Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Sklu_2383.233833818190.0
Kwal_26.918034134112471e-173
YMR228W (MTF1)34133610861e-149
Scas_594.53433419601e-130
CAGL0M11286g3383388941e-120
AFR564W3343266974e-90
KLLA0B08283g3353296862e-88
YDR457W (TOM1)326894760.25
YPL125W (KAP120)103269720.64
YKR009C (FOX2)90027701.2
Scas_700.49*102969681.8
ADL115W33336662.4
Kwal_55.2213194150654.7
AFR737W45785645.2
CAGL0F05049g29353636.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Sklu_2383.2
         (338 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Sklu_2383.2 YMR228W, Contig c2383 8318-9334 reverse complement        705   0.0  
Kwal_26.9180                                                          484   e-173
YMR228W (MTF1) [4184] chr13 (724625..725650) Mitochondrial RNA p...   422   e-149
Scas_594.5                                                            374   e-130
CAGL0M11286g 1108814..1109830 similar to sp|P14908 Saccharomyces...   348   e-120
AFR564W [3756] [Homologous to ScYMR228W (MTF1) - SH] complement(...   273   4e-90
KLLA0B08283g complement(736483..737490) gi|3024184|sp|P87250|MTF...   268   2e-88
YDR457W (TOM1) [1275] chr4 (1369778..1379584) Protein required f...    34   0.25 
YPL125W (KAP120) [5320] chr16 (313387..316485) Nuclear transport...    32   0.64 
YKR009C (FOX2) [3265] chr11 complement(453995..456697) Multifunc...    32   1.2  
Scas_700.49*                                                           31   1.8  
ADL115W [1626] [Homologous to ScYIL041W - SH] complement(483166....    30   2.4  
Kwal_55.22131                                                          30   4.7  
AFR737W [3930] [Homologous to NOHBY] complement(1791346..1792719...    29   5.2  
CAGL0F05049g 513288..514169 similar to tr|Q05867 Saccharomyces c...    29   6.4  

>Sklu_2383.2 YMR228W, Contig c2383 8318-9334 reverse complement
          Length = 338

 Score =  705 bits (1819), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 338/338 (100%), Positives = 338/338 (100%)

Query: 1   MSVHIPTLNSATKIKHYYGFKYLLNSSVHTQIYNKLQLQSTYKMDELKVLDLYPGPSQHS 60
           MSVHIPTLNSATKIKHYYGFKYLLNSSVHTQIYNKLQLQSTYKMDELKVLDLYPGPSQHS
Sbjct: 1   MSVHIPTLNSATKIKHYYGFKYLLNSSVHTQIYNKLQLQSTYKMDELKVLDLYPGPSQHS 60

Query: 61  AIFRNIFNPKQYVLMDSRPDFVKFIQDNFAGTSMELYQRDPYEWSSYTDMIEKEKRFVPN 120
           AIFRNIFNPKQYVLMDSRPDFVKFIQDNFAGTSMELYQRDPYEWSSYTDMIEKEKRFVPN
Sbjct: 61  AIFRNIFNPKQYVLMDSRPDFVKFIQDNFAGTSMELYQRDPYEWSSYTDMIEKEKRFVPN 120

Query: 121 RQSRDKIHNQFLVMANLTGMIGEGLFMQWLSCIGNKNWLQRFGRVKMLVWVPEATAHKVL 180
           RQSRDKIHNQFLVMANLTGMIGEGLFMQWLSCIGNKNWLQRFGRVKMLVWVPEATAHKVL
Sbjct: 121 RQSRDKIHNQFLVMANLTGMIGEGLFMQWLSCIGNKNWLQRFGRVKMLVWVPEATAHKVL 180

Query: 181 ARPGSLIRAKCSVVTEAFTDTKLVATSDSSTLQKFSSSLLEEHDPIIFSTRDTWLNSGKP 240
           ARPGSLIRAKCSVVTEAFTDTKLVATSDSSTLQKFSSSLLEEHDPIIFSTRDTWLNSGKP
Sbjct: 181 ARPGSLIRAKCSVVTEAFTDTKLVATSDSSTLQKFSSSLLEEHDPIIFSTRDTWLNSGKP 240

Query: 241 ISLLEVNPIDHDIDLDNWDYVTKHLLILKSTPLHTAIDSLGHGGKQYFSEKVEDKLLMDK 300
           ISLLEVNPIDHDIDLDNWDYVTKHLLILKSTPLHTAIDSLGHGGKQYFSEKVEDKLLMDK
Sbjct: 241 ISLLEVNPIDHDIDLDNWDYVTKHLLILKSTPLHTAIDSLGHGGKQYFSEKVEDKLLMDK 300

Query: 301 CPKDLTNKEFVYLTSIFNNWPFKPDIYMDFIDVFQENE 338
           CPKDLTNKEFVYLTSIFNNWPFKPDIYMDFIDVFQENE
Sbjct: 301 CPKDLTNKEFVYLTSIFNNWPFKPDIYMDFIDVFQENE 338

>Kwal_26.9180
          Length = 341

 Score =  484 bits (1247), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 224/341 (65%), Positives = 278/341 (81%), Gaps = 3/341 (0%)

Query: 1   MSVHIPTLNSATKIKHYYGFKYLLNSSVHTQIYNKLQLQSTYK-MDELKVLDLYPGPSQH 59
           M++ +  L    KI+HYYGF+YLLN +VH +I++KL+L+ TY  +++LKVLDLYPGP+QH
Sbjct: 1   MALKVQPLQELAKIQHYYGFRYLLNKAVHEKIFSKLKLKDTYSDVNKLKVLDLYPGPAQH 60

Query: 60  SAIFRNIFNPKQYVLMDSRPDFVKFIQ--DNFAGTSMELYQRDPYEWSSYTDMIEKEKRF 117
           S +  N   P Q+VLMD+RPDFVK I+     +  +++LY RDPY+W SYT+MIEKEK F
Sbjct: 61  SVVLNNYLKPSQHVLMDARPDFVKHIRALSLESNGNLQLYNRDPYDWQSYTNMIEKEKLF 120

Query: 118 VPNRQSRDKIHNQFLVMANLTGMIGEGLFMQWLSCIGNKNWLQRFGRVKMLVWVPEATAH 177
           VP +Q +D IH +FLVMANLTGMIGEGLFMQWL+CIGNKNWLQRFGRVKMLVWV E+TA 
Sbjct: 121 VPTKQPQDAIHKEFLVMANLTGMIGEGLFMQWLACIGNKNWLQRFGRVKMLVWVQESTAL 180

Query: 178 KVLARPGSLIRAKCSVVTEAFTDTKLVATSDSSTLQKFSSSLLEEHDPIIFSTRDTWLNS 237
           K+LARPG  +R+KCSVV EAFTDTKLVAT DS  + KFS+S+L  H+PI+F ++D W  S
Sbjct: 181 KLLARPGEHLRSKCSVVAEAFTDTKLVATMDSKNISKFSTSVLSTHEPIVFPSQDVWAPS 240

Query: 238 GKPISLLEVNPIDHDIDLDNWDYVTKHLLILKSTPLHTAIDSLGHGGKQYFSEKVEDKLL 297
           GKPISLLEVNP+DH IDLDN+DY TKHLLILKSTPL  ++DSLGHGGK+YF   + DK L
Sbjct: 241 GKPISLLEVNPLDHIIDLDNFDYATKHLLILKSTPLSESLDSLGHGGKEYFRRVIRDKNL 300

Query: 298 MDKCPKDLTNKEFVYLTSIFNNWPFKPDIYMDFIDVFQENE 338
           + +CPKDLT +EF+ +T +F+ WPFKPDIYMDFIDVFQEN+
Sbjct: 301 LQRCPKDLTCREFIEITDLFDKWPFKPDIYMDFIDVFQEND 341

>YMR228W (MTF1) [4184] chr13 (724625..725650) Mitochondrial RNA
           polymerase specificity factor, distantly related to
           bacterial sigma factors [1026 bp, 341 aa]
          Length = 341

 Score =  422 bits (1086), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 194/336 (57%), Positives = 258/336 (76%), Gaps = 1/336 (0%)

Query: 1   MSVHIPTLNSATKIKHYYGFKYLLNSSVHTQIYNKLQLQSTYKM-DELKVLDLYPGPSQH 59
           MSV IP +   +K+K +YGFKYL N +V+ +I++KL L  TYK  +ELKVLDLYPG    
Sbjct: 1   MSVPIPGIKDISKLKFFYGFKYLWNPTVYNKIFDKLDLTKTYKHPEELKVLDLYPGVGIQ 60

Query: 60  SAIFRNIFNPKQYVLMDSRPDFVKFIQDNFAGTSMELYQRDPYEWSSYTDMIEKEKRFVP 119
           SAIF N + P+QY L++ R    KF+   F G+ +++ +RDPY+WS+Y+++I++E+ FVP
Sbjct: 61  SAIFYNKYCPRQYSLLEKRSSLYKFLNAKFEGSPLQILKRDPYDWSTYSNLIDEERIFVP 120

Query: 120 NRQSRDKIHNQFLVMANLTGMIGEGLFMQWLSCIGNKNWLQRFGRVKMLVWVPEATAHKV 179
             QS D I+++FL +AN+TG   EGL MQWLSCIGNKNWL RFG+VKML+W+P  TA K+
Sbjct: 121 EVQSSDHINDKFLTVANVTGEGSEGLIMQWLSCIGNKNWLYRFGKVKMLLWMPSTTARKL 180

Query: 180 LARPGSLIRAKCSVVTEAFTDTKLVATSDSSTLQKFSSSLLEEHDPIIFSTRDTWLNSGK 239
           LARPG   R+KCSVV EAFTDTKL+A SD++ L+ F S  +EE DPI+FS  + W   GK
Sbjct: 181 LARPGMHSRSKCSVVREAFTDTKLIAISDANELKGFDSQCIEEWDPILFSAAEIWPTKGK 240

Query: 240 PISLLEVNPIDHDIDLDNWDYVTKHLLILKSTPLHTAIDSLGHGGKQYFSEKVEDKLLMD 299
           PI+L+E++PID D D+DNWDYVT+HL+ILK TPL+T +DSLGHGG+QYF+ ++ DK L+ 
Sbjct: 241 PIALVEMDPIDFDFDVDNWDYVTRHLMILKRTPLNTVMDSLGHGGQQYFNSRITDKDLLK 300

Query: 300 KCPKDLTNKEFVYLTSIFNNWPFKPDIYMDFIDVFQ 335
           KCP DLTN EF+YLT +F  WPFKPDI MDF+D++Q
Sbjct: 301 KCPIDLTNDEFIYLTKLFMEWPFKPDILMDFVDMYQ 336

>Scas_594.5
          Length = 343

 Score =  374 bits (960), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 178/341 (52%), Positives = 238/341 (69%), Gaps = 7/341 (2%)

Query: 1   MSVHIPTLNSATKIKHYYGFKYLLNSSVHTQIYNKLQLQSTYKMDELKVLDLYPGPSQHS 60
           MS+ +PT    +KI   YG +YL+N  V  +I+ KL  +       LKVLD+YPGP   S
Sbjct: 1   MSLSVPTTGVLSKITQRYGSQYLINPKVFDKIFKKLDFKEY--SSTLKVLDMYPGPCVQS 58

Query: 61  AIFRNIFNPKQYVLMDSRPDFVKFIQDNFAGTS-MELYQRDPYEWSSYTDMIEKEKRFVP 119
            +F N + PKQYVLM+SR  FVK I+  F   S +E  +RDPY W S+ ++IEKEK  VP
Sbjct: 59  TMFYNKYQPKQYVLMESRSQFVKLIKSEFPFPSPLERTERDPYHWESFIEIIEKEKLLVP 118

Query: 120 NRQSRDKIHNQFLVMANLTGMIGEGLFMQWLSCIGNKNWLQRFGRVKMLVWVPEATAHKV 179
            +Q    IHN FLV+ N+T    E L MQW  CIGN+NWLQRFGRV+ML+WVP +TA K+
Sbjct: 119 EKQPLTHIHNSFLVVGNVTNRNNESLIMQWFHCIGNRNWLQRFGRVRMLLWVPLSTASKL 178

Query: 180 LARPGSLIRAKCSVVTEAFTDTKLVATSDSSTLQKFSSSLLEEHDPIIFST----RDTWL 235
           +A P S +R+K SV+ EAFTDT+L+A S+ + L+KF   +L+E +PI+F      +   +
Sbjct: 179 MAEPKSKLRSKASVIREAFTDTRLLAISNIAELKKFDKIVLDESNPIVFGEDSMLKGAGV 238

Query: 236 NSGKPISLLEVNPIDHDIDLDNWDYVTKHLLILKSTPLHTAIDSLGHGGKQYFSEKVEDK 295
           +S   I+LLE+NP +HD+DL+NWDYVTKHL+ILK T L  A++SLGHG K YF+EK+ED 
Sbjct: 239 SSATSIALLEINPKNHDLDLENWDYVTKHLMILKQTKLIDALESLGHGAKDYFTEKIEDS 298

Query: 296 LLMDKCPKDLTNKEFVYLTSIFNNWPFKPDIYMDFIDVFQE 336
             ++K P ++TN +F+YLT IF NWPFKPDIYMDF+D+ QE
Sbjct: 299 TYLNKTPGEMTNDDFIYLTKIFANWPFKPDIYMDFVDILQE 339

>CAGL0M11286g 1108814..1109830 similar to sp|P14908 Saccharomyces
           cerevisiae YMR228w MTF1 RNA polymerase specific factor,
           start by similarity
          Length = 338

 Score =  348 bits (894), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 167/338 (49%), Positives = 232/338 (68%), Gaps = 6/338 (1%)

Query: 1   MSVHIPTLNSATKIKHYYGFKYLLNSSVHTQIYNKLQLQSTYKMDELKVLDLYPGPSQHS 60
           M V +PT+ S   IK YYGF+YLL+   H +++ KL L S   M   KVLDLYPGP  HS
Sbjct: 1   MKVAVPTI-SQLHIKSYYGFRYLLDPDWHQKVFEKLGLSSNPNM---KVLDLYPGPGIHS 56

Query: 61  AIFRNIFNPKQYVLMDSRPDFVKFIQDNFAGTSMELYQRDPYEWSSYTDMIEKEKRFVPN 120
           A+  N   P+QY +M+ R DF+  +++ +    MEL ++DPY+W SYT++I++EK FVP 
Sbjct: 57  AVLYNKVQPQQYTMMECRRDFLSNLRNIYTDGPMELVKKDPYKWESYTELIDQEKLFVPK 116

Query: 121 RQSRDKIHNQFLVMANLTGMIGEGLFMQWLSCIGNKNWLQRFGRVKMLVWVPEATAHKVL 180
           +   + ++  F +MANLT    EGL MQW++C+GN+NWL RFGR  ML+W+P  TA K+L
Sbjct: 117 KADYNVVNKDFYIMANLTEKKHEGLLMQWMNCVGNRNWLFRFGRSPMLIWMPTPTASKLL 176

Query: 181 ARPGSLIRAKCSVVTEAFTDTKLVATSDSSTLQKFSSSLLEEHDPIIFSTRDTWLNSGKP 240
           A  G   R KCS+V EAFTDTKLVA S    ++ F+S  L++ +P++      +     P
Sbjct: 177 ADSGDHSRHKCSLVREAFTDTKLVALSQEEDMKSFNSVCLDKSNPLVIPDGTDYGGKDFP 236

Query: 241 ISLLEVNPIDHDIDLDNWDYVTKHLLILKSTPLHTAIDSLGHGGKQYFSEKVE-DKL-LM 298
           I+L+E  P  HDIDLDNW++VTKHL++L  TPL  AID LGHG + YFS  ++ D + L+
Sbjct: 237 IALVEFTPKKHDIDLDNWEFVTKHLMVLYKTPLIDAIDCLGHGARDYFSANIDKDHIHLL 296

Query: 299 DKCPKDLTNKEFVYLTSIFNNWPFKPDIYMDFIDVFQE 336
            KCP+D TN +FVYLT++F+ WPFKPD+YMDF+D++QE
Sbjct: 297 KKCPQDFTNNDFVYLTNLFHLWPFKPDVYMDFLDIYQE 334

>AFR564W [3756] [Homologous to ScYMR228W (MTF1) - SH]
           complement(1446758..1447762) [1005 bp, 334 aa]
          Length = 334

 Score =  273 bits (697), Expect = 4e-90,   Method: Compositional matrix adjust.
 Identities = 139/326 (42%), Positives = 204/326 (62%), Gaps = 10/326 (3%)

Query: 8   LNSATKIKHYYGFKYLLNSSVHTQIYNKLQLQSTYKMDELKVLDLYPGPSQHSAIFRNIF 67
           L +   +K  YG   L + +     Y +L LQ  Y M +++VL+LYPG    S IF +I+
Sbjct: 13  LEACLAVKFSYGRTLLHSPTAIELAYKRLNLQEHYDMSKVQVLELYPGTGLPSYIFHDIY 72

Query: 68  NPKQYVLMDSRPDFVKFIQDNFAGT-SMELYQRDPYEWSSYTDMIEKEKRFVPNRQSRDK 126
            PK  VLM+S+P + K I+ +     +++L++ DPY W S+  +I+++K   P  Q+RD 
Sbjct: 73  KPKLQVLMESKPAYAKVIEQHLTLLDNIKLHKEDPYMWESFVSLIDEKKIMQPEVQTRDH 132

Query: 127 IHNQFLVMANLTGMIGEGLFMQWLSCIGNKNWLQRFGRVKMLVWVPEATAHKVLARPGSL 186
           IH+ F+VM NLT   GE L+MQ+L CI NKNW+QRFG V+ML WVP+ TA K+L+  G  
Sbjct: 133 IHDSFIVMGNLTDKRGEQLYMQYLQCIANKNWMQRFGLVRMLFWVPQTTAIKLLSPCGFK 192

Query: 187 IRAKCSVVTEAFTDTKLVATSDSSTLQKFSSSLLEEHDPIIFSTRDTWLNSGKPISLLEV 246
            R++CSV+TEA TDT+L+AT+    L  F   +L++HDP+I     T        +LLEV
Sbjct: 193 SRSRCSVITEAVTDTRLIATT-PDNLASFGPGVLDKHDPLILPENKT------DYALLEV 245

Query: 247 NPIDHDIDLDNWDYVTKHLLILKSTPLHTAIDSLGHGGKQYFSEKVEDKLLMDKCPKDLT 306
            P++H++ L+ WDY  + LL+ KSTPL   ++ LGHG   +   +++ +LL  K P  LT
Sbjct: 246 LPLNHNMKLEYWDYCMQRLLVCKSTPLEDILEVLGHGASDFLKCRIDPELLKKK-PMQLT 304

Query: 307 NKEFVYLTSIFNNWPFKPDIYMDFID 332
           N+EF  + S++  WPFKP IY DF D
Sbjct: 305 NQEFTKIASLYALWPFKPSIY-DFYD 329

>KLLA0B08283g complement(736483..737490)
           gi|3024184|sp|P87250|MTF1_KLULA Kluyveromyces lactis
           MITOCHONDRIAL REPLICATION PROTEIN MTF1 (MITOCHONDRIAL
           TRANSCRIPTION FACTOR MTTFB), start by similarity
          Length = 335

 Score =  268 bits (686), Expect = 2e-88,   Method: Compositional matrix adjust.
 Identities = 140/329 (42%), Positives = 209/329 (63%), Gaps = 9/329 (2%)

Query: 11  ATKIKHYYGFKYLLNSSVHTQIYNKLQLQSTYKMDELKVLDLYPGPSQHSAIFRNIFNPK 70
           A KI   YG ++  N  V  QI +KL L+S YK + L++LD+Y GP   S I      PK
Sbjct: 14  ANKIHTSYGSQFEKNPKVINQILDKLNLESYYKSESLQILDIYAGPLIQSVILNERLKPK 73

Query: 71  QYVLMDSRPDFVKFIQDNFAG-TSMELYQRDPYEWSSYTDMIEKEKRFVPNRQSRDKIHN 129
           ++VL++ R  FV+  Q       SM  Y ++PY+W ++ +M  +++   P+ Q RD IHN
Sbjct: 74  KHVLLEDRLKFVELYQATLKDHPSMVNYNKNPYKWETFLEMTNEDRVLTPSMQKRDHIHN 133

Query: 130 QFLVMANLTGMIGEGLFMQWLSCIGNKNWLQRFGRVKMLVWVPEATAHKVLARPGSLIRA 189
           +FL+ ANLT   GE L++Q+L CI N+NW+QRFG VKMLVW+P+ TA K+ A   +  R 
Sbjct: 134 EFLIAANLTNKKGEQLYVQYLQCIANQNWMQRFGLVKMLVWIPQQTARKLFAPFSNKDRN 193

Query: 190 KCSVVTEAFTDTKLVATSDSSTLQKFSSSLLEEHDPIIFSTRDTWLNSGKPISLLEVNPI 249
           + ++++E  T+TKLVATS++S ++KF    +E+ DP+I  + +    S   +SL+E+NP 
Sbjct: 194 RLTLLSELATNTKLVATSENS-VKKFLPDCIEKFDPVIIPSDN---KSPDDLSLVEINPR 249

Query: 250 DHDIDLDNWDYVTKHLLILKSTPLHTAIDSLGHGGKQYFSEKVEDKLLMDKCPKDLTNKE 309
           DH IDLD+WD+VT+ L+ILKS P+   I+ LGHG + +F  ++ D +L+ K P +LT  E
Sbjct: 250 DHSIDLDHWDFVTQKLMILKSKPVEEMIEILGHGARDWFISRL-DPVLLKKKPYELTYLE 308

Query: 310 FVYLTSIFNNWPFKPDIYMDFIDVFQENE 338
              +  +F  WPFKP + +DF D   ENE
Sbjct: 309 IDEIAKVFALWPFKPSLLVDFYD---ENE 334

>YDR457W (TOM1) [1275] chr4 (1369778..1379584) Protein required for
           the G2/M transition, has similarity to Rsp5p, a
           ubiquitin-protein ligase (E3 enzyme) [9807 bp, 3268 aa]
          Length = 3268

 Score = 33.9 bits (76), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 22/94 (23%), Positives = 43/94 (45%), Gaps = 12/94 (12%)

Query: 73  VLMDSRPDFVKFIQDNFA--GTSMELYQRDPYEWSSYTDMIEKEKRFVPNRQSRDKIHNQ 130
           ++++++ + + F+   F+    S +L++ DPY ++S TD+I   +  +P     D +   
Sbjct: 293 IIIETKLNAIAFVNTIFSPPQVSSKLFELDPYAFNSLTDLISLSETKIPKELRTDALFTL 352

Query: 131 FL----------VMANLTGMIGEGLFMQWLSCIG 154
                       ++ NL G I  GL  Q L  I 
Sbjct: 353 ECISLKHVWCSDIIRNLGGNISHGLLFQILRYIA 386

>YPL125W (KAP120) [5320] chr16 (313387..316485) Nuclear transport
           factor, member of karyopherin-beta family [3099 bp, 1032
           aa]
          Length = 1032

 Score = 32.3 bits (72), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 17/69 (24%), Positives = 35/69 (50%)

Query: 162 FGRVKMLVWVPEATAHKVLARPGSLIRAKCSVVTEAFTDTKLVATSDSSTLQKFSSSLLE 221
           F R+ + V++PEAT   +      +IR + +++   ++  K    S S   + F++ L +
Sbjct: 483 FDRLLIQVFLPEATNTNISGDELRIIRRRVALIINEWSTVKCSEESKSLCYKLFTNFLTD 542

Query: 222 EHDPIIFST 230
           E D ++  T
Sbjct: 543 EDDKVVLLT 551

>YKR009C (FOX2) [3265] chr11 complement(453995..456697)
           Multifunctional enzyme of the peroxisomal fatty acid
           beta-oxidation pathway possessing 2-enoyl-CoA hydratase
           2 and D-3-hydroxyacyl-CoA dehydrogenase activities [2703
           bp, 900 aa]
          Length = 900

 Score = 31.6 bits (70), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 13/27 (48%), Positives = 16/27 (59%)

Query: 101 PYEWSSYTDMIEKEKRFVPNRQSRDKI 127
           PY+ S Y D+I K K+  PN Q   KI
Sbjct: 291 PYQLSDYNDLITKAKKLPPNEQGSVKI 317

>Scas_700.49*
          Length = 1029

 Score = 30.8 bits (68), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 15/69 (21%), Positives = 34/69 (49%)

Query: 162 FGRVKMLVWVPEATAHKVLARPGSLIRAKCSVVTEAFTDTKLVATSDSSTLQKFSSSLLE 221
           F R+ + +++PEAT + +      +IR + +++   ++  K    S +     F+  L+ 
Sbjct: 485 FDRLLVQIFLPEATNNSIPRDQARIIRRRVALIINEWSTVKCSEESKALCYNFFNDLLIG 544

Query: 222 EHDPIIFST 230
           E D ++  T
Sbjct: 545 EDDKVVLLT 553

>ADL115W [1626] [Homologous to ScYIL041W - SH]
           complement(483166..484167) [1002 bp, 333 aa]
          Length = 333

 Score = 30.0 bits (66), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 13/36 (36%), Positives = 23/36 (63%), Gaps = 1/36 (2%)

Query: 69  PKQYVLMDSRPDFVKFIQDNFAGTSMELYQRDPYEW 104
           P++YV ++ R D  K I DNF   S ++Y+ + Y++
Sbjct: 77  PEEYVELEQRVDRTKLIYDNFLKVS-QIYESESYDY 111

>Kwal_55.22131
          Length = 941

 Score = 29.6 bits (65), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 30/50 (60%), Gaps = 2/50 (4%)

Query: 178 KVLARPGSLIRAKCSVVTEAFTDTKLVATSDSSTLQKFSSSLLEEHDPII 227
            V + P SL++++ S  T  FT  K++ +S + T+   SSS++   DP++
Sbjct: 737 SVSSTPRSLVKSQSSQTTVVFTSNKVLTSSIAKTIT--SSSVISTQDPVL 784

>AFR737W [3930] [Homologous to NOHBY] complement(1791346..1792719)
           [1374 bp, 457 aa]
          Length = 457

 Score = 29.3 bits (64), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 24/85 (28%), Positives = 42/85 (49%), Gaps = 2/85 (2%)

Query: 189 AKCSVVTEAFTDTKLVATSDSSTLQKFSSSLLEEHDPIIFSTRDTWLNSGKPISLLEVNP 248
           AK S+++E F D    +  D +  Q +S  LL+    +     D W+ +GK ISL+E+  
Sbjct: 366 AKDSILSELF-DVLATSKDDEAVYQAYSV-LLDISRQVHGRISDLWVPNGKMISLMEMLL 423

Query: 249 IDHDIDLDNWDYVTKHLLILKSTPL 273
                D    D+VT+   I+++  +
Sbjct: 424 TSGKNDKICTDFVTEMYCIIRACAV 448

>CAGL0F05049g 513288..514169 similar to tr|Q05867 Saccharomyces
           cerevisiae YLR283w, hypothetical start
          Length = 293

 Score = 28.9 bits (63), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 24/53 (45%), Gaps = 6/53 (11%)

Query: 262 TKHLLILKSTPLHTAIDS------LGHGGKQYFSEKVEDKLLMDKCPKDLTNK 308
           TKH+   + TP    I +      L     QY  EKV +KL  D+ P D  NK
Sbjct: 9   TKHIRTWRYTPRPKVIRAYHSTPLLQINSTQYLKEKVSNKLTNDETPLDFINK 61

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.320    0.136    0.413 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 12,098,851
Number of extensions: 546984
Number of successful extensions: 1483
Number of sequences better than 10.0: 24
Number of HSP's gapped: 1489
Number of HSP's successfully gapped: 24
Length of query: 338
Length of database: 16,596,109
Length adjustment: 102
Effective length of query: 236
Effective length of database: 13,065,073
Effective search space: 3083357228
Effective search space used: 3083357228
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 62 (28.5 bits)