   I+LR  K I
Sbjct: 12 ACDCCRIRRVKCDGKRP-CSSCLQNSLDCTYLQPSRKRGPKSIRLRSLKRI 61

>CAGL0F07755g complement(755947..757782) similar to sp|P40969
          Saccharomyces cerevisiae YMR168c CEP3 kinetochore
          protein complex, start by similarity
          Length = 611

 Score = 32.3 bits (72), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 19/38 (50%), Gaps = 1/38 (2%)

Query: 9  RKPRRAKTFTGCWTCRSRKVKCDLGRPSCKRCERSGFE 46
          ++P   K+   C  C  RKVKCD   P C  C + G E
Sbjct: 3  QRPLPTKSNRPCSVCSKRKVKCDRLVP-CGHCRKRGTE 39

>Scas_702.7d
          Length = 978

 Score = 32.3 bits (72), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 14/38 (36%), Positives = 20/38 (52%), Gaps = 1/38 (2%)

Query: 10 KPRRAKTFTGCWTCRSRKVKCDLGRPSCKRCERSGFEC 47
          K ++ ++   C  CR RK+KC   +P C  CE  G  C
Sbjct: 8  KIKKLRSSRACSNCRRRKIKCSGIQP-CPNCEIYGCLC 44

>Kwal_47.16939
          Length = 669

 Score = 32.3 bits (72), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 13/33 (39%), Positives = 17/33 (51%), Gaps = 1/33 (3%)

Query: 20 CWTCRSRKVKCD-LGRPSCKRCERSGFECGGYD 51
          C  C+  KVKC+ L    C+RC R   +C   D
Sbjct: 13 CSNCKKNKVKCEYLSSLPCQRCARHSLKCYYLD 45

>CAGL0H00396g complement(37005..39827) similar to sp|P08638
          Saccharomyces cerevisiae YLR451w LEU3 transcription
          factor, hypothetical start
          Length = 940

 Score = 32.3 bits (72), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 12/32 (37%), Positives = 15/32 (46%), Gaps = 3/32 (9%)

Query: 19 GCWTCRSRKVKCDL---GRPSCKRCERSGFEC 47
           C  CR +K KCD        C RC++ G  C
Sbjct: 57 ACVECRQQKSKCDAHDKAPEPCTRCQKKGVPC 88

>AFL031W [3162] [Homologous to ScYBR239C - SH]
          complement(376161..377714) [1554 bp, 517 aa]
          Length = 517

 Score = 32.0 bits (71), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 14/35 (40%), Positives = 17/35 (48%), Gaps = 1/35 (2%)

Query: 12 RRAKTFTGCWTCRSRKVKCDLGRPSCKRCERSGFE 46
          +R KT   C  C    V C+  RP C RC + G E
Sbjct: 11 KRKKTNVACVNCSRSHVTCESQRP-CTRCVKKGLE 44

>YFL052W (YFL052W) [1632] chr6 (28232..29629) Protein with strong
          similarity to the MAL regulatory proteins Mal63p,
          Mal33p, and Mal23p, contains an N-terminal Zn[2]-Cys[6]
          fungal-type binuclear cluster domain [1398 bp, 465 aa]
          Length = 465

 Score = 31.6 bits (70), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 25/49 (51%), Gaps = 2/49 (4%)

Query: 14 AKTFTGCWTCRSRKVKCDLGRPSCKRCERSGFECGGY-DIKLRWSKPIK 61
          A+    C  C  R+VKCD  +P CK C +   +C     +K R  KP+K
Sbjct: 2  ARNRQACDCCCIRRVKCDRKKP-CKCCLQHNLQCTYLRPLKKRGPKPVK 49

>Kwal_8.580
          Length = 638

 Score = 32.0 bits (71), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 15/44 (34%), Positives = 21/44 (47%), Gaps = 3/44 (6%)

Query: 1  MKVEKSDIRKPRRAKTFTGCWTCRSRKVKCDLGRPSCKRCERSG 44
          M  +++  R P  +K    C  CR RK KC    P C+ C  +G
Sbjct: 1  MGTKRASQRSPYVSK---ACDNCRLRKAKCSGDLPVCRNCSTAG 41

>Scas_678.26d1
          Length = 254

 Score = 31.2 bits (69), Expect = 3.3,   Method: Composition-based stats.
 Identities = 16/48 (33%), Positives = 25/48 (52%)

Query: 189 FDFDFSSMNFTGHEWISNELRDDALLSASAVQGIPTNTFTFPAGGNHT 236
           +D  F   +   H   +  L ++A L+AS  Q + T T+T P GG+ T
Sbjct: 71  YDVSFIDPDGVTHTDFTGYLANEAALAASCPQQLTTVTYTVPYGGSQT 118

>Scas_680.25
          Length = 738

 Score = 31.6 bits (70), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 14/29 (48%)

Query: 19 GCWTCRSRKVKCDLGRPSCKRCERSGFEC 47
           C  CR  K KC    PSC  CE++   C
Sbjct: 15 SCSRCRRLKKKCPRQTPSCANCEKAHATC 43

>CAGL0M03135g complement(354638..357859) similar to sp|P47029
           Saccharomyces cerevisiae YJL084c or sp|P36117
           Saccharomyces cerevisiae YKR021w, start by similarity
          Length = 1073

 Score = 31.2 bits (69), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 28/112 (25%), Positives = 50/112 (44%), Gaps = 17/112 (15%)

Query: 664 CVRLVR----HREYYKMNKLPAPRKYAKLCTEFEKRLLNWKSEWDFYKPH--------TR 711
           C+RL R     R++Y+++     R   KLC+     L +++S   F K +         R
Sbjct: 560 CLRLSRVVGDKRKHYEISIDSPMRVLHKLCSHANTLLPSYESHLIFNKQNFTDSSSQKNR 619

Query: 712 EFVNDTIEGVYHHTMSFY-----YSLIIYYFTMARDLNNQLLQSYVEKVLSH 758
           E  ND   G+YH +  F+      S ++     A D+N + + +   +V+ H
Sbjct: 620 ESTNDNELGLYHDSNIFFPKEVLMSPLLSPDVQALDVNTESIYNAPYRVIRH 671

>KLLA0D00396g complement(36277..37362) some similarities with
          ca|CA2346|CaSEF1 Candida albicans Putative
          transcription factor1, hypothetical start
          Length = 361

 Score = 30.8 bits (68), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 22/51 (43%), Gaps = 4/51 (7%)

Query: 15 KTFTGCWTCRSRKVKCDLG--RPS-CKRCERSGFECG-GYDIKLRWSKPIK 61
          K    C  CR  KVKCD    RP  C  C + G  C   Y +  R S  +K
Sbjct: 3  KPLRSCTRCRKNKVKCDSANTRPGPCTACSKRGLVCTLDYVVPPRRSDELK 53

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.320    0.135    0.410 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 25,309,276
Number of extensions: 1037237
Number of successful extensions: 3813
Number of sequences better than 10.0: 253
Number of HSP's gapped: 3902
Number of HSP's successfully gapped: 263
Length of query: 848
Length of database: 16,596,109
Length adjustment: 110
Effective length of query: 738
Effective length of database: 12,788,129
Effective search space: 9437639202
Effective search space used: 9437639202
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 66 (30.0 bits)