Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Sklu_2383.11720172083700.0
Kwal_26.91891726172856790.0
YMR229C (RRP5)1729170553810.0
AFR566C1716173053710.0
Scas_594.41722170952740.0
CAGL0M04829g1706170447260.0
KLLA0B08239g1729133640470.0
KLLA0F17996g6842271252e-06
Scas_713.426992211201e-05
CAGL0D02376g695881127e-05
AGL184W683225960.006
Kwal_56.23875680130950.007
KLLA0B09262g941208940.011
CAGL0F02915g835141920.020
YLR117C (CLF1)68792900.029
YER013W (PRP22)114573900.034
Scas_705.55907170890.047
KLLA0B11638g111175880.058
ADL344W910206880.065
Kwal_23.367080297870.079
Kwal_55.210291105120840.19
YBR112C (SSN6)966137820.29
AAR020W111273790.76
KLLA0F20449g804102761.5
CAGL0E03630g74698761.6
Sklu_2440.18824240733.7
Scas_570.11858216723.9
KLLA0D16148g26790704.8
CAGL0D01364g114879715.2
CAGL0M08206g40078706.7
Scas_661.22877101698.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Sklu_2383.1
         (1720 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Sklu_2383.1 YMR229C, Contig c2383 993-6155                           3228   0.0  
Kwal_26.9189                                                         2192   0.0  
YMR229C (RRP5) [4185] chr13 complement(725933..731122) Protein r...  2077   0.0  
AFR566C [3758] [Homologous to ScYMR229C (RRP5) - SH] (1449324..1...  2073   0.0  
Scas_594.4                                                           2036   0.0  
CAGL0M04829g complement(524685..529805) similar to sp|Q05022 Sac...  1825   0.0  
KLLA0B08239g 729850..735039 similar to sp|Q05022 Saccharomyces c...  1563   0.0  
KLLA0F17996g 1645592..1647646 similar to sgd|S0004107 Saccharomy...    53   2e-06
Scas_713.42                                                            51   1e-05
CAGL0D02376g complement(244241..246328) similar to tr|Q12309 Sac...    48   7e-05
AGL184W [4128] [Homologous to ScYLR117C (CLF1) - SH] complement(...    42   0.006
Kwal_56.23875                                                          41   0.007
KLLA0B09262g 814303..817128 some similarities with sp|P14922 Sac...    41   0.011
CAGL0F02915g 281010..283517 similar to sp|Q04048 Saccharomyces c...    40   0.020
YLR117C (CLF1) [3530] chr12 complement(382472..384535) Essential...    39   0.029
YER013W (PRP22) [1436] chr5 (178840..182277) Pre-mRNA splicing f...    39   0.034
Scas_705.55                                                            39   0.047
KLLA0B11638g complement(1020591..1023926) similar to sp|P24384 S...    39   0.058
ADL344W [1396] [Homologous to ScYBR112C (CYC8) - SH] complement(...    39   0.065
Kwal_23.3670                                                           38   0.079
Kwal_55.21029                                                          37   0.19 
YBR112C (CYC8) [302] chr2 complement(462826..465726) General rep...    36   0.29 
AAR020W [206] [Homologous to ScYER013W (PRP22) - SH] complement(...    35   0.76 
KLLA0F20449g 1898253..1900667 highly similar to sp|P13188 Saccha...    34   1.5  
CAGL0E03630g complement(335091..337331) weakly similar to sp|P38...    34   1.6  
Sklu_2440.18 YDR416W, Contig c2440 29476-31950                         33   3.7  
Scas_570.11                                                            32   3.9  
KLLA0D16148g 1361758..1362561 highly similar to sp|P40545 Saccha...    32   4.8  
CAGL0D01364g 152033..155479 similar to sp|P14922 Saccharomyces c...    32   5.2  
CAGL0M08206g complement(816472..817674) similar to sp|P46992 Sac...    32   6.7  
Scas_661.22                                                            31   8.7  

>Sklu_2383.1 YMR229C, Contig c2383 993-6155
          Length = 1720

 Score = 3228 bits (8370), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1601/1720 (93%), Positives = 1601/1720 (93%)

Query: 1    MAPSNNKRKRDDESPLTRQDNTSQPVKSSLLQSSEETSFPRGGASVLTPLELKQVANEAA 60
            MAPSNNKRKRDDESPLTRQDNTSQPVKSSLLQSSEETSFPRGGASVLTPLELKQVANEAA
Sbjct: 1    MAPSNNKRKRDDESPLTRQDNTSQPVKSSLLQSSEETSFPRGGASVLTPLELKQVANEAA 60

Query: 61   SDVLFDNGTSSAVKPEVERPXXXXXXXXXXXXXXNETDEEESTTIVEHISFKNLTPGSQL 120
            SDVLFDNGTSSAVKPEVERP              NETDEEESTTIVEHISFKNLTPGSQL
Sbjct: 61   SDVLFDNGTSSAVKPEVERPKKKKKTSKSTTGTKNETDEEESTTIVEHISFKNLTPGSQL 120

Query: 121  LGQISAVNKHDLCISLSDNLCGYVTLANISEQFTNLLEELDENMXXXXXXXXXXXXXXXX 180
            LGQISAVNKHDLCISLSDNLCGYVTLANISEQFTNLLEELDENM                
Sbjct: 121  LGQISAVNKHDLCISLSDNLCGYVTLANISEQFTNLLEELDENMEKDQDSEDDDSDYDSS 180

Query: 181  XXXXHSKNKKNKELPDLKKYFKPGQWLRCTVQSNTALEAKKKQKRIELTIEPSATNQLAD 240
                HSKNKKNKELPDLKKYFKPGQWLRCTVQSNTALEAKKKQKRIELTIEPSATNQLAD
Sbjct: 181  DEDEHSKNKKNKELPDLKKYFKPGQWLRCTVQSNTALEAKKKQKRIELTIEPSATNQLAD 240

Query: 241  EDLSRNCTVQCSVKSIEDHGAILDLGIKGITGFISKKDYPGVEELLPGTVFLGNVAKRSD 300
            EDLSRNCTVQCSVKSIEDHGAILDLGIKGITGFISKKDYPGVEELLPGTVFLGNVAKRSD
Sbjct: 241  EDLSRNCTVQCSVKSIEDHGAILDLGIKGITGFISKKDYPGVEELLPGTVFLGNVAKRSD 300

Query: 301  RTVNVNFDFTSKNNKVSHISSIDAVIPGQSVDFLCQKISSNGIFGKTFGLVSGFLGASHL 360
            RTVNVNFDFTSKNNKVSHISSIDAVIPGQSVDFLCQKISSNGIFGKTFGLVSGFLGASHL
Sbjct: 301  RTVNVNFDFTSKNNKVSHISSIDAVIPGQSVDFLCQKISSNGIFGKTFGLVSGFLGASHL 360

Query: 361  RTFSADKIKHNYAIGSNIRARIVATLTNKKGEKIILVSTLPHILSLETKILEADALDAFP 420
            RTFSADKIKHNYAIGSNIRARIVATLTNKKGEKIILVSTLPHILSLETKILEADALDAFP
Sbjct: 361  RTFSADKIKHNYAIGSNIRARIVATLTNKKGEKIILVSTLPHILSLETKILEADALDAFP 420

Query: 421  VGYILESCTVKGRDSQYFYLSMDQDRIGQVHISRVGDEDPAGEVKARVMGYNVVDGYYQL 480
            VGYILESCTVKGRDSQYFYLSMDQDRIGQVHISRVGDEDPAGEVKARVMGYNVVDGYYQL
Sbjct: 421  VGYILESCTVKGRDSQYFYLSMDQDRIGQVHISRVGDEDPAGEVKARVMGYNVVDGYYQL 480

Query: 481  STDPKVLELKYLRTKDIPLGEVISGCEIVTVSDKGIQLTLFGSQFKAFVPPLHISDVKLV 540
            STDPKVLELKYLRTKDIPLGEVISGCEIVTVSDKGIQLTLFGSQFKAFVPPLHISDVKLV
Sbjct: 481  STDPKVLELKYLRTKDIPLGEVISGCEIVTVSDKGIQLTLFGSQFKAFVPPLHISDVKLV 540

Query: 541  YPERKFKIGSKVKGRVLNVDNRGRVTVTLKKSLVNLDEDEIKLVSNFKQIEKLADNDEKT 600
            YPERKFKIGSKVKGRVLNVDNRGRVTVTLKKSLVNLDEDEIKLVSNFKQIEKLADNDEKT
Sbjct: 541  YPERKFKIGSKVKGRVLNVDNRGRVTVTLKKSLVNLDEDEIKLVSNFKQIEKLADNDEKT 600

Query: 601  SATVEFFKTNGCVVSFLGNLKGFLPNGEISEAFVKRPQDHLRLGQTVMVKVLQHDEEKNR 660
            SATVEFFKTNGCVVSFLGNLKGFLPNGEISEAFVKRPQDHLRLGQTVMVKVLQHDEEKNR
Sbjct: 601  SATVEFFKTNGCVVSFLGNLKGFLPNGEISEAFVKRPQDHLRLGQTVMVKVLQHDEEKNR 660

Query: 661  VIITCKVSSDAAAQQKDAIENMVIGRSIVTVTVVGKTKDSAVIELVDVGLRGVIYVGHLS 720
            VIITCKVSSDAAAQQKDAIENMVIGRSIVTVTVVGKTKDSAVIELVDVGLRGVIYVGHLS
Sbjct: 661  VIITCKVSSDAAAQQKDAIENMVIGRSIVTVTVVGKTKDSAVIELVDVGLRGVIYVGHLS 720

Query: 721  DSRIEQNRAQLKKLRVGTELEGLVIDKDIRTRVFNLSCKKSLIKDAQNGLLPLSYDEVKA 780
            DSRIEQNRAQLKKLRVGTELEGLVIDKDIRTRVFNLSCKKSLIKDAQNGLLPLSYDEVKA
Sbjct: 721  DSRIEQNRAQLKKLRVGTELEGLVIDKDIRTRVFNLSCKKSLIKDAQNGLLPLSYDEVKA 780

Query: 781  KGNSFPMHGYVKSFSDKGIFVAFSGRFVGLVLPSYAVESRDVDILKKFHINQSITAYLLR 840
            KGNSFPMHGYVKSFSDKGIFVAFSGRFVGLVLPSYAVESRDVDILKKFHINQSITAYLLR
Sbjct: 781  KGNSFPMHGYVKSFSDKGIFVAFSGRFVGLVLPSYAVESRDVDILKKFHINQSITAYLLR 840

Query: 841  TDDENERFLLTLKEPKVAEKRQDNGSVNAVNPIDESVKELSEYXXXXXXXXXXXXXXXNQ 900
            TDDENERFLLTLKEPKVAEKRQDNGSVNAVNPIDESVKELSEY               NQ
Sbjct: 841  TDDENERFLLTLKEPKVAEKRQDNGSVNAVNPIDESVKELSEYVVGKVTKAKIKAVKKNQ 900

Query: 901  LNVLLADNLHGRVDVSEIFDKFENIKDTKAPLSCYKKGDVIEVKVIGYHDIKTHRFLPIS 960
            LNVLLADNLHGRVDVSEIFDKFENIKDTKAPLSCYKKGDVIEVKVIGYHDIKTHRFLPIS
Sbjct: 901  LNVLLADNLHGRVDVSEIFDKFENIKDTKAPLSCYKKGDVIEVKVIGYHDIKTHRFLPIS 960

Query: 961  HRASKNTILELTAKPSKLTEENESSLTIKNVKENDELVGFVNNFSKGFLWLTLSPVLKAK 1020
            HRASKNTILELTAKPSKLTEENESSLTIKNVKENDELVGFVNNFSKGFLWLTLSPVLKAK
Sbjct: 961  HRASKNTILELTAKPSKLTEENESSLTIKNVKENDELVGFVNNFSKGFLWLTLSPVLKAK 1020

Query: 1021 ISNINLSDDGSTFASDIPESFPLGSALKVKAVDIDTEHNVVSVTGRFHSIKDITDVKVGD 1080
            ISNINLSDDGSTFASDIPESFPLGSALKVKAVDIDTEHNVVSVTGRFHSIKDITDVKVGD
Sbjct: 1021 ISNINLSDDGSTFASDIPESFPLGSALKVKAVDIDTEHNVVSVTGRFHSIKDITDVKVGD 1080

Query: 1081 KLPARIIMIADSYLLLDLGNDLKGISFVTEALDDYSVSLKTAFENRKNSIVPATVIXXXX 1140
            KLPARIIMIADSYLLLDLGNDLKGISFVTEALDDYSVSLKTAFENRKNSIVPATVI    
Sbjct: 1081 KLPARIIMIADSYLLLDLGNDLKGISFVTEALDDYSVSLKTAFENRKNSIVPATVISVDL 1140

Query: 1141 XXXXXXXXXRSTKPKDREIKSYKDLSRGDVVRGFIKAVSDKGIFVYLSTSVQAFVPVSKL 1200
                     RSTKPKDREIKSYKDLSRGDVVRGFIKAVSDKGIFVYLSTSVQAFVPVSKL
Sbjct: 1141 KDKKVKLSLRSTKPKDREIKSYKDLSRGDVVRGFIKAVSDKGIFVYLSTSVQAFVPVSKL 1200

Query: 1201 TDSFIKDWKKFYKPMQPVTGKVVNCEEESRILLTLKESEVNGDLNILKGYSNIQAGEIFE 1260
            TDSFIKDWKKFYKPMQPVTGKVVNCEEESRILLTLKESEVNGDLNILKGYSNIQAGEIFE
Sbjct: 1201 TDSFIKDWKKFYKPMQPVTGKVVNCEEESRILLTLKESEVNGDLNILKGYSNIQAGEIFE 1260

Query: 1261 GYITNVTDFGVFVKLNNTLNVTGLAHRSQIADSQVDDLSALFGEGDKVKAIVLKTNPEKK 1320
            GYITNVTDFGVFVKLNNTLNVTGLAHRSQIADSQVDDLSALFGEGDKVKAIVLKTNPEKK
Sbjct: 1261 GYITNVTDFGVFVKLNNTLNVTGLAHRSQIADSQVDDLSALFGEGDKVKAIVLKTNPEKK 1320

Query: 1321 QVSLGLKASYFKKEVEKNQXXXXXXXXXXXXXXXXXXXXXXVDYXXXXXXXXXXXXXATS 1380
            QVSLGLKASYFKKEVEKNQ                      VDY             ATS
Sbjct: 1321 QVSLGLKASYFKKEVEKNQEVEDVEMEDVAENESEEDEIIAVDYENESELEAEPEKEATS 1380

Query: 1381 QSSKVPVTNDGLSLSTGFDWTASILDQAQXXXXXXXXXXFANTKKSRNRKKGRTNAVEDK 1440
            QSSKVPVTNDGLSLSTGFDWTASILDQAQ          FANTKKSRNRKKGRTNAVEDK
Sbjct: 1381 QSSKVPVTNDGLSLSTGFDWTASILDQAQEDEESSEDEDFANTKKSRNRKKGRTNAVEDK 1440

Query: 1441 TIDINTRAPESVSDFERLIMGNPNSSVVWMNYMAFQLQLSEVDKAREIAERALKTISFRD 1500
            TIDINTRAPESVSDFERLIMGNPNSSVVWMNYMAFQLQLSEVDKAREIAERALKTISFRD
Sbjct: 1441 TIDINTRAPESVSDFERLIMGNPNSSVVWMNYMAFQLQLSEVDKAREIAERALKTISFRD 1500

Query: 1501 ELEKLNIWIAMLNLENTFGTEETLDDAFKRSCQYMDSFTMHNKLISIYQLSEKFERAAEL 1560
            ELEKLNIWIAMLNLENTFGTEETLDDAFKRSCQYMDSFTMHNKLISIYQLSEKFERAAEL
Sbjct: 1501 ELEKLNIWIAMLNLENTFGTEETLDDAFKRSCQYMDSFTMHNKLISIYQLSEKFERAAEL 1560

Query: 1561 YRATAKKFGSQKVSIWVSWGEFLISRNQNDEAHAVLGNALKALPKRDHIEVVRKFAQLEF 1620
            YRATAKKFGSQKVSIWVSWGEFLISRNQNDEAHAVLGNALKALPKRDHIEVVRKFAQLEF
Sbjct: 1561 YRATAKKFGSQKVSIWVSWGEFLISRNQNDEAHAVLGNALKALPKRDHIEVVRKFAQLEF 1620

Query: 1621 SKGDAEQGRSLFEGLLADAPKRIDLWNVYIDQETKAGEKKKVEDLFERIISKKITRKQAK 1680
            SKGDAEQGRSLFEGLLADAPKRIDLWNVYIDQETKAGEKKKVEDLFERIISKKITRKQAK
Sbjct: 1621 SKGDAEQGRSLFEGLLADAPKRIDLWNVYIDQETKAGEKKKVEDLFERIISKKITRKQAK 1680

Query: 1681 FFFNKWLQFEESKNDQXXXXXXXXXXXXFVQKSQPNVDEE 1720
            FFFNKWLQFEESKNDQ            FVQKSQPNVDEE
Sbjct: 1681 FFFNKWLQFEESKNDQKAAEYVKAKAAEFVQKSQPNVDEE 1720

>Kwal_26.9189
          Length = 1726

 Score = 2192 bits (5679), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1078/1728 (62%), Positives = 1324/1728 (76%), Gaps = 26/1728 (1%)

Query: 4    SNNKRKRDDESPLTRQDNTSQPVKSSLLQSSEETSFPRGGASVLTPLELKQVANEAASDV 63
            S  KRKR +ESPLTRQD T QP  SSLLQ+++E SFPRGGAS LTPLELKQVANEAA DV
Sbjct: 3    SGQKRKRVEESPLTRQDQTQQP-SSSLLQNADEGSFPRGGASALTPLELKQVANEAAGDV 61

Query: 64   LFDNGTSSAVKPEV---ERPXXXXXXXXXXXXXXNETDEEEST-TIVEHISFKNLTPGSQ 119
            LF  G  SA    V   +RP               + D E+S+ T+++H++F+NL  G+ 
Sbjct: 62   LF--GAESAAPAPVSDSQRPKKKKKTHQKSATKAADEDSEDSSVTVIDHLNFRNLPVGTL 119

Query: 120  LLGQISAVNKHDLCISLSDNLCGYVTLANISEQFTNLLEELDENMXXXXXXXXXXXXXXX 179
            LLGQIS VNKHDLC+SLSDNLCG+VTL +ISE FT LLE+LDE+M               
Sbjct: 120  LLGQISQVNKHDLCVSLSDNLCGFVTLPSISEPFTKLLEDLDESMNSDGEEEVNGSEAEY 179

Query: 180  XXXXXHSK-----NKKNKELPDLKKYFKPGQWLRCTVQSNTALEA-KKKQKRIELTIEPS 233
                  SK     + K KELPDL+++F  GQWLRC+VQSN+AL+   KK KRIEL+IEPS
Sbjct: 180  DSDEESSKASRAQDTKGKELPDLQRFFSQGQWLRCSVQSNSALDKDNKKSKRIELSIEPS 239

Query: 234  ATNQLADEDLSRNCTVQCSVKSIEDHGAILDLGIKGITGFISKKDYPGVEELLPGTVFLG 293
             TNQL +EDL RNCTVQC+VKSIEDHGAILDLGI+GITGFISKKDY  +  LLPG+VFL 
Sbjct: 240  ITNQLVEEDLVRNCTVQCAVKSIEDHGAILDLGIEGITGFISKKDYALLPNLLPGSVFLA 299

Query: 294  NVAKRSDRTVNVNFDFTSKNNKVSHISSIDAVIPGQSVDFLCQKISSNGIFGKTFGLVSG 353
            NVAK+S RT  VNFDF +K +KVSHISSIDA+IPGQ+VDFLCQK +SNG+ GK FGLV G
Sbjct: 300  NVAKKSGRTATVNFDFKNKKSKVSHISSIDAIIPGQAVDFLCQKKTSNGVIGKVFGLVDG 359

Query: 354  FLGASHLRTF--SADKIKHNYAIGSNIRARIVATLTNKKGEKIILVSTLPHILSLETKIL 411
            FL  S    F  S  K    Y++GSN R RI+ATL NK GEK ++VS LPHILS  T+ L
Sbjct: 360  FLNVSQQSAFYSSGKKNDEAYSVGSNTRVRILATLMNKAGEKFVVVSELPHILSFATEAL 419

Query: 412  EADALDAFPVGYILESCTVKGRDSQYFYLSMDQDRIGQVHISRVGDEDPAGEVKARVMGY 471
            E  AL+AFPVGYI E C + GRDSQYFYL ++ D +GQVHIS++G E+P+G+V+ARV+GY
Sbjct: 420  ERPALNAFPVGYIFEDCDLMGRDSQYFYLKINNDLVGQVHISKIGTEEPSGKVRARVLGY 479

Query: 472  NVVDGYYQLSTDPKVLELKYLRTKDIPLGEVISGCEIVTVSDKGIQLTLFGSQFKAFVPP 531
            N +DGYYQLSTDPK L +KYLRT DIP+G +I  CEI  VSDKGIQL++ G QFKA VPP
Sbjct: 480  NNLDGYYQLSTDPKTLSVKYLRTSDIPVGTIIPSCEITQVSDKGIQLSILGGQFKASVPP 539

Query: 532  LHISDVKLVYPERKFKIGSKVKGRVLNVDNRGRVTVTLKKSLVNLDEDEIKLVSNFKQIE 591
            LHISD++LVYPERKFKIGSKVK  +++ +NRG + V+LKKSLVNLD +E++L S+F+ I+
Sbjct: 540  LHISDIRLVYPERKFKIGSKVKAILISANNRGHLFVSLKKSLVNLDREEVQLASSFQDID 599

Query: 592  KLADNDEKTSATVEFFKTNGCVVSFLGNLKGFLPNGEISEAFVKRPQDHLRLGQTVMVKV 651
            ++A +  K +ATV+ FKTNGCVVSFLG L+GFLPN EISEAFVKRPQDHLRLGQTV+VKV
Sbjct: 600  RIATDGLKVAATVDIFKTNGCVVSFLGGLRGFLPNSEISEAFVKRPQDHLRLGQTVIVKV 659

Query: 652  LQHDEEKNRVIITCKVSSDAAAQQKDAIENMVIGRSIVTVTVVGKTKDSAVIELVDVGLR 711
            LQH+ ++NRVI+TCKVSS+AA+QQK+AIENM++GRSI+ V VV KTKDS V+E V VGLR
Sbjct: 660  LQHNAQQNRVIVTCKVSSEAASQQKEAIENMIVGRSIIKVAVVEKTKDSLVVEQVGVGLR 719

Query: 712  GVIYVGHLSDSRIEQNRAQLKKLRVGTELEGLVIDKDIRTRVFNLSCKKSLIKDAQNGLL 771
            GV+YVGHLSDSRIEQNRAQLKK+++G E EGLVIDKD RTRVFNLSCKKSLIKDA+  LL
Sbjct: 720  GVVYVGHLSDSRIEQNRAQLKKIKIGNEFEGLVIDKDARTRVFNLSCKKSLIKDAEKSLL 779

Query: 772  PLSYDEVKAKGNSFPMHGYVKSFSDKGIFVAFSGRFVGLVLPSYAVESRDVDILKKFHIN 831
            P++Y +VK +G    M+GYVKS S+KG+FVAF+G+FVGLVLPSYAV+SRDVD+  KF+ N
Sbjct: 780  PVNYQDVKERGTHSAMNGYVKSVSEKGVFVAFNGQFVGLVLPSYAVDSRDVDLASKFYSN 839

Query: 832  QSITAYLLRTDDENERFLLTLKEPKVAEKRQDNGSV-NAVNPIDESVKELSEYXXXXXXX 890
            QS+T YLLRTDD NERFLLT+KEPK  +  +    V  AVNP+D S+K+LS++       
Sbjct: 840  QSVTVYLLRTDDANERFLLTMKEPKNEKSSKPIPEVRGAVNPVDSSIKDLSDFSVGKITK 899

Query: 891  XXXXXXXXNQLNVLLADNLHGRVDVSEIFDKFENIKDTKAPLSCYKKGDVIEVKVIGYHD 950
                    NQLNV+L+DNLHGR+D+SE+FDK E+I DTK+PL+ +KKGD+++VKVIGYHD
Sbjct: 900  AMVKAVKRNQLNVVLSDNLHGRIDISEVFDKIEDISDTKSPLATFKKGDLLDVKVIGYHD 959

Query: 951  IKTHRFLPISHRASKNTILELTAKPSKLTEENESSLTIKNVKENDELVGFVNNFSKGFLW 1010
            +KTH+FLP+SHR+SKN +LELTAKPS+L       + I NVK  D +VGFVNN SK  LW
Sbjct: 960  VKTHKFLPVSHRSSKNVLLELTAKPSRLN--GAGGVAIDNVKVGDSIVGFVNNISKDILW 1017

Query: 1011 LTLSPVLKAKISNINLSDDGSTFASDIPESFPLGSALKVKAVDIDTEHNVVSVTGRFHSI 1070
            LT+SPVLKAKI   +L+D+ S   ++I ++FPLGSAL+   V ID + N +SV+GR HS+
Sbjct: 1018 LTVSPVLKAKIDFFDLTDESSQHNANIEDAFPLGSALRATVVKIDQDRNTLSVSGRSHSV 1077

Query: 1071 KDITDVKVGDKLPARIIMIADSYLLLDLGNDLKGISFVTEALDDYSVSLKTAFENRKNSI 1130
             DI D+ VGD LPAR++ +ADSYLLL++G D+KG++FVT+ALDDY+ SLK  + N+KN+I
Sbjct: 1078 SDIKDINVGDNLPARLLNVADSYLLLEVGKDVKGVAFVTDALDDYTKSLKDVYGNQKNNI 1137

Query: 1131 VPATVIXXXXXXXXXXXXXRSTKPKDREIKSYKDLSRGDVVRGFIKAVSDKGIFVYLSTS 1190
              A VI             RS   +D  +K++KDL RG +VRG +K  +DKGIFVYLS+S
Sbjct: 1138 FSAKVISVDTKNGKLNLSLRSEDAQDGNVKTHKDLKRGQIVRGLVKKATDKGIFVYLSSS 1197

Query: 1191 VQAFVPVSKLTDSFIKDWKKFYKPMQPVTGKVVNCEEESRILLTLKESEVNGDLNILKGY 1250
            +QAFVPVSKLTDS+IK+WKKFY+PMQ V GK+VNC+++S IL TLKESEVNG LNILK Y
Sbjct: 1198 LQAFVPVSKLTDSYIKEWKKFYRPMQSVVGKIVNCDDDSHILATLKESEVNGTLNILKNY 1257

Query: 1251 SNIQAGEIFEGYITNVTDFGVFVKLNNTLNVTGLAHRSQIADSQVDDLSALFGEGDKVKA 1310
            ++I+ GEIFEG + NVTDFG+FVKL+NT+NVTGLAH+S++AD+ V+DLS +FG GDKVKA
Sbjct: 1258 ADIKVGEIFEGSVKNVTDFGLFVKLDNTMNVTGLAHKSEVADAPVNDLSTIFGAGDKVKA 1317

Query: 1311 IVLKTNPEKKQVSLGLKASYFKK------EVEKNQXXXXXXXXXXXXXXXXXXXXXXVDY 1364
            +VLK N EKKQ+SLGLKASYFK+      ++E +                          
Sbjct: 1318 VVLKVNAEKKQLSLGLKASYFKENKNTSPKLENSDVVSEDEVDDERDVDSASEDLVEEIG 1377

Query: 1365 XXXXXXXXXXXXXATSQSSKVPVTNDGLSLSTGFDWTASILDQAQXXXXXXXXXXFANTK 1424
                           + +    ++ DGLSLS GFDWT SILDQAQ          F  TK
Sbjct: 1378 QESEPEEMEDIAEDENHNGGKALSTDGLSLSAGFDWTTSILDQAQ-DEDSSDEEDFTETK 1436

Query: 1425 KSRNRKKGRTNAVEDKTIDINTRAPESVSDFERLIMGNPNSSVVWMNYMAFQLQLSEVDK 1484
            KS+ +K+     VED+TIDINTRAPESV DFER+IMGNPNSSVVWMN+MAFQLQL E+DK
Sbjct: 1437 KSKKKKRS-VGGVEDQTIDINTRAPESVGDFERMIMGNPNSSVVWMNFMAFQLQLGEIDK 1495

Query: 1485 AREIAERALKTISFRDELEKLNIWIAMLNLENTFGTEETLDDAFKRSCQYMDSFTMHNKL 1544
            AR++AERALKTISFR+E EK+NIWI MLNLENTFG E +L++ F R+CQYMDS+ +H KL
Sbjct: 1496 ARDVAERALKTISFREEAEKMNIWIGMLNLENTFGNESSLNEVFSRACQYMDSYVIHTKL 1555

Query: 1545 ISIYQLSEKFERAAELYRATAKKFGSQKVSIWVSWGEFLISRNQNDEAHAVLGNALKALP 1604
            I+IYQ+S   ++AA L++ATAKKFGS+KV IWVSWGEFLI + Q DEAH VL +ALK+LP
Sbjct: 1556 INIYQMSHNIDKAAALFKATAKKFGSEKVPIWVSWGEFLIDQGQADEAHQVLASALKSLP 1615

Query: 1605 KRDHIEVVRKFAQLEFSKGDAEQGRSLFEGLLADAPKRIDLWNVYIDQETKAGEKKKVED 1664
            +R HIEVVRKFAQLEF+KGD EQGRSLFEGLLAD PKRIDLWNVY+DQE KAG+KKKVED
Sbjct: 1616 RRHHIEVVRKFAQLEFAKGDQEQGRSLFEGLLADTPKRIDLWNVYVDQEIKAGDKKKVED 1675

Query: 1665 LFERIISKKITRKQAKFFFNKWLQFEESKNDQXXXXXXXXXXXXFVQK 1712
            LFERI+++K+TRKQAKFFF KWL+FEES +DQ            FV+K
Sbjct: 1676 LFERIVNRKLTRKQAKFFFGKWLEFEESADDQKTAEYVKAKASEFVEK 1723

>YMR229C (RRP5) [4185] chr13 complement(725933..731122) Protein
            required for processing of pre-rRNA to 18S and 5.8S rRNA,
            component of U3 snoRNP (also called small subunit
            processome), which is required for 18S rRNA biogenesis
            [5190 bp, 1729 aa]
          Length = 1729

 Score = 2077 bits (5381), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1012/1705 (59%), Positives = 1292/1705 (75%), Gaps = 14/1705 (0%)

Query: 4    SNNKRKRDDESPLTRQDNTSQPVKSSLLQSSEETSFPRGGASVLTPLELKQVANEAASDV 63
            ++ KRKRD++ PL+R+D+T QP  SSL++++EE SFPRGGAS LTPLELKQVANEAASDV
Sbjct: 3    ASTKRKRDEDFPLSREDSTKQPSTSSLVRNTEEVSFPRGGASALTPLELKQVANEAASDV 62

Query: 64   LFDNGTSSAVKPEVERPXXXXXXXXXXXXXXNETD----EEESTTIVEHISFKNLTPGSQ 119
            LF N +  A +P   RP              +E      +E    ++EH++FK L  GS 
Sbjct: 63   LFGNESVKASEP-ASRPLKKKKTTKKSTSKDSEASSANSDEARAGLIEHVNFKTLKNGSS 121

Query: 120  LLGQISAVNKHDLCISLSDNLCGYVTLANISEQFTNLLEELDENMXXXXXXXXXXXXXXX 179
            LLGQISA+ K DLCI+ +D + GYV L +ISE+FT++LE+LDE+M               
Sbjct: 122  LLGQISAITKQDLCITFTDGISGYVNLTHISEEFTSILEDLDEDMDSDTDAADEKKSKVE 181

Query: 180  XXXXXHSKNK-----KNKELPDLKKYFKPGQWLRCTVQSNTALEA---KKKQKRIELTIE 231
                  S ++     K+ ELP+L++YF  GQWLRC+V  NT+LE    K K+KRIELTIE
Sbjct: 182  DAEYESSDDEDEKLDKSNELPNLRRYFHIGQWLRCSVIKNTSLEPSTKKSKKKRIELTIE 241

Query: 232  PSATNQLADEDLSRNCTVQCSVKSIEDHGAILDLGIKGITGFISKKDYPGVEELLPGTVF 291
            PS+ N  ADEDL ++ ++QC+VKSIEDHGA LD+G+ G TGFI+KKD+   E+LLPG VF
Sbjct: 242  PSSVNIYADEDLVKSTSIQCAVKSIEDHGATLDVGLPGFTGFIAKKDFGNFEKLLPGAVF 301

Query: 292  LGNVAKRSDRTVNVNFDFTSKNNKVSHISSIDAVIPGQSVDFLCQKISSNGIFGKTFGLV 351
            LGN+ K+SDR++ VN DF+ K NK++ ISSIDA+IPGQ VD LC+ I+ NGI GK FGLV
Sbjct: 302  LGNITKKSDRSIVVNTDFSDKKNKITQISSIDAIIPGQIVDLLCESITKNGIAGKVFGLV 361

Query: 352  SGFLGASHLRTFSADKIKHNYAIGSNIRARIVATLTNKKGEKIILVSTLPHILSLETKIL 411
            SG +  SHLRTFS + +KH + IGS+IR RI+A L NK G+K++++S LPHIL LE  + 
Sbjct: 362  SGVVNVSHLRTFSEEDLKHKFVIGSSIRCRIIACLENKSGDKVLILSNLPHILKLEDALR 421

Query: 412  EADALDAFPVGYILESCTVKGRDSQYFYLSMDQDRIGQVHISRVGDEDPAGEVKARVMGY 471
              + LDAFP+GY  ESC++KGRDS+Y YL++D DR+G+VH SRVG+ + +  + +RV+GY
Sbjct: 422  STEGLDAFPIGYTFESCSIKGRDSEYLYLALDDDRLGKVHSSRVGEIENSENLSSRVLGY 481

Query: 472  NVVDGYYQLSTDPKVLELKYLRTKDIPLGEVISGCEIVTVSDKGIQLTLFGSQFKAFVPP 531
            + VD  YQLSTDPK L+LKYLRT DIP+GE++  CEI +VS  GI+L +F  QFKA VPP
Sbjct: 482  SPVDDIYQLSTDPKYLKLKYLRTNDIPIGELLPSCEITSVSSSGIELKIFNGQFKASVPP 541

Query: 532  LHISDVKLVYPERKFKIGSKVKGRVLNVDNRGRVTVTLKKSLVNLDEDEIKLVSNFKQIE 591
            LHISD +LVYPERKFKIGSKVKGRV++V++RG V VTLKKSLVN++++E+ LVS ++  +
Sbjct: 542  LHISDTRLVYPERKFKIGSKVKGRVISVNSRGNVHVTLKKSLVNIEDNELPLVSTYENAK 601

Query: 592  KLADNDEKTSATVEFFKTNGCVVSFLGNLKGFLPNGEISEAFVKRPQDHLRLGQTVMVKV 651
             + + +EKT AT++ FK NGC++SF G L GFLPN EISE FVKRP++HLRLGQTV+VK+
Sbjct: 602  NIKEKNEKTLATIQVFKPNGCIISFFGGLSGFLPNSEISEVFVKRPEEHLRLGQTVIVKL 661

Query: 652  LQHDEEKNRVIITCKVSSDAAAQQKDAIENMVIGRSIVTVTVVGKTKDSAVIELVDVGLR 711
            L  D ++ R+I TCKVS++ AAQQKD IEN+V GR+I+TV V+ KTKDS ++E+ DVGLR
Sbjct: 662  LDVDADRRRIIATCKVSNEQAAQQKDTIENIVPGRTIITVHVIEKTKDSVIVEIPDVGLR 721

Query: 712  GVIYVGHLSDSRIEQNRAQLKKLRVGTELEGLVIDKDIRTRVFNLSCKKSLIKDAQNGLL 771
            GVIYVGHLSDSRIEQNRAQLKKLR+GTEL GLVIDKD RTRVFN+S K SLIKDA+   L
Sbjct: 722  GVIYVGHLSDSRIEQNRAQLKKLRIGTELTGLVIDKDTRTRVFNMSLKSSLIKDAKKETL 781

Query: 772  PLSYDEVKAKGNSFPMHGYVKSFSDKGIFVAFSGRFVGLVLPSYAVESRDVDILKKFHIN 831
            PL+YD+VK      PMH Y+KS SDKG+FVAF+G+F+GLVLPSYAV+SRD+DI K F+IN
Sbjct: 782  PLTYDDVKDLNKDVPMHAYIKSISDKGLFVAFNGKFIGLVLPSYAVDSRDIDISKAFYIN 841

Query: 832  QSITAYLLRTDDENERFLLTLKEPKVAEKRQDNGSVNAVNPIDESVKELSEYXXXXXXXX 891
            QS+T YLLRTDD+N++FLL+LK PKV E+++   S N  +P+D S+K   +         
Sbjct: 842  QSVTVYLLRTDDKNQKFLLSLKAPKVKEEKKKVES-NIEDPVDSSIKSWDDLSIGSIVKA 900

Query: 892  XXXXXXXNQLNVLLADNLHGRVDVSEIFDKFENIKDTKAPLSCYKKGDVIEVKVIGYHDI 951
                   NQLNV+LA NLHGRVD++E+FD +E I D K PLS YKK DVI+VK+IG HD+
Sbjct: 901  KIKSVKKNQLNVILAANLHGRVDIAEVFDTYEEITDKKQPLSNYKKDDVIKVKIIGNHDV 960

Query: 952  KTHRFLPISHRASKNTILELTAKPSKLTEENESSLTIKNVKENDELVGFVNNFSKGFLWL 1011
            K+H+FLPI+H+ SK ++LEL+ KPS+L  +   + +++ +    EL GFVNN S   LWL
Sbjct: 961  KSHKFLPITHKISKASVLELSMKPSELKSKEVHTKSLEEINIGQELTGFVNNSSGNHLWL 1020

Query: 1012 TLSPVLKAKISNINLSDDGSTFASDIPESFPLGSALKVKAVDIDTEHNVVSVTGRFHSIK 1071
            T+SPVLKA+IS ++L+D+ S F+ +I   FPLGSAL+VK   ID EH  V+  G+ H   
Sbjct: 1021 TISPVLKARISLLDLADNDSNFSENIESVFPLGSALQVKVASIDREHGFVNAIGKSHVDI 1080

Query: 1072 DITDVKVGDKLPARIIMIADSYLLLDLGNDLKGISFVTEALDDYSVSLKTAFENRKNSIV 1131
            +++ +KVGD+LP R++ IA+ Y+LLDLGN + GISF+T+AL+D+S++LK AFE++ N+++
Sbjct: 1081 NMSTIKVGDELPGRVLKIAEKYVLLDLGNKVTGISFITDALNDFSLTLKEAFEDKINNVI 1140

Query: 1132 PATVIXXXXXXXXXXXXXRSTKPKDREIKSYKDLSRGDVVRGFIKAVSDKGIFVYLSTSV 1191
            P TV+             R    K R IKS++DL +G++V G +K V+DKGIFVYLS  V
Sbjct: 1141 PTTVLSVDEQNKKIELSLRPATAKTRSIKSHEDLKQGEIVDGIVKNVNDKGIFVYLSRKV 1200

Query: 1192 QAFVPVSKLTDSFIKDWKKFYKPMQPVTGKVVNCEEESRILLTLKESEVNGDLNILKGYS 1251
            +AFVPVSKL+DS++K+WKKFYKPMQ V GKVV C+E+SRI LTL+ESE+NGDL +LK YS
Sbjct: 1201 EAFVPVSKLSDSYLKEWKKFYKPMQYVLGKVVTCDEDSRISLTLRESEINGDLKVLKTYS 1260

Query: 1252 NIQAGEIFEGYITNVTDFGVFVKLNNTLNVTGLAHRSQIADSQVDDLSALFGEGDKVKAI 1311
            +I+AG++FEG I +VTDFGVFVKL+NT+NVTGLAH ++IAD + +DLSALFG GD+VKAI
Sbjct: 1261 DIKAGDVFEGTIKSVTDFGVFVKLDNTVNVTGLAHITEIADKKPEDLSALFGVGDRVKAI 1320

Query: 1312 VLKTNPEKKQVSLGLKASYFKKEVEKNQXXXXXXXXXXXXXXXXXXXXXXVDYXXXXXXX 1371
            VLKTNPEKKQ+SL LKAS+F KE E                           +       
Sbjct: 1321 VLKTNPEKKQISLSLKASHFSKEAELASTTTTTTTVDQLEKEDEDEVMADAGFNDSDSES 1380

Query: 1372 XXXXXXATSQSSKVPVTNDGLSLSTGFDWTASILDQAQXXXXXXXXXXFANTKKSRNRKK 1431
                        K   ++DGLSLS GFDWTASILDQAQ               K    K+
Sbjct: 1381 DIGDQNTEVADRKPETSSDGLSLSAGFDWTASILDQAQEEEESDQDQEDFTENKKHKHKR 1440

Query: 1432 GRTNAVEDKTIDINTRAPESVSDFERLIMGNPNSSVVWMNYMAFQLQLSEVDKAREIAER 1491
             + N V+DKTIDINTRAPESV+DFERL++GNPNSSVVWMNYMAFQLQLSE++KARE+AER
Sbjct: 1441 RKENVVQDKTIDINTRAPESVADFERLLIGNPNSSVVWMNYMAFQLQLSEIEKARELAER 1500

Query: 1492 ALKTISFRDELEKLNIWIAMLNLENTFGTEETLDDAFKRSCQYMDSFTMHNKLISIYQLS 1551
            ALKTI+FR+E EKLNIWIAMLNLENTFGTEETL++ F R+CQYMDS+T+H KL+ IY++S
Sbjct: 1501 ALKTINFREEAEKLNIWIAMLNLENTFGTEETLEEVFSRACQYMDSYTIHTKLLGIYEIS 1560

Query: 1552 EKFERAAELYRATAKKFGSQKVSIWVSWGEFLISRNQNDEAHAVLGNALKALPKRDHIEV 1611
            EKF++AAEL++ATAKKFG +KVSIWVSWG+FLIS N+  EA  +LGNALKALPKR+HIEV
Sbjct: 1561 EKFDKAAELFKATAKKFGGEKVSIWVSWGDFLISHNEEQEARTILGNALKALPKRNHIEV 1620

Query: 1612 VRKFAQLEFSKGDAEQGRSLFEGLLADAPKRIDLWNVYIDQETKAGEKKKVEDLFERIIS 1671
            VRKFAQLEF+KGD E+GRSLFEGL+ADAPKRIDLWNVY+DQE KA +KKKVEDLFERII+
Sbjct: 1621 VRKFAQLEFAKGDPERGRSLFEGLVADAPKRIDLWNVYVDQEVKAKDKKKVEDLFERIIT 1680

Query: 1672 KKITRKQAKFFFNKWLQFEESKNDQ 1696
            KKITRKQAKFFFNKWLQFEES+ D+
Sbjct: 1681 KKITRKQAKFFFNKWLQFEESEGDE 1705

>AFR566C [3758] [Homologous to ScYMR229C (RRP5) - SH]
            (1449324..1454474) [5151 bp, 1716 aa]
          Length = 1716

 Score = 2073 bits (5371), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1034/1730 (59%), Positives = 1289/1730 (74%), Gaps = 31/1730 (1%)

Query: 4    SNNKRKRDDESPLTRQDNTSQPVKSSLLQSSEETSFPRGGASVLTPLELKQVANEAASDV 63
            S NKRK ++E     +    Q    S+L S  + +FPRGGAS LTPLELKQVANEAASDV
Sbjct: 5    SVNKRKLNNEQR-PEEAAGRQMASKSVLASGGDVAFPRGGASALTPLELKQVANEAASDV 63

Query: 64   LF--DNGTSSAVKPEVERPXXXXXXXXXXXXXXNETDEEESTTIVEHISFKNLTPGSQLL 121
            LF  D+G     KP  ERP                  +E+ T IVEH+SFK LT G+ LL
Sbjct: 64   LFGRDDG-----KPAEERPRKKKKTSKASKEDA-VAGKEDRTDIVEHLSFKGLTSGTVLL 117

Query: 122  GQISAVNKHDLCISLSDNLCGYVTLANISEQFTNLLEELDENMXXXXXXXXXXXXXXXXX 181
            GQ+  VN+ DLCI+L+D L GYV L NIS  FT+LLE+LD++M                 
Sbjct: 118  GQLCGVNRTDLCIALTDGLRGYVPLTNISAPFTSLLEQLDQSMDSGSEDEDDDSDDEQ-- 175

Query: 182  XXXHSKNKKNKELPDLKKYFKPGQWLRCTVQSNTALEA-KKKQKRIELTIEPSATNQLAD 240
                 K     ELP+L KYF  GQWLRC V  N+AL++ KKK  RIEL+IEPS  N    
Sbjct: 176  ---RDKPHTITELPELSKYFTLGQWLRCVVVKNSALDSQKKKNSRIELSIEPSKVNLFET 232

Query: 241  EDLSRNCTVQCSVKSIEDHGAILDLGIKGITGFISKKDYPGVEELLPGTVFLGNVAKRSD 300
            EDL+++ TVQC+VKSIEDHGA+LDLG++ +TGFIS KD   + +++PG+VFL N+ KR D
Sbjct: 233  EDLAKHTTVQCAVKSIEDHGALLDLGVQDVTGFISNKDLSKMGDVMPGSVFLANITKRGD 292

Query: 301  RTVNVNFDFTSKNNKVSHISSIDAVIPGQSVDFLCQKISSNGIFGKTFGLVSGFLGASHL 360
            RT  VNF+FT+KN+KVS ISS+DAVIPG ++DFLC+KI+++GI GK FG++ GFL  S  
Sbjct: 293  RTATVNFEFTAKNSKVSQISSVDAVIPGHTIDFLCEKITNHGIIGKAFGVLDGFLSESQA 352

Query: 361  RTFSADKIKHNYAIGSNIRARIVATLTNKKGEKIILVSTLPHILSLETKILEADALDAFP 420
            R FS   +KH YAIGSNI+ RI+ATL  K+G K+ILVS LPHILSLE  +LE +A+ AFP
Sbjct: 353  RVFSVTDMKHKYAIGSNIKVRIIATLRTKQGNKVILVSALPHILSLERNLLETEAMHAFP 412

Query: 421  VGYILESCTVKGRDSQYFYLSMDQDRIGQVHISRVGDEDPAGEVKARVMGYNVVDGYYQL 480
            VGY+ ++C + GRDSQY Y+S+  +RIGQ+HIS+ GD      VKARV GYN VDGYYQL
Sbjct: 413  VGYVFDNCKLLGRDSQYLYVSLSDERIGQIHISKAGDAITQEAVKARVTGYNTVDGYYQL 472

Query: 481  STDPKVLELKYLRTKDIPLGEVISGCEIVTVSDKGIQLTLFGSQFKAFVPPLHISDVKLV 540
            ++DPK+L   YLR+ DIP+G ++SGCEI  VS  GI+L+LF  QFKAFV PLHISD++LV
Sbjct: 473  TSDPKLLAKPYLRSADIPVGTILSGCEITAVSGNGIELSLFDGQFKAFVAPLHISDIRLV 532

Query: 541  YPERKFKIGSKVKGRVLNVDNRGRVTVTLKKSLVNLDEDEIKLVSNFKQIEKLADNDEKT 600
            YPERKFKIGSKVKGRVL+VDN+GRV VTLKKSLV+ ++ +I LVS+F+QI KLA+ D KT
Sbjct: 533  YPERKFKIGSKVKGRVLHVDNKGRVYVTLKKSLVSANDSDIPLVSDFEQIAKLAEEDGKT 592

Query: 601  SATVEFFKTNGCVVSFLGNLKGFLPNGEISEAFVKRPQDHLRLGQTVMVKVLQHDEEKNR 660
             ATVE FK +GCVV+FLGNLK FLPN EISEAFV+R QDHLRLGQTV+VKVL+H  ++++
Sbjct: 593  LATVESFKPSGCVVTFLGNLKAFLPNKEISEAFVQRAQDHLRLGQTVVVKVLEHVAKQSK 652

Query: 661  VIITCKVSSDAAAQQKDAIENMVIGRSIVTVTVVGKTKDSAVIELVDVGLRGVIYVGHLS 720
            VI+T KVSS+ + +QK AI ++V+GRSIV VTVV KTKDS V+EL DVGLRGVIYVGHLS
Sbjct: 653  VIVTRKVSSEDSEKQKAAINDLVVGRSIVDVTVVEKTKDSVVVELNDVGLRGVIYVGHLS 712

Query: 721  DSRIEQNRAQLKKLRVGTELEGLVIDKDIRTRVFNLSCKKSLIKDAQNGLLPLSYDEVKA 780
            DS++EQNRA LKKLR+G+ L+G+V+DKD++TRVFN+SCKKSLIKDA   +LPL++ ++K 
Sbjct: 713  DSKLEQNRALLKKLRIGSSLQGVVMDKDVKTRVFNMSCKKSLIKDASKDILPLTFVDIKD 772

Query: 781  KGNSFPMHGYVKSFSDKGIFVAFSGRFVGLVLPSYAVESRDVDILKKFHINQSITAYLLR 840
            K  + PMHGYVKS SD+GIFVAF+G+FVGLVLPSYA ESRDVDI KKF+INQS+T YLLR
Sbjct: 773  KDPNTPMHGYVKSISDRGIFVAFTGKFVGLVLPSYATESRDVDIFKKFYINQSVTVYLLR 832

Query: 841  TDDENERFLLTLKEPKVAEKRQD-NGSVNAVNPIDESVKELSEYXXXXXXXXXXXXXXXN 899
            TD+ENERFLLT+  P+ + K++D N  V AVNP+D SVK +S+Y                
Sbjct: 833  TDEENERFLLTMSPPQTSNKKEDSNHDVAAVNPVDASVKIISQYSVGTVTKARVKSVKKT 892

Query: 900  QLNVLLADNLHGRVDVSEIFDKFENIKDTKAPLSCYKKGDVIEVKVIGYHDIKTHRFLPI 959
            QLNV+LADNLHGRVD SEI+D FE I++ K PL+ +K GDVI+VKVIG+HD KTH+FLPI
Sbjct: 893  QLNVVLADNLHGRVDASEIYDTFEEIENPKEPLAKFKSGDVIDVKVIGFHDSKTHKFLPI 952

Query: 960  SHRASKNTILELTAKPSKLTEENESSLTIKNVKENDELVGFVNNFSKGFLWLTLSPVLKA 1019
            SHR   NT+LEL+AK S L    +  +    +K  DEL+GFVNNF+KGF+WLTLSP LKA
Sbjct: 953  SHRTGVNTVLELSAKKSALKGAYQ-PIEFSGMKNGDELIGFVNNFAKGFIWLTLSPALKA 1011

Query: 1020 KISNINLSDDGSTFASDIPESFPLGSALKVKAVDIDTEHNVVSVTGRFHSIKDITDVKVG 1079
            KI +  LSDDGS F  ++ ESFPLG ALKVK  ++D  H +VSV+ R H+I DI D+KV 
Sbjct: 1012 KIPDFELSDDGSVFTGNLDESFPLGCALKVKVKELDPAHKIVSVSARKHAITDIKDIKVA 1071

Query: 1080 DKLPARIIMIADSYLLLDLGNDLKGISFVTEALDDYSVSLKTAFENRKNSIVPATVIXXX 1139
            DKLPARI+ +ADSYLLLDLGN L G++FVT+AL+++S+SL++ +E++  S++ A+V+   
Sbjct: 1072 DKLPARIVKVADSYLLLDLGNRLTGVAFVTDALNEFSLSLRSVYEDKIGSMILASVVGVD 1131

Query: 1140 XXXXXXXXXXRSTKPKDREIKSYKDLSRGDVVRGFIKAVSDKGIFVYLSTSVQAFVPVSK 1199
                      R+    DR I S+KDL +GDVVRGFIK+V+DKGIFVYLS ++QAFVPVSK
Sbjct: 1132 VENKKINLSLRTEDATDRYILSHKDLKQGDVVRGFIKSVTDKGIFVYLSRTLQAFVPVSK 1191

Query: 1200 LTDSFIKDWKKFYKPMQPVTGKVVNCEEESRILLTLKESEVNGDLNILKGYSNIQAGEIF 1259
            LTD++IK+WKKFYK MQP+TGKVVNCE +SRILLT+KESEVNG+L ILK Y+++++G+IF
Sbjct: 1192 LTDAYIKEWKKFYKTMQPITGKVVNCESDSRILLTMKESEVNGELKILKSYADLKSGDIF 1251

Query: 1260 EGYITNVTDFGVFVKLNNTLNVTGLAHRSQIADSQVDDLSALFGEGDKVKAIVLKTNPEK 1319
            +G + NVTDFGVFVKL+NTLNVTGLAH+S+I+DS++DDLS LFGEGDKVKAI+LKTNPEK
Sbjct: 1252 DGSVKNVTDFGVFVKLHNTLNVTGLAHKSEISDSKIDDLSLLFGEGDKVKAIILKTNPEK 1311

Query: 1320 KQVSLGLKASYFKK------EVEKNQXXXXXX-XXXXXXXXXXXXXXXXVDYXXXXXXXX 1372
             QVSLGLKASYF+K      E E  +                       ++Y        
Sbjct: 1312 NQVSLGLKASYFQKAHDDEDEAEPAESIEEANGEEINGEASDEDEAMEDIEYEHTPADAP 1371

Query: 1373 XXXXXATSQSSKVPVTNDGLSLSTGFDWTASILD--QAQXXXXXXXXXXFANTKKSRNRK 1430
                 + +    VP    GLSLS GFDWT SILD  Q +          F   K  +N K
Sbjct: 1372 SHETSSKAHKEAVPT---GLSLSAGFDWTGSILDPEQGKTMRMSSEDDDFTFKKAKKNNK 1428

Query: 1431 KGRTNAVEDKTIDINTRAPESVSDFERLIMGNPNSSVVWMNYMAFQLQLSEVDKAREIAE 1490
              R N  +D     +T+APESV DFERLIMGNPNSSV+WMNYMAFQLQLSEV+KARE+AE
Sbjct: 1429 ASRCNDRQD--CRHHTKAPESVGDFERLIMGNPNSSVIWMNYMAFQLQLSEVEKARELAE 1486

Query: 1491 RALKTISFRDELEKLNIWIAMLNLENTFGTEETLDDAFKRSCQYMDSFTMHNKLISIYQL 1550
            RALKTISFR+E EKLNIWIAMLNLENTFGT+ETL+D F+R+CQYMD++T+H KLISIY +
Sbjct: 1487 RALKTISFREEHEKLNIWIAMLNLENTFGTDETLEDVFRRACQYMDAYTIHMKLISIYAM 1546

Query: 1551 SEKFERAAELYRATAKKFGSQKVSIWVSWGEFLISRNQNDEAHAVLGNALKALPKRDHIE 1610
            S K ++A ELY+A AKKFGS+ VS+WVSWGEFL++  Q DEA AVL  ALK+LP+R HI+
Sbjct: 1547 SSKDDKAVELYKAAAKKFGSENVSLWVSWGEFLLTHEQPDEARAVLAQALKSLPRRSHID 1606

Query: 1611 VVRKFAQLEFSKGDAEQGRSLFEGLLADAPKRIDLWNVYIDQETKAGEKKKVEDLFERII 1670
            VVRKFAQLEF+KGD EQGR+LFEGLLADAPKRID+WNVY+DQE K+  + + + LFER++
Sbjct: 1607 VVRKFAQLEFAKGDPEQGRALFEGLLADAPKRIDIWNVYLDQEIKSSNRARADALFERVL 1666

Query: 1671 SKKITRKQAKFFFNKWLQFEESKNDQXXXXXXXXXXXXFVQKSQPNVDEE 1720
              K++RKQAKFFFNKWLQ  ES +DQ            +V+K     D E
Sbjct: 1667 VAKLSRKQAKFFFNKWLQLAESTDDQRGVEYIKARAADYVRKHDSVPDAE 1716

>Scas_594.4
          Length = 1722

 Score = 2036 bits (5274), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 998/1709 (58%), Positives = 1287/1709 (75%), Gaps = 26/1709 (1%)

Query: 1    MAPSNNKRKRDDESPLTRQDNTSQPVKSSLLQSSEETSFPRGGASVLTPLELKQVANEAA 60
            M P   KRKRD+E PL R+D T QP  SSL++++EE SFPRGG+S LTPLELKQVANEAA
Sbjct: 1    MVPPT-KRKRDEEFPLAREDATQQPTASSLMRNTEEVSFPRGGSSALTPLELKQVANEAA 59

Query: 61   SDVLFDNGTSSAVKPEVERPXXXXXXXXXXXXXXNETDEEEST---TIVEHISFKNLTPG 117
            +DVLF   TS+ V     RP               E  EEE     ++V+H++FK L  G
Sbjct: 60   NDVLFGKETSTDVAESTTRPKKKKKTGKKSKKDTEEKTEEEDEETLSVVQHVNFKTLKIG 119

Query: 118  SQLLGQISAVNKHDLCISLSDNLCGYVTLANISEQFTNLLEELDENMXXXXXXXXXXXXX 177
            S +LGQIS ++K D+CIS +D L GYV L +IS  F  +LEELD++M             
Sbjct: 120  SLVLGQISEISKTDMCISFTDGLSGYVNLTHISAPFMTILEELDDDMDDDDELEKKKTDE 179

Query: 178  XXXXXXXHSKNKKNKE----LPDLKKYFKPGQWLRCTVQSNTAL---EAKKKQKRIELTI 230
                     + +K  +    LP L+ YFK GQWLRC+V SNTAL   + K K+K+IEL+I
Sbjct: 180  EYDSSDDEEEKEKATKDSIGLPSLENYFKVGQWLRCSVISNTALLPKDKKNKKKKIELSI 239

Query: 231  EPSATNQLADEDLSRNCTVQCSVKSIEDHGAILDLGIKGITGFISKKDYPGVEELLPGTV 290
            EPS  N L +ED+ R+ +VQC+VKSIEDHGA+LD+GI G TGFISKKDYP  E+LLPG V
Sbjct: 240  EPSVVNTLTEEDIVRSASVQCAVKSIEDHGAMLDIGIDGFTGFISKKDYPEFEKLLPGAV 299

Query: 291  FLGNVAKRSDRTVNVNFDFTSKNNKVSHISSIDAVIPGQSVDFLCQKISSNGIFGKTFGL 350
            FLGNV K+SDRTV +N DF+ K  K++HISS+DAV+PGQ VD LCQ I++NGI GKTFGL
Sbjct: 300  FLGNVTKKSDRTVTINLDFSDKKAKITHISSVDAVVPGQVVDLLCQTITNNGIVGKTFGL 359

Query: 351  VSGFLGASHLRTFSADKIKHNYAIGSNIRARIVATLTNKKGEKIILVSTLPHILSLETKI 410
            V  F+  +HLR F  +++KHN+A+GSNI  RI+A L  K+ +K +L+STLPHI SL+  +
Sbjct: 360  VPSFISTAHLRVFKEEELKHNFAVGSNIPCRIIAVLITKENDKTLLLSTLPHIKSLKNVL 419

Query: 411  LEADALDAFPVGYILESCTVKGRDSQYFYLSMDQDRIGQVHISRVGDEDPAGEVKARVMG 470
             E + L AFP+G++++SCTVKGRDS Y YL+MD DR+G+VH SR+G+ +   ++KARV+G
Sbjct: 420  GEVENLTAFPIGHLIDSCTVKGRDSDYLYLAMDDDRVGEVHSSRIGELEKFDKLKARVLG 479

Query: 471  YNVVDGYYQLSTDPKVLELKYLRTKDIPLGEVISGCEIVTVSDKGIQLTLFGSQFKAFVP 530
            +N +D  Y+LSTDP++L+LKYLR+KDIP+GEV+  CEI  VS KGI+L +F  QFKA VP
Sbjct: 480  FNSIDNLYELSTDPEILKLKYLRSKDIPIGEVLPNCEITAVSSKGIELKIFNGQFKAIVP 539

Query: 531  PLHISDVKLVYPERKFKIGSKVKGRVLNVDNRGRVTVTLKKSLVNLDEDEIKLVSNFKQI 590
            P+HISD +LVYPERKFKIGSKVKGRVLN++NRG + VTLKK+LVN+++D+I+L+SNF   
Sbjct: 540  PMHISDTRLVYPERKFKIGSKVKGRVLNINNRGLIYVTLKKTLVNIEDDDIQLLSNFAIA 599

Query: 591  EKLADNDEKTSATVEFFKTNGCVVSFLGNLKGFLPNGEISEAFVKRPQDHLRLGQTVMVK 650
            +++ + ++KT ATV  F+ +GC+V+F G +  FLPN EISE FV++P++HLRLGQT++VK
Sbjct: 600  KEIQEKNQKTVATVTAFRPSGCIVAFFGGMTAFLPNAEISEVFVRKPEEHLRLGQTIVVK 659

Query: 651  VLQHDEEKNRVIITCKVSSDAAAQQKDAIENMVIGRSIVTVTVVGKTKDSAVIELVDVGL 710
            +L+ D+E  R+++TCK+S+D A ++K+ IE ++ GRS+V V VV KTKDS ++EL +  L
Sbjct: 660  LLKIDQENARMLVTCKISNDQAEKKKETIEKLIPGRSMVKVNVVEKTKDSVIVELPETSL 719

Query: 711  RGVIYVGHLSDSRIEQNRAQLKKLRVGTELEGLVIDKDIRTRVFNLSCKKSLIKDAQNGL 770
            RGVIYVGHLSD+RIEQNRA +KK+ +G+EL+GLVIDKD RT+VFNLS K+SLIKDA+N +
Sbjct: 720  RGVIYVGHLSDARIEQNRAAIKKIAIGSELKGLVIDKDARTQVFNLSLKQSLIKDAKNEV 779

Query: 771  LPLSYDEVKAKGNSFPMHGYVKSFSDKGIFVAFSGRFVGLVLPSYAVESRDVDILKKFHI 830
             PL+Y ++K+K  + P+HGY+KS S+KG+FVAF+G+FVGLVLPSYAVESRDVDI K F+I
Sbjct: 780  SPLTYADIKSKSKTTPLHGYIKSISNKGLFVAFNGKFVGLVLPSYAVESRDVDISKTFYI 839

Query: 831  NQSITAYLLRTDDENERFLLTLKEPKVAEKRQDNGSVNAVNPIDESVKELSEYXXXXXXX 890
            NQS+TAYLLR+DD+NERFLLTL+ P   +          + PID ++K+L ++       
Sbjct: 840  NQSVTAYLLRSDDDNERFLLTLRTPSTKDDSSKVTGTETLKPIDPAMKDLKDFTTGKVVK 899

Query: 891  XXXXXXXXNQLNVLLADNLHGRVDVSEIFDKFENIKDTKAPLSCYKKGDVIEVKVIGYHD 950
                    NQLNV+LADNLHGR+D++E+FD F +IK+   PL  +KKG++I+ K+IG HD
Sbjct: 900  VQIKGIKKNQLNVVLADNLHGRIDIAEVFDSFSDIKNATHPLIDFKKGNIIDAKIIGTHD 959

Query: 951  IKTHRFLPISHRASKNTILELTAKPSKLTEENESSLTIKNVKENDELVGFVNNFSKGFLW 1010
            IK+HRFLPISH A K ++LEL+ KPS++  ++  +L+I +V   DEL GFVNN+    LW
Sbjct: 960  IKSHRFLPISHHAVKGSVLELSLKPSQMRSKDIKTLSISDVAVGDELTGFVNNYGSNTLW 1019

Query: 1011 LTLSPVLKAKISNINLSDDGSTFASDIPESFPLGSALKVKAVDIDTEHNVVSVTGRFHSI 1070
            LT+SP LKAKIS  +L++DG   +  + ++FPLG AL VK   IDTEH VV+VTGR H+ 
Sbjct: 1020 LTVSPTLKAKISLFDLAEDGLKSSEKVEDNFPLGCALPVKVTSIDTEHGVVNVTGRSHTE 1079

Query: 1071 KDITDVKVGDKLPARIIMIADSYLLLDLGNDLKGISFVTEALDDYSVSLKTAFENRKNSI 1130
                 +KVGD +P+RII IADSY+LLDLGN + GI+F+T+ALDD+SV LK A++  +N I
Sbjct: 1080 ISFESLKVGDNVPSRIIKIADSYVLLDLGNKIHGIAFITDALDDFSVPLKEAYKGMENDI 1139

Query: 1131 VPATVIXXXXXXXXXXXXXRSTKPKDREIKSYKDLSRGDVVRGFIKAVSDKGIFVYLSTS 1190
            V A ++             R+   K   I S+ D+S+GDVV G +K++SDKGIFVYLS S
Sbjct: 1140 VSAKIVSIDAENKKVNLSLRTESAKTPSISSHTDISQGDVVHGLVKSISDKGIFVYLSRS 1199

Query: 1191 VQAFVPVSKLTDSFIKDWKKFYKPMQPVTGKVVNCEEESRILLTLKESEVNGDLNILKGY 1250
            + AFVPVSKL+D+++KDWKKF+KPMQ V GKVVN EE+SRILLTL+ESEVNGDL ILK Y
Sbjct: 1200 INAFVPVSKLSDTYLKDWKKFFKPMQYVIGKVVNAEEDSRILLTLRESEVNGDLKILKNY 1259

Query: 1251 SNIQAGEIFEGYITNVTDFGVFVKLNNTLNVTGLAHRSQIADSQVDDLSALFGEGDKVKA 1310
             +I+  EI+ G + NVTDFGVFVKL+NT+NVTGLAH S+IAD + +DL++LFG GD+VKA
Sbjct: 1260 DDIKVNEIYNGSVKNVTDFGVFVKLDNTVNVTGLAHNSEIADQKPEDLASLFGVGDRVKA 1319

Query: 1311 IVLKTNPEKKQVSLGLKASYF----KKEVEKNQXXXXXXXXXXXXXXXXXXXXXXVDYXX 1366
             VLK NPEKKQ+SL LKAS F    + +VE+ +                      VDY  
Sbjct: 1320 YVLKVNPEKKQLSLSLKASRFGNTNESKVEEKE----------TVDADGDEIMEAVDYNN 1369

Query: 1367 XXXXXXXXXXXATSQSSKVPVTNDGLSLSTGFDWTASILDQAQXXXXXXXXXXFANTKKS 1426
                            SK  ++ DGLSLSTGFDWTASILDQAQ          F  TK++
Sbjct: 1370 APSDNENETEEILETVSKPKISTDGLSLSTGFDWTASILDQAQAEESSEEDEDFTETKRN 1429

Query: 1427 RNRKKGRTNAVEDKTIDINTRAPESVSDFERLIMGNPNSSVVWMNYMAFQLQLSEVDKAR 1486
            R++K+ +T  VEDKTIDINTRAPESV+DFERLI+GNPNSSV+WMNYMAFQLQLSE++KAR
Sbjct: 1430 RHKKRKQT-IVEDKTIDINTRAPESVADFERLIIGNPNSSVIWMNYMAFQLQLSEIEKAR 1488

Query: 1487 EIAERALKTISFRDELEKLNIWIAMLNLENTFGTEETLDDAFKRSCQYMDSFTMHNKLIS 1546
            E+AERALKTI+FR+E EK NIW+AMLNLENTFG++ETL+D FKR+CQYMDSFTMHN+L+S
Sbjct: 1489 ELAERALKTINFREESEKQNIWMAMLNLENTFGSDETLEDVFKRACQYMDSFTMHNRLLS 1548

Query: 1547 IYQLSEKFERAAELYRATAKKFGSQKVSIWVSWGEFLISRNQNDEAHAVLGNALKALPKR 1606
            IYQ+S K ++AAEL++ TAKKFGS+ VSIWVSWG+FL S  +  EA  +L NALKALPKR
Sbjct: 1549 IYQMSGKIDKAAELFKITAKKFGSENVSIWVSWGDFLTSHGKAQEARGILSNALKALPKR 1608

Query: 1607 DHIEVVRKFAQLEFSKGDAEQGRSLFEGLLADAPKRIDLWNVYIDQETKAGEKKKVEDLF 1666
            DHIEVVRKFAQLEF+KGD E GRSLFEGL+ADAPKRID+WNVY+DQE KA EKKKVEDLF
Sbjct: 1609 DHIEVVRKFAQLEFAKGDPEGGRSLFEGLIADAPKRIDIWNVYLDQEIKANEKKKVEDLF 1668

Query: 1667 ERIISKKITRKQAKFFFNKWLQFEESKND 1695
            ER++S+KITRKQAKFFFNKWL+FEES+ND
Sbjct: 1669 ERVVSRKITRKQAKFFFNKWLEFEESQND 1697

>CAGL0M04829g complement(524685..529805) similar to sp|Q05022
            Saccharomyces cerevisiae YMR229c RRP5, hypothetical start
          Length = 1706

 Score = 1825 bits (4726), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 906/1704 (53%), Positives = 1211/1704 (71%), Gaps = 18/1704 (1%)

Query: 15   PLTRQDNTSQPVKSSLLQSSEETSFPRGGASVLTPLELKQVANEAASDVLFDNGTSSAVK 74
            PL+++D T QP KS+L++++EE SFPRGG+S LTPLELK VANEAA DVLF N      +
Sbjct: 8    PLSKEDGTRQPEKSTLVRTTEEISFPRGGSSALTPLELKHVANEAAHDVLFGNEKRPLTE 67

Query: 75   PEV-ERPXXXXXXXXXXXXXXNETDEEESTTIVEHISFKNLTPGSQLLGQISAVNKHDLC 133
             +  +                 +   E+ + I+EH++F N+  G+ LLGQI ++ K+DL 
Sbjct: 68   DDAGKPKKKKKRSSKKDTETVTDDTTEQRSAIIEHLNFNNVKEGTILLGQIDSITKNDLR 127

Query: 134  ISLSDNLCGYVTLANISEQFTNLLEELDENMXXXXXXXXXXXXXXXXXXXXHSKNKKNKE 193
            I+ +D L G+V L +ISEQ T+LLE++DE+M                         + K 
Sbjct: 128  ITFTDGLSGFVDLTHISEQLTSLLEDIDEDMDSDSKEDDAEYESS-------DDESEQKS 180

Query: 194  LPDLKKYFKPGQWLRCTVQSNTALEAK--KKQKRIELTIEPSATNQLADEDLSRNCTVQC 251
            LP+L+ YFK GQWLRC V  NTAL+ K  K++KRIELTIEPS  N    ED+++N  +QC
Sbjct: 181  LPNLRHYFKVGQWLRCAVTKNTALKPKNAKQKKRIELTIEPSVVNNFDVEDINKNTIIQC 240

Query: 252  SVKSIEDHGAILDLGIKGITGFISKKDYPGVEELLPGTVFLGNVAKRSDRTVNVNFDFTS 311
            SV+SIEDHGA LDLG+  +TGFI+KKD    +EL PG+VF+  + K++DR++ V+ DF+ 
Sbjct: 241  SVESIEDHGATLDLGVPSLTGFIAKKDCTNFDELKPGSVFISCITKKTDRSIVVSQDFSV 300

Query: 312  KNNKVSHISSIDAVIPGQSVDFLCQKISSNGIFGKTFGLVSGFLGASHLRTFSADKIKHN 371
            K NK++ ISSID+V+PGQ VD LC++I+ +GI GK FG +S F+G  HL+TFS + IKH 
Sbjct: 301  KKNKMTSISSIDSVLPGQVVDLLCEEITDSGIVGKVFGSISAFIGKPHLQTFSEEDIKHK 360

Query: 372  YAIGSNIRARIVATLTNKKGEKIILVSTLPHILSLETKILEADALDAFPVGYILESCTVK 431
            +++GSNI  RI+A++ NK G++++++STLPH++SL   +   ++L+AFP+G+I++   VK
Sbjct: 361  FSLGSNIPCRILASVINKSGDRVLILSTLPHVISLNNTLGSIESLEAFPIGFIIDESVVK 420

Query: 432  GRDSQYFYLSMDQDRIGQVHISRVGDEDPAGEVKARVMGYNVVDGYYQLSTDPKVLELKY 491
            GRDS Y YL++    IG+VH S +G+     ++K+RV+GY+V D  ++L+TDP+ L+LKY
Sbjct: 421  GRDSSYLYLAISDKFIGRVHQSNLGEIIKQDKLKSRVIGYDVADCIFELTTDPEKLKLKY 480

Query: 492  LRTKDIPLGEVISGCEIVTVSDKGIQLTLFGSQFKAFVPPLHISDVKLVYPERKFKIGSK 551
            +R+KDIP+GEV + CEI+  S  G++L L G QF AFVPPLHISD++L+YPERKFKI SK
Sbjct: 481  IRSKDIPVGEVFNNCEILKASSSGVELKLLGGQFTAFVPPLHISDIRLIYPERKFKIASK 540

Query: 552  VKGRVLNVDNRGRVTVTLKKSLVNLDEDEIKLVSNFKQIEKLADNDEKTSATVEFFKTNG 611
             K R+LNVDN G +  T+KKSLVN +E E  ++ +F+  + + + +EKT  TV+ F  +G
Sbjct: 541  TKCRILNVDNHGHIIATMKKSLVNDEELEKPVIESFETAKSIKNKNEKTVGTVQSFNGHG 600

Query: 612  CVVSFLGNLKGFLPNGEISEAFVKRPQDHLRLGQTVMVKVLQHDEEKNRVIITCKVSSDA 671
            CV+ F G + GFLP  E+SE FVKR +DHLRLGQTV VKVL+ DEE+ R+I+TCKVS++ 
Sbjct: 601  CVIMFFGGVTGFLPKSEVSEVFVKRAEDHLRLGQTVQVKVLEVDEERRRIIVTCKVSNEE 660

Query: 672  AAQQKDAIENMVIGRSIVTVTVVGKTKDSAVIELVDVGLRGVIYVGHLSDSRIEQNRAQL 731
            A QQK  IE++ IG+SI+   VV KTKDS ++E+ DVG+RGVIYVGH+SD RIEQ RA++
Sbjct: 661  AQQQKSIIESLKIGQSIIETVVVEKTKDSVIVEIPDVGIRGVIYVGHISDERIEQCRAEI 720

Query: 732  KKLRVGTELEGLVIDKDIRTRVFNLSCKKSLIKDAQNGLLPLSYDEVKAKGNSFPMHGYV 791
            KK+R+G++L GLVIDKD RT++FNLS KKSL+KDAQN  LP ++ E+     + P+HGYV
Sbjct: 721  KKIRIGSKLTGLVIDKDSRTQIFNLSLKKSLMKDAQNKRLPTTFAEITKFKKTDPLHGYV 780

Query: 792  KSFSDKGIFVAFSGRFVGLVLPSYAVESRDVDILKKFHINQSITAYLLRTDDENERFLLT 851
            KS S  G+FVAF+G+FVGLVLPSYAVESR VDI K F+ NQS+TAYLLRTDD+NERFLLT
Sbjct: 781  KSISSTGVFVAFTGKFVGLVLPSYAVESRQVDIEKAFYSNQSVTAYLLRTDDDNERFLLT 840

Query: 852  LKEPKVAEKRQDNGSVNAVNPIDESVKELSEYXXXXXXXXXXXXXXXNQLNVLLADNLHG 911
            LK PKV +  +   +++A N ID S+K + +                NQLN++LADN+HG
Sbjct: 841  LKAPKVEKAAE---TISAENIIDTSIKSVKDIKLGKILDAKIKGVKKNQLNIILADNVHG 897

Query: 912  RVDVSEIFDKFENIKDTKAPLSCYKKGDVIEVKVIGYHDIKTHRFLPISHRASKNTILEL 971
            RVD+SE+FD + +IKD K PLS YK  D + VK+IG+HD+K+H+ LPI+H   K T+ EL
Sbjct: 898  RVDISEVFDNYNDIKDKKHPLSHYKANDKVRVKIIGHHDLKSHKSLPITHNFVKGTVFEL 957

Query: 972  TAKPSKLTEENESSLTIKNVKENDELVGFVNNFSKGFLWLTLSPVLKAKISNINLSDDGS 1031
            T KPS+L  ++   L I+++   DE++ FVNN+    LWLT++P +KAK+S  +LS++  
Sbjct: 958  TMKPSQLKSKDVKELDIRDITVGDEIIAFVNNYQNSTLWLTVTPTIKAKLSIFDLSEETL 1017

Query: 1032 TFASDIPESFPLGSALKVKAVDIDTEHNVVSVTGRFHSIKDITDVKVGDKLPARIIMIAD 1091
                ++ + FPLGS LKV     D   +++ VT R   I  I D+KVG     +I+ +  
Sbjct: 1018 MNIKNVEDDFPLGSVLKVNVTGKDQNKSILQVTQRNGKINSIDDLKVGGHTIGKIVKVTP 1077

Query: 1092 SYLLLDLGNDLKGISFVTEALDDYSVSLKTAFENRKNSIVPATVIXXXXXXXXXXXXXRS 1151
             YLL++L N + GIS   EAL+D++  L   F  ++N  V A +                
Sbjct: 1078 KYLLIELENKITGISTALEALNDFTEPLDQVFAGKENEFVKAKITSVIADEKKVQLQLAE 1137

Query: 1152 TKPKDREIKSYKDLSRGDVVRGFIKAVSDKGIFVYLSTSVQAFVPVSKLTDSFIKDWKKF 1211
             +   ++I S+ DL  G+VV G +K V+DKG+FV+L  SV+AFVPVSKL+DS++K+WKKF
Sbjct: 1138 DESTVQKITSHSDLKVGEVVNGLVKTVTDKGLFVFLGKSVEAFVPVSKLSDSYLKEWKKF 1197

Query: 1212 YKPMQPVTGKVVNCEEESRILLTLKESEVNGDLNILKGYSNIQAGEIFEGYITNVTDFGV 1271
            YKPMQPV GK+V+C E+ RILLTL+E+EVNGDL +LK YS+I+ G+IF G + NVTDFGV
Sbjct: 1198 YKPMQPVVGKIVSCNEDDRILLTLRETEVNGDLKVLKNYSDIKPGDIFNGTVRNVTDFGV 1257

Query: 1272 FVKLNNTLNVTGLAHRSQIADSQVDDLSALFGEGDKVKAIVLKTNPEKKQVSLGLKASYF 1331
            FVKL+NT NVTGLAH ++IAD   +D+ ++FG GD+VKA VLK+NPEKKQ+SL LKAS+F
Sbjct: 1258 FVKLDNTANVTGLAHITEIADEVPEDIQSIFGVGDRVKAYVLKSNPEKKQLSLSLKASHF 1317

Query: 1332 KKEVEKNQXXXXXXXXXXXXXXXXXXXXXXVDYXXXXXXXXXXXXXATSQSSKVPVTND- 1390
                   +                      V Y             A S  S   ++ND 
Sbjct: 1318 NTNETITEKAESQPQPRKIDEDQDELMDDEVVY--NSESEASDDEEAHSSKSTTVISNDG 1375

Query: 1391 GLSLSTGFDWTASILDQAQX-XXXXXXXXXFANTKKSRNRKKGRTNAVEDKTIDINTRAP 1449
            GLSLS GFDWT SILDQA            F  +K+S+N+KK   N VEDKTIDINTRAP
Sbjct: 1376 GLSLSAGFDWTTSILDQANASSDSESDEEDFMESKRSKNKKKKSKNLVEDKTIDINTRAP 1435

Query: 1450 ESVSDFERLIMGNPNSSVVWMNYMAFQLQLSEVDKAREIAERALKTISFRDELEKLNIWI 1509
            ESV+DFERLI+GNPNSSV+WMNYMAFQLQLSE+DKARE+AERALKTI++R+E EKLNIWI
Sbjct: 1436 ESVADFERLIIGNPNSSVIWMNYMAFQLQLSEIDKARELAERALKTINYREEAEKLNIWI 1495

Query: 1510 AMLNLENTFGTEETLDDAFKRSCQYMDSFTMHNKLISIYQLSEKFERAAELYRATAKKFG 1569
            AMLNLENTFG+EETL+D F RSCQYMDSFTMH+KLI IYQLSEKF++A+EL++ T KKFG
Sbjct: 1496 AMLNLENTFGSEETLEDVFTRSCQYMDSFTMHSKLIGIYQLSEKFDKASELFKITTKKFG 1555

Query: 1570 SQKVSIWVSWGEFLISRNQNDEAHAVLGNALKALPKRDHIEVVRKFAQLEFSKGDAEQGR 1629
            S+K SIWVSW  F++S+N+ D+   +L +ALK+LPKR+HIEVVRKFAQLEFS+G+ E+GR
Sbjct: 1556 SEKTSIWVSWASFVLSQNEPDQVGTILSSALKSLPKRNHIEVVRKFAQLEFSEGNPERGR 1615

Query: 1630 SLFEGLLADAPKRIDLWNVYIDQETKAGE-KKKVEDLFERIISKKITRKQAKFFFNKWLQ 1688
            SLFEGLLADAPKRID+WNVY+DQE K  + K +VE+LFER+I  KITRKQAKFFFNKWLQ
Sbjct: 1616 SLFEGLLADAPKRIDIWNVYLDQEIKQKDNKSRVEELFERVIKMKITRKQAKFFFNKWLQ 1675

Query: 1689 FEESKNDQXXXXXXXXXXXXFVQK 1712
            FEES ND+            +V+K
Sbjct: 1676 FEESNNDEKMTDYVKAKASEYVEK 1699

>KLLA0B08239g 729850..735039 similar to sp|Q05022 Saccharomyces
            cerevisiae YMR229c RRP5 processing of pre-ribosomal RNA,
            start by similarity
          Length = 1729

 Score = 1563 bits (4047), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 756/1336 (56%), Positives = 998/1336 (74%), Gaps = 12/1336 (0%)

Query: 1    MAPSNNKRKRDDESPLTRQDNTSQPVKSSLLQSSEETSFPRGGASVLTPLELKQVANEAA 60
            M    +KRKRDDESPL RQD T  P KS+L   SEE SFPRGG+S L+PLE+KQV NE  
Sbjct: 1    MVAPQSKRKRDDESPLVRQDATEAPAKSAL-SKSEEISFPRGGSSALSPLEVKQVGNEVV 59

Query: 61   SDVLF--DNGTSSAVKPEVERPXXXXXXXXXXXXXXNETDEEESTTIVEHISFKNLTPGS 118
            +DVLF  D   + A  P  ++               +E ++E+ T ++EH   K +T G+
Sbjct: 60   ADVLFGKDESATGAEGPTKKKKKNAKNNFDQITTGDDE-EKEDKTDLIEHFGMKQMTKGT 118

Query: 119  QLLGQISAVNKHDLCISLSDNLCGYVTLANISEQFTNLLEELDENMXXXXXXXXXXXXXX 178
             +LGQI +++KH+L ISL D L GYV+L +ISEQ T +LE LDE+M              
Sbjct: 119  IVLGQIQSISKHELKISLVDGLHGYVSLTDISEQMTKILENLDESMESDDEKNEDSEYDS 178

Query: 179  XXXXXXHSKNKKNKELPDLKKYFKPGQWLRCTVQSNTALEAKKKQKRIELTIEPSATNQL 238
                   S     KELPDL KYFK GQWLRC VQ+N+ALE+ K  K+++L+IEPS  N  
Sbjct: 179  SDD---ESDITTPKELPDLNKYFKIGQWLRCMVQNNSALESNK-NKKLDLSIEPSVVNVF 234

Query: 239  ADEDLSRNCTVQCSVKSIEDHGAILDLGIKGITGFISKKDYPGVEELLPGTVFLGNVAKR 298
             D+DL++NC +QCS+KSIEDHGAILD+GI+ +TGFISKKD P    LLPG VFL  V KR
Sbjct: 235  EDDDLAKNCPLQCSLKSIEDHGAILDIGIENLTGFISKKDIPEFSSLLPGMVFLATVTKR 294

Query: 299  SDRTVNVNFDFTSKNNKVSHISSIDAVIPGQSVDFLCQKISSNGIFGKTFGLVSGFLGAS 358
            S RTVNVN D  SKN KV  ISSIDA++PGQS+DFL Q I+++G+ GK FGL++ FL   
Sbjct: 295  SGRTVNVNLDLASKNTKVEKISSIDAIVPGQSIDFLPQTITNHGVIGKAFGLITAFLPLP 354

Query: 359  HLRTFSADKIKHNYAIGSNIRARIVATLTNKKGEKIILVSTLPHILSLETKILEADALDA 418
            H   F+ + +KH+Y+IG  + ARI+AT   K G+K+ +VST PHI+SL  K+ E +AL++
Sbjct: 355  HSNFFTVEDLKHHYSIGDLVNARILATTIVKSGDKVAVVSTQPHIISLHPKLQETEALES 414

Query: 419  FPVGYILESCTVKGRDSQYFYLSMDQDRIGQVHISRVGDEDPAGEVKARVMGYNVVDGYY 478
            FPVGYI +SCTVKGRDSQ+FY+S++ +++GQ+H+S+ G+ +P G VKAR++GYN VD  Y
Sbjct: 415  FPVGYIFDSCTVKGRDSQFFYVSINNEQVGQIHLSKAGETEPTGTVKARILGYNNVDKLY 474

Query: 479  QLSTDPKVLELKYLRTKDIPLGEVISGCEIVTVSDKGIQLTLFGSQFKAFVPPLHISDVK 538
             L++DP +L++KYLR+ DIP GEV+S CEIVTVS KGI+L +F  QFKAFVPPLHISD +
Sbjct: 475  TLTSDPALLDVKYLRSSDIPAGEVLSACEIVTVSGKGIELKIFNDQFKAFVPPLHISDTR 534

Query: 539  LVYPERKFKIGSKVKGRVLNVDNRGRVTVTLKKSLVNLDEDEIKLVSNFKQIEKLADNDE 598
            LVYPERKFKIGSKVKGRVLNVD+ GRVTVTLKKS+VN DE+ + LV     I+ +   + 
Sbjct: 535  LVYPERKFKIGSKVKGRVLNVDSVGRVTVTLKKSIVNADEESVTLVCKNDDIQTVESQEL 594

Query: 599  KTSATVEFFKTNGCVVSFLGNLKGFLPNGEISEAFVKRPQDHLRLGQTVMVKVLQHDEEK 658
            KT  TVE FK NGCV+SF  N+K F+PN EISEAFVK+PQ+HLRLGQ+V+VK+L HD E+
Sbjct: 595  KTIGTVEIFKPNGCVISFFNNIKAFVPNKEISEAFVKKPQEHLRLGQSVLVKILNHDFER 654

Query: 659  NRVIITCKVSSDAAAQQKDAIENMVIGRSIVTVTVVGKTKDSAVIELVDVGLRGVIYVGH 718
            NR+I +CK+S++++++QK AIE++V+G+SI+   V+ KTKDS ++E  D GLRGVIY GH
Sbjct: 655  NRIIASCKISAESSSKQKSAIESLVVGKSIIDAIVIEKTKDSVIVESKDSGLRGVIYTGH 714

Query: 719  LSDSRIEQNRAQLKKLRVGTELEGLVIDKDIRTRVFNLSCKKSLIKDAQNGLLPLSYDEV 778
            LSD RIEQNRA  KKL++ +E+ GLV+DKDIRT VFN+SCKKSLIKDA++G LPLS+ ++
Sbjct: 715  LSDDRIEQNRASQKKLKINSEVRGLVLDKDIRTHVFNMSCKKSLIKDAEDGTLPLSFSDI 774

Query: 779  KAKGNSFPMHGYVKSFSDKGIFVAFSGRFVGLVLPSYAVESRDVDILKKFHINQSITAYL 838
            K K  + PMHGYVKS SD+G+FVAF+G+FVGLVLPSYA E+RD+DI KK++INQS+T YL
Sbjct: 775  KNKDKTEPMHGYVKSVSDRGVFVAFNGKFVGLVLPSYAAETRDIDIHKKYYINQSVTVYL 834

Query: 839  LRTDDENERFLLTLKEPKVAEKRQDNGSVNAVNPIDESVKELSEYXXXXXXXXXXXXXXX 898
            LRTD+E+ERFLLT+ + K   K+  N SV  +NP+D+S+K+LS++               
Sbjct: 835  LRTDEEHERFLLTILKQKTDVKKI-NSSV--INPVDKSIKDLSDFTIGKVTKATITSVKK 891

Query: 899  NQLNVLLADNLHGRVDVSEIFDKFENIKDTKAPLSCYKKGDVIEVKVIGYHDIKTHRFLP 958
            NQLNV LADN+HGR+ +SE+FD FE+IK+ KAPLS YKK D + V+VIG+HDIK+ +FLP
Sbjct: 892  NQLNVTLADNVHGRISISEVFDSFEDIKEQKAPLSVYKKNDSLSVRVIGFHDIKSRKFLP 951

Query: 959  ISHRASKNTILELTAKPSKLTEENESSLTIKNVKENDELVGFVNNFSKGFLWLTLSPVLK 1018
            ISH  SK+ ++EL+AKPS LT    S   +K+        GF+NN+S    WLT++P +K
Sbjct: 952  ISHTTSKSHLVELSAKPSSLTSP-VSEKKLKDFTPEQTTFGFINNYSNDTAWLTITPTVK 1010

Query: 1019 AKISNINLSDDGSTFASDIPESFPLGSALKVKAVDIDTEHNVVSVTGRFHSIKDITDVKV 1078
            AK+    +SD+G  F+  I E +P+G+A++V    IDTEH+ + V+ R H+I  I+++K 
Sbjct: 1011 AKLPIFEISDEGHDFSLPIEEKYPIGTAVRVTVKSIDTEHDSLVVSARSHAISSISEIKE 1070

Query: 1079 GDKLPARIIMIADSYLLLDLGNDLKGISFVTEALDDYSVSLKTAFENRKNSIVPATVIXX 1138
            GD LPAR+I + D+Y+LL LG D+ G+SF+T+ALDDYS+SLK  ++++K +IV ATV+  
Sbjct: 1071 GDVLPARVISVQDTYVLLSLGKDVTGVSFITDALDDYSLSLKDVYDSKKKNIVSATVLNV 1130

Query: 1139 XXXXXXXXXXXRSTKPKDREIKSYKDLSRGDVVRGFIKAVSDKGIFVYLSTSVQAFVPVS 1198
                       RS+ PKDR I S  +L RGD+VRGF+K+++DKG+F+ LS+ +QAFVPVS
Sbjct: 1131 DIDNNKINLSLRSSSPKDRTIISSSELKRGDIVRGFVKSITDKGVFISLSSVLQAFVPVS 1190

Query: 1199 KLTDSFIKDWKKFYKPMQPVTGKVVNCEEESRILLTLKESEVNGDLNILKGYSNIQAGEI 1258
            KLTD+FIKDWKKF++  Q V GKVVNC+ + R+LLTL+ESEVNG LN+LK YS+I  G+I
Sbjct: 1191 KLTDAFIKDWKKFFRRGQSVVGKVVNCDNDDRVLLTLRESEVNGQLNVLKSYSDINVGDI 1250

Query: 1259 FEGYITNVTDFGVFVKLNNTLNVTGLAHRSQIADSQVDDLSALFGEGDKVKAIVLKTNPE 1318
            F+G + NVTDFGVFVKL+ T+NVTGLAH+S++AD+++D+L  LFGEGDKVKAIVLKTNPE
Sbjct: 1251 FQGSVKNVTDFGVFVKLDGTVNVTGLAHKSEVADAKIDNLQNLFGEGDKVKAIVLKTNPE 1310

Query: 1319 KKQVSLGLKASYFKKE 1334
            KKQ+SLGLKASYF  E
Sbjct: 1311 KKQISLGLKASYFTNE 1326

 Score =  498 bits (1282), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 244/337 (72%), Positives = 276/337 (81%), Gaps = 2/337 (0%)

Query: 1378 ATSQSSKVPVTNDGLSLSTGFDWTASILDQAQXXXXXXXXXXFANTKKSRNRKKGRTNAV 1437
             T   +  PV+ DGLSLSTGFDWTASILDQAQ            +  KSR +KK +T  V
Sbjct: 1390 TTRPKNSAPVSTDGLSLSTGFDWTASILDQAQDEEESSEED--EDFIKSRKQKKKKTQIV 1447

Query: 1438 EDKTIDINTRAPESVSDFERLIMGNPNSSVVWMNYMAFQLQLSEVDKAREIAERALKTIS 1497
            +DKT+DINTR PESV DFERLIMGNPNSSVVWMNYMAF LQLSEV+KAREI ERALKTI+
Sbjct: 1448 QDKTVDINTRIPESVGDFERLIMGNPNSSVVWMNYMAFHLQLSEVEKAREIVERALKTIN 1507

Query: 1498 FRDELEKLNIWIAMLNLENTFGTEETLDDAFKRSCQYMDSFTMHNKLISIYQLSEKFERA 1557
            FR+E EKLNIWIA LNLENTFGTEET++D F ++CQYMDSFTMH KL+SIYQ+SEK E+A
Sbjct: 1508 FREESEKLNIWIASLNLENTFGTEETVEDVFTKACQYMDSFTMHMKLLSIYQMSEKIEKA 1567

Query: 1558 AELYRATAKKFGSQKVSIWVSWGEFLISRNQNDEAHAVLGNALKALPKRDHIEVVRKFAQ 1617
             EL++ TAKKFGS+KVSIWV+WGEFLI  N  DEAH VLGN+LK+LP R+HIEVVRKFAQ
Sbjct: 1568 KELFKITAKKFGSEKVSIWVAWGEFLIDNNLIDEAHEVLGNSLKSLPTRNHIEVVRKFAQ 1627

Query: 1618 LEFSKGDAEQGRSLFEGLLADAPKRIDLWNVYIDQETKAGEKKKVEDLFERIISKKITRK 1677
            LEFSKGD EQGRSLFEGLLADAPKR+DLWNVYIDQE K GEK K EDLFER+I+KKITRK
Sbjct: 1628 LEFSKGDPEQGRSLFEGLLADAPKRVDLWNVYIDQEIKHGEKSKAEDLFERVITKKITRK 1687

Query: 1678 QAKFFFNKWLQFEESKNDQXXXXXXXXXXXXFVQKSQ 1714
            QAKFFFNKWLQFEE K+DQ            +V+K++
Sbjct: 1688 QAKFFFNKWLQFEEQKDDQKLVDYVKAKAAEYVKKNK 1724

>KLLA0F17996g 1645592..1647646 similar to sgd|S0004107 Saccharomyces
            cerevisiae YLR117c CLF1, start by similarity
          Length = 684

 Score = 52.8 bits (125), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 51/227 (22%), Positives = 90/227 (39%), Gaps = 16/227 (7%)

Query: 1453 SDFERLIMGNPNSSVVWMNYMAFQLQLSEVDKAREIAERALKTISFRDELEKLNIWIAML 1512
            S +ER ++ +     +W+ Y+  +++   ++ AR + +RA   +   D+L     W   L
Sbjct: 84   SIYERALLVDHGFIPLWIQYIDSEIKWKNINHARNLLDRATNALPRVDKL-----WFKYL 138

Query: 1513 NLENTFGTEETLDDAFKRSCQYMDSFTMHNKLISIYQLSEKFERAAELYRATAKKFGSQK 1572
             LE + G +  +   + R C +       +  I        FE    +Y          +
Sbjct: 139  LLEESLGNQGIVRGIYTRWCSFEPGPDAWDSFIEFETRCLNFENVRNIYSKFV--LVHPQ 196

Query: 1573 VSIWVSWGEFLISRNQNDEAHAVLGNALKAL------PKRDHIEVVRKFAQLEFSKGDAE 1626
            +  W+ W  F  +         V   AL  L      P  D   V+  FA  E S+G+ E
Sbjct: 197  IDTWLKWVRFEQTHGDISSVRTVFSFALDTLTSFSGTPLVDIERVIGSFASWEASQGEYE 256

Query: 1627 QGRSLFEGLLADAPKRIDLWNVYIDQETKAGEKKKVEDLFERIISKK 1673
            + R+L+   +   P    L    I  E K G  K +ED+   +I+K+
Sbjct: 257  RSRTLYRLAVERWPISEALKEQQIQFEKKFGSSKNMEDI---VIAKR 300

 Score = 36.6 bits (83), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 27/83 (32%), Positives = 40/83 (48%), Gaps = 3/83 (3%)

Query: 1614 KFAQLEFSKGDAEQGRSLFEGLLADAPKRIDLWNVYIDQETKAGEKKKVEDLFERIISKK 1673
            ++AQ EF + D  + RS++E  L      I LW  YID E K        +L +R  +  
Sbjct: 68   RYAQFEFDQKDIRRARSIYERALLVDHGFIPLWIQYIDSEIKWKNINHARNLLDR-ATNA 126

Query: 1674 ITRKQAKFFFNKWLQFEESKNDQ 1696
            + R    +F  K+L  EES  +Q
Sbjct: 127  LPRVDKLWF--KYLLLEESLGNQ 147

 Score = 35.0 bits (79), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 26/102 (25%), Positives = 49/102 (48%), Gaps = 5/102 (4%)

Query: 1566 KKFGSQKVSIWVSWGEFLISRNQNDEAHAVLGNALKALPKRDHIEVVRKFAQLEFSKGDA 1625
            KKF   K  +W+ + EF I +N   +A  +LG +L   PK    +V + +  LE    + 
Sbjct: 393  KKFTFGK--LWIMYAEFEIRQNNLLKARKILGVSLGKSPKP---KVFKYYINLEIRLKEF 447

Query: 1626 EQGRSLFEGLLADAPKRIDLWNVYIDQETKAGEKKKVEDLFE 1667
            ++ R L+E  +   P  +  W  Y + E   G++ +   +++
Sbjct: 448  DRVRKLYEKYIDFNPSSVQSWLDYAELEENLGDEDRSRGIYD 489

 Score = 33.9 bits (76), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 35/123 (28%), Positives = 56/123 (45%), Gaps = 28/123 (22%)

Query: 1433 RTNAVEDKTIDINTRAPESVSDFERLI--MGNPNSS--------------------VVWM 1470
            R   + +K ID N  + +S  D+  L   +G+ + S                    +V  
Sbjct: 449  RVRKLYEKYIDFNPSSVQSWLDYAELEENLGDEDRSRGIYDISMSNNVGLSESDQLIVIQ 508

Query: 1471 NYMAFQLQLSEVDKAREIAERALKTISFRDELEKLNIWIAMLNLENTFGTEETLDDAFKR 1530
             Y+AF+   +E +KARE+ E+ L  +S  D    +NIWI     E+T  TE  L  A+++
Sbjct: 509  RYIAFETDAAEYEKARELYEKYL-ILSRYD----VNIWINQALFESTIPTETQL-IAYQQ 562

Query: 1531 SCQ 1533
            S Q
Sbjct: 563  SHQ 565

>Scas_713.42
          Length = 699

 Score = 50.8 bits (120), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 51/221 (23%), Positives = 93/221 (42%), Gaps = 16/221 (7%)

Query: 1453 SDFERLIMGNPNSSVVWMNYMAFQLQLSEVDKAREIAERALKTISFRDELEKLNIWIAML 1512
            S FER ++ N +   +W+ Y+  +L+L  ++ AR + +RA+ T+   D+L     W   L
Sbjct: 92   SVFERALLVNNSYIPLWIRYIDAELKLKCINHARNLLDRAITTLPRVDKL-----WYKYL 146

Query: 1513 NLENTFGTEETLDDAFKRSCQYMDSFTMHNKLISIYQLSEKFERAAELYRATAKKFGSQK 1572
             +E +    + +   F++ C            +        +    E+Y          K
Sbjct: 147  FVEESLQNWDVVRSLFRKWCSLEPGINAWKSYVDFETRQNNWNNVREVYSKYVA--IHPK 204

Query: 1573 VSIWVSWGEFLIS-------RNQNDEAHAVLGNALKALP--KRDHIEVVRKFAQLEFSKG 1623
            V+ W+SW +F +        R        VL    K  P  K D IE    FA  E S+ 
Sbjct: 205  VATWLSWVKFEMVHGDVSTIRTVFSLGSDVLNEYEKTDPGFKEDCIEFAIAFANWEASQM 264

Query: 1624 DAEQGRSLFEGLLADAPKRIDLWNVYIDQETKAGEKKKVED 1664
            + ++ R++++ L+   P    L +  ID E + G+   +E+
Sbjct: 265  EYDRSRAIYKILIDKWPNDGKLQSGMIDFEKQFGDVSTMEE 305

 Score = 45.4 bits (106), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 25/92 (27%), Positives = 46/92 (50%), Gaps = 3/92 (3%)

Query: 1575 IWVSWGEFLISRNQNDEAHAVLGNALKALPKRDHIEVVRKFAQLEFSKGDAEQGRSLFEG 1634
            IW+ + EF I +N    A  +LG +L   PK    +V R++ ++E S  + ++ R L+E 
Sbjct: 412  IWIMYSEFEIRQNDIGTARKILGRSLGLCPK---PKVFRRYIEIEISLREFDRVRRLYEK 468

Query: 1635 LLADAPKRIDLWNVYIDQETKAGEKKKVEDLF 1666
             L   P  +  W  Y + E    ++++   +F
Sbjct: 469  FLEFDPSNLKTWIAYAELEQNLDDEERARSIF 500

 Score = 32.7 bits (73), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 28/118 (23%), Positives = 56/118 (47%), Gaps = 7/118 (5%)

Query: 1573 VSIWVSWGEFLISRNQNDEAHAVLGNALKALPKRDHIEVVRKFAQLEFSKGDAEQGRSLF 1632
            + +W+ + +  +     + A  +L  A+  LP+ D +    K+  +E S  + +  RSLF
Sbjct: 105  IPLWIRYIDAELKLKCINHARNLLDRAITTLPRVDKLWY--KYLFVEESLQNWDVVRSLF 162

Query: 1633 EGLLADAPKRIDLWNVYIDQETKAGEKKKVEDLFERIISKKITRKQAKFFFNKWLQFE 1690
                +  P  I+ W  Y+D ET+      V +++ + ++  I  K A +    W++FE
Sbjct: 163  RKWCSLEPG-INAWKSYVDFETRQNNWNNVREVYSKYVA--IHPKVATWL--SWVKFE 215

 Score = 32.0 bits (71), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 42/214 (19%), Positives = 88/214 (41%), Gaps = 18/214 (8%)

Query: 1468 VWMNYMAF-QLQLSEVDKAREIAERALKTISFRDELEKLNIWIAMLNLE---NTFGTEET 1523
            +W+ Y+A+ +L ++++   R + ++ +  I          IWI     E   N  GT   
Sbjct: 372  LWVRYLAYIELSINDIVSCRNLFKKLINEIIPHKSFTFGKIWIMYSEFEIRQNDIGTARK 431

Query: 1524 LDDAFKRSCQYMDSFTMHNKLISIYQLSEKFERAAELYRATAKKFGSQKVSIWVSWGEFL 1583
            +     RS        +  + I I     +F+R   LY    + F    +  W+++ E  
Sbjct: 432  I---LGRSLGLCPKPKVFRRYIEIEISLREFDRVRRLYEKFLE-FDPSNLKTWIAYAE-- 485

Query: 1584 ISRNQNDEAHA-----VL---GNALKALPKRDHIEVVRKFAQLEFSKGDAEQGRSLFEGL 1635
            + +N +DE  A     +L    N + ++     + V+++F + E    +    R L+E  
Sbjct: 486  LEQNLDDEERARSIFNILLDDANDVISMSDSSKVIVIKRFIEFETDMEEYNNARELYEHY 545

Query: 1636 LADAPKRIDLWNVYIDQETKAGEKKKVEDLFERI 1669
            L  +    ++W  Y   E+      +++ L E++
Sbjct: 546  LQLSNFSPEVWTSYAMYESATPTDDQLKALREKM 579

 Score = 31.6 bits (70), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 21/72 (29%), Positives = 33/72 (45%), Gaps = 2/72 (2%)

Query: 1614 KFAQLEFSKGDAEQGRSLFEGLLADAPKRIDLWNVYIDQETKAGEKKKVEDLFERIISK- 1672
            ++A  E  + D  + RS+FE  L      I LW  YID E K        +L +R I+  
Sbjct: 76   RYALFEVEQHDIRRARSVFERALLVNNSYIPLWIRYIDAELKLKCINHARNLLDRAITTL 135

Query: 1673 -KITRKQAKFFF 1683
             ++ +   K+ F
Sbjct: 136  PRVDKLWYKYLF 147

>CAGL0D02376g complement(244241..246328) similar to tr|Q12309
            Saccharomyces cerevisiae YLR117c CLF1, start by
            similarity
          Length = 695

 Score = 47.8 bits (112), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 25/88 (28%), Positives = 47/88 (53%), Gaps = 3/88 (3%)

Query: 1575 IWVSWGEFLISRNQNDEAHAVLGNALKALPKRDHIEVVRKFAQLEFSKGDAEQGRSLFEG 1634
            IW+ + EF I ++  ++A ++LG +L   PKR   +  + +  LE    + ++ R L+E 
Sbjct: 402  IWILYAEFEIRQDNLEKARSILGRSLGLCPKR---KTFKYYIDLETKLREFDRVRILYEN 458

Query: 1635 LLADAPKRIDLWNVYIDQETKAGEKKKV 1662
             L   P  +D W  Y++ E   G++ +V
Sbjct: 459  FLKFDPLNLDTWRAYVEFEDSLGDEVRV 486

 Score = 40.0 bits (92), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 50/250 (20%), Positives = 95/250 (38%), Gaps = 40/250 (16%)

Query: 1453 SDFERLIMGNPNSSVVWMNYMAFQLQLSEVDKAREIAERALKT-ISF------------- 1498
            ++FE  +  N      WM Y  F+++  ++ +AR I ERAL+  IS+             
Sbjct: 48   TEFEGYLKRNRLDVKQWMRYAVFEIEQHDMRRARSIFERALRVHISYVPLWIRYIESELK 107

Query: 1499 -------RDELEKL--------NIWIAMLNLENTFGTEETLDDAFKRSCQYMDSFTMHNK 1543
                   R+ LE+          +W   L +E +    + + + F++ C    +  + + 
Sbjct: 108  LGYINHARNILERAITKLPRVDKLWYKYLIVEESLAHFDIVRNLFQKWCSLEPAAHVWDS 167

Query: 1544 LISIYQLSEKFERAAELYRATAKKFGSQKVSIWVSWGEFLISRNQNDEAHAVLGNALKAL 1603
                    E++E    +Y          + S W  W  F +         +V   AL AL
Sbjct: 168  FTDFEVRQERYEDVRNIYSKYV--LIHPQFSTWRKWINFEVRYGSTKTVRSVYSLALDAL 225

Query: 1604 PKR---------DHIEVVRKFAQLEFSKGDAEQGRSLFEGLLADAPKRIDLWNVYIDQET 1654
                        D I ++ +F++ E  + +  + +SL E  +   PK   L N  +  E 
Sbjct: 226  IAYSESRNELVDDCINLIVEFSKWEALQKEYIRSKSLLEIAIQKWPKSNTLNNALLQFER 285

Query: 1655 KAGEKKKVED 1664
            + G  + +E+
Sbjct: 286  EHGTAETLEN 295

 Score = 37.7 bits (86), Expect = 0.095,   Method: Compositional matrix adjust.
 Identities = 22/70 (31%), Positives = 36/70 (51%), Gaps = 2/70 (2%)

Query: 1605 KRDHIEVVR--KFAQLEFSKGDAEQGRSLFEGLLADAPKRIDLWNVYIDQETKAGEKKKV 1662
            KR+ ++V +  ++A  E  + D  + RS+FE  L      + LW  YI+ E K G     
Sbjct: 55   KRNRLDVKQWMRYAVFEIEQHDMRRARSIFERALRVHISYVPLWIRYIESELKLGYINHA 114

Query: 1663 EDLFERIISK 1672
             ++ ER I+K
Sbjct: 115  RNILERAITK 124

 Score = 33.5 bits (75), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 46/186 (24%), Positives = 75/186 (40%), Gaps = 29/186 (15%)

Query: 1510 AMLNLENTFGTEETLDDA--FKRSCQY----------MDSFTMHNKLIS------IYQLS 1551
            A+L  E   GT ETL++     R   Y           D++ ++ +L+       + +  
Sbjct: 279  ALLQFEREHGTAETLENTIILNRKKHYEDILNEKVYDYDTWLLYLQLLENNYPKLVMEAF 338

Query: 1552 EKFERAAELYRATAKKFGSQKVSIWVSWGEFLISRNQNDEAHAVLGNALKAL-----PKR 1606
                 AA     T  K+  Q + IW+ +  FL     ND    + G   + L     P  
Sbjct: 339  SNVLNAAIPTSRTKDKYWKQYILIWIKYLTFL-ELTIND--IPLCGQKFEELIHNIIPND 395

Query: 1607 DHI--EVVRKFAQLEFSKGDAEQGRSLFEGLLADAPKRIDLWNVYIDQETKAGEKKKVED 1664
            D    ++   +A+ E  + + E+ RS+    L   PKR   +  YID ETK  E  +V  
Sbjct: 396  DFTFSKIWILYAEFEIRQDNLEKARSILGRSLGLCPKR-KTFKYYIDLETKLREFDRVRI 454

Query: 1665 LFERII 1670
            L+E  +
Sbjct: 455  LYENFL 460

>AGL184W [4128] [Homologous to ScYLR117C (CLF1) - SH]
            complement(350805..352856) [2052 bp, 683 aa]
          Length = 683

 Score = 41.6 bits (96), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 50/225 (22%), Positives = 91/225 (40%), Gaps = 18/225 (8%)

Query: 1453 SDFERLIMGNPNSSVVWMNYMAFQLQLSEVDKAREIAERALKTISFRDELEKLNIWIAML 1512
            S FER +   P   VVW+ Y+  +L+  +V+ AR +  RA   +   D+L     W   +
Sbjct: 81   SVFERALAVAPGDVVVWLRYVDCELRARDVNHARNLLVRATALLPRVDKL-----WYKYV 135

Query: 1513 NLENTFGTEETLDDAFKRSCQYMDSFTMHNKLISIYQLSEKFERAAELYRATAKKFGSQK 1572
             +E + G  E +   + + C    +    +  +       + E   E+Y  +        
Sbjct: 136  LMEESLGQVELVRGVYTKWCTLEPAAAAWDAFVDFETRQGQVEHVREVY--SRYVMVHPV 193

Query: 1573 VSIWVSWGEFLISRNQND-----EAHAVLGNALKALPKRDHIEV---VRKFAQLEFSKGD 1624
             + W+ W  F   R   D       +++  + L A    D  EV   V  FA+ E ++ +
Sbjct: 194  AATWLKWVAF--ERKHGDAGTVRRVYSLACDTLTAFAGADVHEVEQLVVSFAEWEATQQE 251

Query: 1625 AEQGRSLFEGLLADAPKRIDLWNVYIDQETKAGEKKKVED-LFER 1668
             E+ R++    ++  P+   L +     E K G  +  E  LF+R
Sbjct: 252  LERSRAVLSVAVSRWPESSTLKDATAQLEKKFGGARAGESILFKR 296

 Score = 38.5 bits (88), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 33/132 (25%), Positives = 59/132 (44%), Gaps = 36/132 (27%)

Query: 1576 WVSWGEFLISRNQNDEAHAVLGNALKALPK---------------------RDHIEVVR- 1613
            W+ + EF I + + D+A  +LG +L   PK                     R H +++  
Sbjct: 398  WIMYAEFEIRQEKLDKARKILGMSLGMCPKPKLFQYYIDLEIKLKEFDRVRRLHEKLLEF 457

Query: 1614 ---------KFAQLEFSKGDAEQGRSLFE-GLLADA----PKRIDLWNVYIDQETKAGEK 1659
                     ++A+LE + GD ++ R ++E GL AD      +++ L   YI  ET A E 
Sbjct: 458  QPDVLSNWIEYAELEENLGDEDRARGIYEIGLTADGGLSQARQLQLMQRYIQFETDASEF 517

Query: 1660 KKVEDLFERIIS 1671
            ++   L+ R ++
Sbjct: 518  ERARALYSRYVA 529

 Score = 38.1 bits (87), Expect = 0.076,   Method: Compositional matrix adjust.
 Identities = 21/66 (31%), Positives = 37/66 (56%), Gaps = 2/66 (3%)

Query: 1605 KRDHIEVVR--KFAQLEFSKGDAEQGRSLFEGLLADAPKRIDLWNVYIDQETKAGEKKKV 1662
            KR+ ++V +  ++A  E+ + D  + RS+FE  LA AP  + +W  Y+D E +A +    
Sbjct: 54   KRNRLDVRQWLRYAAFEYEQRDMRRARSVFERALAVAPGDVVVWLRYVDCELRARDVNHA 113

Query: 1663 EDLFER 1668
             +L  R
Sbjct: 114  RNLLVR 119

 Score = 33.5 bits (75), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 28/123 (22%), Positives = 54/123 (43%), Gaps = 7/123 (5%)

Query: 1573 VSIWVSWGEFLISRNQNDEAHAVLGNALKALPKRDHIEVVRKFAQLEFSKGDAEQGRSLF 1632
            V +W+ + +  +     + A  +L  A   LP+ D +    K+  +E S G  E  R ++
Sbjct: 94   VVVWLRYVDCELRARDVNHARNLLVRATALLPRVDKLWY--KYVLMEESLGQVELVRGVY 151

Query: 1633 EGLLADAPKRIDLWNVYIDQETKAGEKKKVEDLFERIISKKITRKQAKFFFNKWLQFEES 1692
                   P     W+ ++D ET+ G+ + V +++ R +   +    A  +  KW+ FE  
Sbjct: 152  TKWCTLEPA-AAAWDAFVDFETRQGQVEHVREVYSRYV---MVHPVAATWL-KWVAFERK 206

Query: 1693 KND 1695
              D
Sbjct: 207  HGD 209

>Kwal_56.23875
          Length = 680

 Score = 41.2 bits (95), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 30/130 (23%), Positives = 56/130 (43%), Gaps = 7/130 (5%)

Query: 1453 SDFERLIMGNPNSSVVWMNYMAFQLQLSEVDKAREIAERALKTISFRDELEKLNIWIAML 1512
            S FER +  N     +W+ Y+  +L+   ++ AR + +RA   +     +EKL  W+  +
Sbjct: 80   SIFERALQVNNQYVPLWIKYIDSELKAKNINHARNLLDRACNLLP---RVEKL--WLKYV 134

Query: 1513 NLENTFGTEETLDDAFKRSCQYMDSFTMHNKLISIYQLSEKFERAAELYRATAKKFGSQK 1572
             +E + G    +   F R C    S   ++  +       +FE+A ++Y        +  
Sbjct: 135  IVEESLGNVSLVRSLFSRWCSLSPSKNAYDAYVGFETRCGEFEKARKVYSGYVSVHPA-- 192

Query: 1573 VSIWVSWGEF 1582
            V  W+ W  F
Sbjct: 193  VDTWLKWVAF 202

 Score = 35.8 bits (81), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 28/55 (50%)

Query: 1614 KFAQLEFSKGDAEQGRSLFEGLLADAPKRIDLWNVYIDQETKAGEKKKVEDLFER 1668
            ++A+ E  + D  + RS+FE  L    + + LW  YID E KA       +L +R
Sbjct: 64   RYAKFEIGQHDMRRARSIFERALQVNNQYVPLWIKYIDSELKAKNINHARNLLDR 118

 Score = 35.0 bits (79), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 33/137 (24%), Positives = 65/137 (47%), Gaps = 15/137 (10%)

Query: 1554 FERAAELYRATAKKFGSQKVSIWVSWGEFLISRNQNDEAHAVLGNALKALPKRDHIEVVR 1613
            FERA ++         +Q V +W+ + +  +     + A  +L  A   LP+ + + +  
Sbjct: 82   FERALQV--------NNQYVPLWIKYIDSELKAKNINHARNLLDRACNLLPRVEKLWL-- 131

Query: 1614 KFAQLEFSKGDAEQGRSLFEGLLADAPKRIDLWNVYIDQETKAGEKKKVEDLFERIISKK 1673
            K+  +E S G+    RSLF    + +P + + ++ Y+  ET+ GE +K      ++ S  
Sbjct: 132  KYVIVEESLGNVSLVRSLFSRWCSLSPSK-NAYDAYVGFETRCGEFEKA----RKVYSGY 186

Query: 1674 ITRKQAKFFFNKWLQFE 1690
            ++   A   + KW+ FE
Sbjct: 187  VSVHPAVDTWLKWVAFE 203

 Score = 32.7 bits (73), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 39/188 (20%), Positives = 76/188 (40%), Gaps = 15/188 (7%)

Query: 1468 VWMNYMAF-QLQLSEVDKAREIAERALKTISFRDELEKLNIWIAMLNLENTFGTEETLDD 1526
            +W+ Y+ + +L ++++ K R   E  +K +    +     IW+     E     +E L  
Sbjct: 357  LWIRYLLYLELDIADIPKTRSSFETLVKDVIPHKKFTFAKIWVMYSKFE---LRQENLAK 413

Query: 1527 AFKRSCQYMDSFTMHNKLISIY-----QLSEKFERAAELYRATAKKFGSQKVSIWVSWGE 1581
            A ++   Y        K+   Y     QL E F+R  ++Y      F     + W+++ E
Sbjct: 414  A-RKIFGYALGTCPKQKIFKEYINFEIQLKE-FDRVRKIYEQLLA-FDPLSNANWIAYAE 470

Query: 1582 FLISRNQNDEAHAVLGNALK---ALPKRDHIEVVRKFAQLEFSKGDAEQGRSLFEGLLAD 1638
               +    D A  +   A+     LP    I ++++    E   G+ E  R+++  LLA 
Sbjct: 471  LEENLGDEDRARGIYHIAISENLGLPNESKIGIIKRLISFETDLGEYENARAVYRTLLAL 530

Query: 1639 APKRIDLW 1646
            +     +W
Sbjct: 531  SNNSAKIW 538

>KLLA0B09262g 814303..817128 some similarities with sp|P14922
            Saccharomyces cerevisiae YBR112c CYC8 general repressor
            of transcription singleton, hypothetical start
          Length = 941

 Score = 40.8 bits (94), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 47/208 (22%), Positives = 82/208 (39%), Gaps = 46/208 (22%)

Query: 1508 WIAMLNLENTFGTEETLDDAFKRSCQYMDSFTMHNKLISI---YQLSEKFERAAELYRAT 1564
            W+++ +L  T G  +    A+  + Q+  S T  N L S+   Y+  + F+RAAELY+  
Sbjct: 111  WLSIASLAETLGDADLAAMAYDATLQHNPSST--NALTSLAHLYRSRDMFQRAAELYQ-R 167

Query: 1565 AKKFGSQKVSIWVSWGEFLISRNQNDEAHAVLGNALKAL-----PKRDH-IEVVR-KFAQ 1617
            A     +   IW + G   +  ++   A+A    AL  L     PK  H I ++  ++  
Sbjct: 168  ALSANPELGDIWATLGHCYLMLDELQNAYAAYQQALYHLSNPNIPKLWHGIGILYDRYGS 227

Query: 1618 LEFS------------------------------KGDAEQGRSLFEGLLADAPKRIDLWN 1647
            L+++                              +G   Q    F  +L   P  +  W+
Sbjct: 228  LDYAEEAFAKVLELDPQFEKANEIYFRLGIIYKHQGKWNQALECFRYILPQPPAPLQEWD 287

Query: 1648 VYIDQET---KAGEKKKVEDLFERIISK 1672
            V+    +     GE +   D +E IIS+
Sbjct: 288  VWFQLGSVLESMGEWQGARDAYEHIISQ 315

 Score = 34.3 bits (77), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 32/137 (23%), Positives = 59/137 (43%), Gaps = 9/137 (6%)

Query: 1455 FERLIMGNPNSSVVWMNYMAFQLQLSEVDKAREIAERALKTISFRDELEKLNIWIAMLNL 1514
            ++R +  NP    +W       L L E+  A    ++AL  +S    + KL  W  +  L
Sbjct: 165  YQRALSANPELGDIWATLGHCYLMLDELQNAYAAYQQALYHLS-NPNIPKL--WHGIGIL 221

Query: 1515 ENTFGTEETLDDAFKRSCQYMDSFTMHN----KLISIYQLSEKFERAAELYRATAKKFGS 1570
             + +G+ +  ++AF +  +    F   N    +L  IY+   K+ +A E +R    +  +
Sbjct: 222  YDRYGSLDYAEEAFAKVLELDPQFEKANEIYFRLGIIYKHQGKWNQALECFRYILPQPPA 281

Query: 1571 --QKVSIWVSWGEFLIS 1585
              Q+  +W   G  L S
Sbjct: 282  PLQEWDVWFQLGSVLES 298

>CAGL0F02915g 281010..283517 similar to sp|Q04048 Saccharomyces
            cerevisiae YDR416w SYF1 synthetic lethal with CDC40,
            hypothetical start
          Length = 835

 Score = 40.0 bits (92), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 37/141 (26%), Positives = 61/141 (43%), Gaps = 25/141 (17%)

Query: 1538 FTMHNKLISIYQLSEKFERAAELYRATAKKFGS------QKVSIWVSWGEFLISRNQN-- 1589
            F +HNKL         F RA +L  + A++  +      Q+V +W S     IS+ +   
Sbjct: 661  FEIHNKL---------FSRAIDLLMSGARRPYTNKEQLKQRVDLWES----AISKCEEFL 707

Query: 1590 --DEAHAVLGNALKALPKRDHIEVVRKFAQLEFSKGDAEQGRSLFE--GLLADAPKRIDL 1645
              D    +L   ++ LP    I  V KF +LE S  D  + R L +    L    K  +L
Sbjct: 708  GPDSLRQLLSECIQELPNSKAITYVLKFTKLEMSLSDYTRARELLQYGAQLLPPIKNEEL 767

Query: 1646 WNVYIDQETKAGEKKKVEDLF 1666
            W ++   E + G+K   +++ 
Sbjct: 768  WGLWEQFELEHGDKSYYKEML 788

>YLR117C (CLF1) [3530] chr12 complement(382472..384535) Essential
            pre-mRNA splicing factor that plays a role in the
            initiation of DNA replication, has tetratricopeptide
            (TPR) repeats and has similarity to Drosophila crooked
            neck (crn) protein, component of Prp19p-associated
            complex [2064 bp, 687 aa]
          Length = 687

 Score = 39.3 bits (90), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 21/92 (22%), Positives = 46/92 (50%), Gaps = 3/92 (3%)

Query: 1575 IWVSWGEFLISRNQNDEAHAVLGNALKALPKRDHIEVVRKFAQLEFSKGDAEQGRSLFEG 1634
            IW+ + +FLI  +   +A  +LG A+   PK    +  + + +LE    + ++ R ++E 
Sbjct: 406  IWLMYAKFLIRHDDVPKARKILGKAIGLCPK---AKTFKGYIELEVKLKEFDRVRKIYEK 462

Query: 1635 LLADAPKRIDLWNVYIDQETKAGEKKKVEDLF 1666
             +   P  + +W+ Y + E   G+  +V  ++
Sbjct: 463  FIEFQPSDLQIWSQYGELEENLGDWDRVRGIY 494

 Score = 38.9 bits (89), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 34/197 (17%), Positives = 78/197 (39%), Gaps = 16/197 (8%)

Query: 1453 SDFERLIMGNPNSSVVWMNYMAFQLQLSEVDKAREIAERALKTISFRDELEKLNIWIAML 1512
            S FER ++ + +   +W+ Y+  +L++  ++ AR +  RA+ T+   D+L     W   L
Sbjct: 86   SIFERALLVDSSFIPLWIRYIDAELKVKCINHARNLMNRAISTLPRVDKL-----WYKYL 140

Query: 1513 NLENTFGTEETLDDAFKRSCQYMDSFTMHNKLISIYQLSEKFERAAELYRATAKKFGSQK 1572
             +E +    E +   + + C         N  +      + +    E+Y          +
Sbjct: 141  IVEESLNNVEIVRSLYTKWCSLEPGVNAWNSFVDFEIRQKNWNGVREIYSKYV--MAHPQ 198

Query: 1573 VSIWVSWGEFLISRNQNDEAHAVLGNALKALPKRDHIEV---------VRKFAQLEFSKG 1623
            +  W+ W  F       +   +V   A+  +    ++++         V  FA  E ++ 
Sbjct: 199  MQTWLKWVRFENRHGNTEFTRSVYSLAIDTVANLQNLQIWSDMEVAKLVNSFAHWEAAQQ 258

Query: 1624 DAEQGRSLFEGLLADAP 1640
            + E+  +L++  +   P
Sbjct: 259  EYERSSALYQIAIEKWP 275

 Score = 36.6 bits (83), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 38/82 (46%), Gaps = 3/82 (3%)

Query: 1614 KFAQLEFSKGDAEQGRSLFEGLLADAPKRIDLWNVYIDQETKAGEKKKVEDLFERIISKK 1673
            ++AQ E  + D  + RS+FE  L      I LW  YID E K        +L  R IS  
Sbjct: 70   RYAQFEIEQHDMRRARSIFERALLVDSSFIPLWIRYIDAELKVKCINHARNLMNRAIS-- 127

Query: 1674 ITRKQAKFFFNKWLQFEESKND 1695
             T  +    + K+L  EES N+
Sbjct: 128  -TLPRVDKLWYKYLIVEESLNN 148

 Score = 31.6 bits (70), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 40/178 (22%), Positives = 77/178 (43%), Gaps = 19/178 (10%)

Query: 1457 RLIMGNPNSSVVWMNYMAFQLQLSEVDKAREIAERALKTISFRDELEKLNIWIAMLNLEN 1516
            RL MG       W+ Y  F+++  ++ +AR I ERAL   S       + +WI  ++ E 
Sbjct: 62   RLDMGQ------WIRYAQFEIEQHDMRRARSIFERALLVDS-----SFIPLWIRYIDAEL 110

Query: 1517 TFGTEETLDDAFKRSCQYMDSFTMHNKLISIYQLSEKFERAAELYRATAKKFGSQK--VS 1574
                     +   R+   + +    +KL   Y + E+     E+ R+   K+ S +  V+
Sbjct: 111  KVKCINHARNLMNRA---ISTLPRVDKLWYKYLIVEESLNNVEIVRSLYTKWCSLEPGVN 167

Query: 1575 IWVSWGEFLISRNQNDEAHAVLGNALKALPKRDHIEVVRKFAQLEFSKGDAEQGRSLF 1632
             W S+ +F I +   +    +    + A P+   ++   K+ + E   G+ E  RS++
Sbjct: 168  AWNSFVDFEIRQKNWNGVREIYSKYVMAHPQ---MQTWLKWVRFENRHGNTEFTRSVY 222

>YER013W (PRP22) [1436] chr5 (178840..182277) Pre-mRNA splicing factor
            of DEAH box family, required for release of mature mRNA
            from the spliceosome [3438 bp, 1145 aa]
          Length = 1145

 Score = 39.3 bits (90), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 23/73 (31%), Positives = 40/73 (54%), Gaps = 3/73 (4%)

Query: 1257 EIFEGYITNVTDFGVFVKLNNTL--NVTGLAHRSQIADSQVDDLSALFGEGDKVKAIVLK 1314
            +++EG + N+T FG FV++  T   N  GL H S+++D +  D   +  +G  +   V+K
Sbjct: 179  KVYEGKVRNITTFGCFVQIFGTRMKNCDGLVHISEMSDQRTLDPHDVVRQGQHIFVEVIK 238

Query: 1315 TNPEKKQVSLGLK 1327
                 K +SL +K
Sbjct: 239  IQNNGK-ISLSMK 250

>Scas_705.55
          Length = 907

 Score = 38.9 bits (89), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 42/170 (24%), Positives = 75/170 (44%), Gaps = 11/170 (6%)

Query: 1455 FERLIMGNPNSSVVWMNYMAFQLQLSEVDKAREIAERALKTISFRDELEKLNIWIAMLNL 1514
            +ER +  NP  S VW       L L ++ +A    ++AL  +S    + KL  W  +  L
Sbjct: 113  YERALSINPELSDVWATLGHCYLMLDDLQRAYNSYQQALYHLS-NPNVPKL--WHGIGIL 169

Query: 1515 ENTFGTEETLDDAFKRSCQYMDSFTMHN----KLISIYQLSEKFERAAELYRATAKKFGS 1570
             + +G+ +  ++AF +  +    F   N    +L  IY+   K+ +A E +R    +  +
Sbjct: 170  YDRYGSLDYAEEAFAKVLELDPQFEKANEIYFRLGIIYKHQGKWTQALECFRYILNQPPA 229

Query: 1571 --QKVSIWVSWGEFLISRNQNDEAHAVLGNALKALPKRDHIEVVRKFAQL 1618
              Q+  IW   G  L S N+   A     + L  L   +H +V+++   L
Sbjct: 230  PLQEWDIWFQLGSVLESMNEWQGAREAYEHVL--LQNENHAKVLQQLGCL 277

>KLLA0B11638g complement(1020591..1023926) similar to sp|P24384
            Saccharomyces cerevisiae YER013w PRP22 pre-mRNA splicing
            factor, start by similarity
          Length = 1111

 Score = 38.5 bits (88), Expect = 0.058,   Method: Compositional matrix adjust.
 Identities = 26/75 (34%), Positives = 39/75 (52%), Gaps = 5/75 (6%)

Query: 1257 EIFEGYITNVTDFGVFVKL---NNTLNVTGLAHRSQIADSQVDDLSALFGEGDKVKAIVL 1313
            +++ G + NVT FG FV++    NT NV GL H S+++ S VD    +      V   V+
Sbjct: 180  KVYPGKVQNVTKFGCFVRIFGVRNT-NVDGLVHVSELSSSHVDKPEDVVHRNQDVFVKVI 238

Query: 1314 KTNPEKKQVSLGLKA 1328
            K     K +SL +K 
Sbjct: 239  KIQNNGK-ISLAMKG 252

>ADL344W [1396] [Homologous to ScYBR112C (CYC8) - SH]
            complement(103567..106299) [2733 bp, 910 aa]
          Length = 910

 Score = 38.5 bits (88), Expect = 0.065,   Method: Compositional matrix adjust.
 Identities = 42/206 (20%), Positives = 79/206 (38%), Gaps = 42/206 (20%)

Query: 1508 WIAMLNLENTFGTEETLDDAFKRSCQYMDSFTMH-NKLISIYQLSEKFERAAELYRATAK 1566
            W+++ +L  T G  +    A+  + QY  S T     L  +Y+  + F+RAAELY+  A 
Sbjct: 65   WLSIASLAETLGDADRAAMAYDATLQYNPSSTKALTSLAHLYRSRDVFQRAAELYQ-RAL 123

Query: 1567 KFGSQKVSIWVSWGEFLISRNQNDEAHAVLGNALKAL-----PKRDH-IEVVR-KFAQLE 1619
                +   +W + G   +  +    A+A    AL  L     PK  H I ++  ++  L+
Sbjct: 124  AVNPELGDVWATLGHCYLMLDDLQRAYAAYQQALYHLSNPNVPKLWHGIGILYDRYGSLD 183

Query: 1620 FS------------------------------KGDAEQGRSLFEGLLADAPKRIDLWNVY 1649
            ++                              +G   Q    F  +L   P  +  W+V+
Sbjct: 184  YAEEAFAKVLELDPHFEKVNEIYFRLGIIYKHQGKWNQALECFRYILPQPPAPLQEWDVW 243

Query: 1650 IDQET---KAGEKKKVEDLFERIISK 1672
                +     GE +   + +E ++S+
Sbjct: 244  FQLGSVLESMGEWQGAREAYEHVLSQ 269

 Score = 32.7 bits (73), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 36/152 (23%), Positives = 67/152 (44%), Gaps = 12/152 (7%)

Query: 1440 KTIDINTRAPESVSDFERLIMGNPNSSVVWMNYMAFQLQLSEVDKAREIAERALKTISFR 1499
            ++ D+  RA E    ++R +  NP    VW       L L ++ +A    ++AL  +S  
Sbjct: 107  RSRDVFQRAAEL---YQRALAVNPELGDVWATLGHCYLMLDDLQRAYAAYQQALYHLS-N 162

Query: 1500 DELEKLNIWIAMLNLENTFGTEETLDDAFKRSCQYMDSFTMHN----KLISIYQLSEKFE 1555
              + KL  W  +  L + +G+ +  ++AF +  +    F   N    +L  IY+   K+ 
Sbjct: 163  PNVPKL--WHGIGILYDRYGSLDYAEEAFAKVLELDPHFEKVNEIYFRLGIIYKHQGKWN 220

Query: 1556 RAAELYRATAKKFGS--QKVSIWVSWGEFLIS 1585
            +A E +R    +  +  Q+  +W   G  L S
Sbjct: 221  QALECFRYILPQPPAPLQEWDVWFQLGSVLES 252

>Kwal_23.3670
          Length = 802

 Score = 38.1 bits (87), Expect = 0.079,   Method: Compositional matrix adjust.
 Identities = 27/97 (27%), Positives = 44/97 (45%), Gaps = 2/97 (2%)

Query: 1508 WIAMLNLENTFGTEETLDDAFKRSCQYMDSFTMH-NKLISIYQLSEKFERAAELYRATAK 1566
            W+++ +L  T G  +    A+  + QY  S T     L  +Y+  + F+RAAELY+  A 
Sbjct: 69   WLSIASLAETLGDADRAAMAYDATLQYNPSSTKALTSLAHLYRSRDMFQRAAELYQ-RAL 127

Query: 1567 KFGSQKVSIWVSWGEFLISRNQNDEAHAVLGNALKAL 1603
                +   IW + G   +  +    A+A    AL  L
Sbjct: 128  TVNPELGDIWATLGHCYLMLDDLQRAYAAYQQALYHL 164

 Score = 32.3 bits (72), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 32/137 (23%), Positives = 59/137 (43%), Gaps = 9/137 (6%)

Query: 1455 FERLIMGNPNSSVVWMNYMAFQLQLSEVDKAREIAERALKTISFRDELEKLNIWIAMLNL 1514
            ++R +  NP    +W       L L ++ +A    ++AL  +S    + KL  W  +  L
Sbjct: 123  YQRALTVNPELGDIWATLGHCYLMLDDLQRAYAAYQQALYHLS-NPNVPKL--WHGIGIL 179

Query: 1515 ENTFGTEETLDDAFKRSCQYMDSFTMHN----KLISIYQLSEKFERAAELYRA--TAKKF 1568
             + +G+ +  ++AF +  +    F   N    +L  IY+   K+ +A E +R   T    
Sbjct: 180  YDRYGSLDYAEEAFAKVLELDPQFEKANEIYFRLGIIYKHQGKWNQALECFRYILTQPPA 239

Query: 1569 GSQKVSIWVSWGEFLIS 1585
              Q+  +W   G  L S
Sbjct: 240  PLQEWDVWFQLGSVLES 256

>Kwal_55.21029
          Length = 1105

 Score = 37.0 bits (84), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 30/120 (25%), Positives = 59/120 (49%), Gaps = 3/120 (2%)

Query: 1222 VVNCEEESRILLTLKESEVNGDLNILKGYSNIQAGEIFEGYITNVTDFGVFVKLNNTLN- 1280
            + N + E + L+    S+ + DL I     +    +I+ G +  +T FG F+++  T + 
Sbjct: 143  MANEKVEWKSLMEDTTSKTHTDLGIQNMDESPVLDKIYSGSVKKITTFGCFIRIQGTKDP 202

Query: 1281 -VTGLAHRSQIADSQVDDLSALFGEGDKVKAIVLKTNPEKKQVSLGLKASYFKKEVEKNQ 1339
               GL H S++A+ +++D S L     +V   V++     K +SL +K       +E+N+
Sbjct: 203  RCDGLLHISEMANRRLEDPSELVSLNQQVYVKVIRIQNNGK-ISLRMKNIDQSTGIEQNE 261

>YBR112C (CYC8) [302] chr2 complement(462826..465726) General
            repressor of RNA polymerase II transcription that is
            brought to target promoters by sequence-specific
            DNA-binding proteins, Sko1p-Ssn6p-Tup1p complex undergoes
            Hog1p-dependent conversion to a transcriptional activator
            [2901 bp, 966 aa]
          Length = 966

 Score = 36.2 bits (82), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 35/137 (25%), Positives = 62/137 (45%), Gaps = 9/137 (6%)

Query: 1455 FERLIMGNPNSSVVWMNYMAFQLQLSEVDKAREIAERALKTISFRDELEKLNIWIAMLNL 1514
            +ER ++ NP  S VW       L L ++ +A    ++AL  +S    + KL  W  +  L
Sbjct: 103  YERALLVNPELSDVWATLGHCYLMLDDLQRAYNAYQQALYHLS-NPNVPKL--WHGIGIL 159

Query: 1515 ENTFGTEETLDDAFKRSCQYMDSFTMHN----KLISIYQLSEKFERAAELYRATAKKFGS 1570
             + +G+ +  ++AF +  +    F   N    +L  IY+   K+ +A E +R    +  +
Sbjct: 160  YDRYGSLDYAEEAFAKVLELDPHFEKANEIYFRLGIIYKHQGKWSQALECFRYILPQPPA 219

Query: 1571 --QKVSIWVSWGEFLIS 1585
              Q+  IW   G  L S
Sbjct: 220  PLQEWDIWFQLGSVLES 236

>AAR020W [206] [Homologous to ScYER013W (PRP22) - SH]
            complement(376250..379588) [3339 bp, 1112 aa]
          Length = 1112

 Score = 35.0 bits (79), Expect = 0.76,   Method: Compositional matrix adjust.
 Identities = 22/73 (30%), Positives = 36/73 (49%), Gaps = 2/73 (2%)

Query: 1256 GEIFEGYITNVTDFGVFVK-LNNTLNVTGLAHRSQIADSQVDDLSALFGEGDKVKAIVLK 1314
            G+I+   I N+  FG F + L    +  GL H SQ++ S+V   + +   GD V   + K
Sbjct: 183  GKIYRAVIRNIKPFGCFARVLGTKRSCEGLIHISQLSHSRVGSPNDVVSVGDHVYVKITK 242

Query: 1315 TNPEKKQVSLGLK 1327
                 K +SL ++
Sbjct: 243  VQDNGK-LSLSMR 254

>KLLA0F20449g 1898253..1900667 highly similar to sp|P13188
           Saccharomyces cerevisiae YOR168w GLN4 glutaminyl-tRNA
           synthetase, start by similarity
          Length = 804

 Score = 33.9 bits (76), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 29/102 (28%), Positives = 45/102 (44%), Gaps = 10/102 (9%)

Query: 438 FYLSMDQDR--IGQVHISR-----VGDEDPAGEV-KARVMGYNVVDGYYQLSTDPKVLEL 489
           FYLS +       QVH+ R      G  +  G V   R +   V  GY     DP++  L
Sbjct: 461 FYLSRESYEWLCDQVHVFRPAQREYGRLNITGTVLSKRKIAKLVTGGYVSGWNDPRLFTL 520

Query: 490 KYLRTKDIPLGEVISGCEI--VTVSDKGIQLTLFGSQFKAFV 529
           + +R + +P G ++S      VT S   IQ+  F S  + ++
Sbjct: 521 EAIRRRGVPPGAILSFINTLGVTTSTTNIQVVRFESAIRKYL 562

>CAGL0E03630g complement(335091..337331) weakly similar to sp|P38741
           Saccharomyces cerevisiae YHL024w RIM4 No sporulation,
           hypothetical start
          Length = 746

 Score = 33.9 bits (76), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 26/98 (26%), Positives = 43/98 (43%), Gaps = 3/98 (3%)

Query: 591 EKLADNDEKTSATVEFFKTNGCVVSFLGNLKGFLPNGEISEAFVKRPQDHLRLGQTVMVK 650
           E   DN   T+ T+  +K       F+ +L   LP+ ++     K  Q++   GQ V VK
Sbjct: 73  ETTPDNVTNTADTIGDYKGRPSACIFVASLASSLPDDQLCMNVTKHFQNY---GQLVGVK 129

Query: 651 VLQHDEEKNRVIITCKVSSDAAAQQKDAIENMVIGRSI 688
           VL+ D  +    +      DA    K+A   ++ GR +
Sbjct: 130 VLRDDHNRPYAFVQYINDKDAKHALKNASGTVLNGRKL 167

>Sklu_2440.18 YDR416W, Contig c2440 29476-31950
          Length = 824

 Score = 32.7 bits (73), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 47/240 (19%), Positives = 102/240 (42%), Gaps = 18/240 (7%)

Query: 1439 DKTIDINTRAPESVSDFERLIMGNPNSSVVWMNYMAFQLQLSEVDKAREIAERALKTISF 1498
            + T D     P + + +E+ I     + ++++NY  F  +    +++ +I ERA+ T   
Sbjct: 533  ESTCDNKDAIPSTRAAYEQAISLKIATPLIFINYAHFLQEQKLWEESFKIYERAIDTFPS 592

Query: 1499 RDELEKLNIWIAMLNLENTFGTEETLDDAFKRSCQYMDSFTMHNKLISIYQLSEK----F 1554
                E  NI++A   L+N   ++E + D F+++ +            ++Y   E+     
Sbjct: 593  DTSFEIWNIYLAE-GLKNGL-SKERMRDLFEQAMKLAQDGLDCKPFYTLYSDFEEKNGLT 650

Query: 1555 ERAAELYRATAKKFGS--QKVSIWVSWGEFLISRNQ----NDEAHAVLGNALKALPKRDH 1608
            +R+ ++     K+      K ++W    E  I + +    +  +  +    ++ LP    
Sbjct: 651  KRSVDILHRGCKETSHLDSKCTLW----ELCIYKCKKLLGDVNSRELYEECIQDLPNSKS 706

Query: 1609 IEVVRKFAQLEFSKGDAEQGRSL--FEGLLADAPKRIDLWNVYIDQETKAGEKKKVEDLF 1666
            ++    FA  E S GD E+ R++  F   L        LW+ + + E + G K   +++ 
Sbjct: 707  VKFSLDFAVTEASHGDFERARAILNFGAQLLHPSTNQALWDYWNEFELRYGNKDTYKEML 766

 Score = 32.3 bits (72), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 52/233 (22%), Positives = 94/233 (40%), Gaps = 26/233 (11%)

Query: 1469 WMNYMAFQLQLSEVDKAREIAERALKTISFRDELEKLNIWIAMLNLENTFGTEETLDDAF 1528
            W  Y    +   + D AREI +RA + + +   ++  ++WI    +E      E      
Sbjct: 429  WCRYAKLYINKQDYDTAREIFDRATR-VPYSHLIDLEDVWICWAEMELDIDGLEKAALVI 487

Query: 1529 KRSCQYMDSFTMHNKLISIYQLSEKFERAAELYRATAKKFGSQKVSIWVSWGEFLISRNQ 1588
            K + +   S  +   ++  YQ S+K E  A+        F S K  +W  + + L S   
Sbjct: 488  KTALKVPQSPEL---VLEKYQRSKKRELPAQ-----TVVFSSLK--LWSFYLDLLESTCD 537

Query: 1589 NDEA----HAVLGNALK---ALPKRDHIEVVRKFAQLEFSKGDAEQGRSLFEGLLADAPK 1641
            N +A     A    A+    A P      +   +A     +   E+   ++E  +   P 
Sbjct: 538  NKDAIPSTRAAYEQAISLKIATPL-----IFINYAHFLQEQKLWEESFKIYERAIDTFPS 592

Query: 1642 --RIDLWNVYIDQETKAG-EKKKVEDLFERIISKKITRKQAKFFFNKWLQFEE 1691
                ++WN+Y+ +  K G  K+++ DLFE+ +         K F+  +  FEE
Sbjct: 593  DTSFEIWNIYLAEGLKNGLSKERMRDLFEQAMKLAQDGLDCKPFYTLYSDFEE 645

>Scas_570.11
          Length = 858

 Score = 32.3 bits (72), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 43/216 (19%), Positives = 91/216 (42%), Gaps = 25/216 (11%)

Query: 1470 MNYMAFQLQLSEVDKAREIAERALKTISFRDELEKLNIWIAMLNLENTFGTEETLDDAFK 1529
            +NY  F    + + ++ +I ERA+   +   + E  NI++A +    +  ++E + + F+
Sbjct: 600  INYSHFLQHHNMIMESYQIYERAIPLFTAETQYELWNIYLAEVVNPLSPLSKEHIRELFE 659

Query: 1530 RSCQYMDSFTMHNKLISIYQLSEKFE-------RAAELYRATAKKFGS------QKVSIW 1576
             + + +  F +  K  SI+ L   FE       R+ ++    A+  G        ++ +W
Sbjct: 660  HAIRTLLPFGIDCK--SIFILYSDFEEKQGLLKRSVDILWKGAQTNGQGTIHLKSRLGLW 717

Query: 1577 VSWGEFLISRNQN----DEAHAVLGNALKALPKRDHIEVVRKFAQLEFSKGDAEQGRSLF 1632
                   + + Q+      +  +  + ++ +P       +  FA  E S G+  + R + 
Sbjct: 718  ----NLCLFKAQSHLGLSVSRQIYEDCIQQVPNSKSAPYIIGFADAETSGGEITRSREIL 773

Query: 1633 E--GLLADAPKRIDLWNVYIDQETKAGEKKKVEDLF 1666
            E    L    K   LWN +   E K G+K+  +D+ 
Sbjct: 774  EYGARLIPPAKNTSLWNYWETFELKHGDKETYKDML 809

>KLLA0D16148g 1361758..1362561 highly similar to sp|P40545
            Saccharomyces cerevisiae YIL020c HIS6 5 Pro-FAR isomerase
            singleton, start by similarity
          Length = 267

 Score = 31.6 bits (70), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 24/90 (26%), Positives = 40/90 (44%), Gaps = 4/90 (4%)

Query: 1477 LQLSEV-DKAREIAERALKTISFRDELEKLNIWIAMLNLENTFGTEETLDDAFKRSCQYM 1535
            ++L+E+  K R + + + K ++  D+  K   W+  +N   T    E  +  F   CQY 
Sbjct: 121  VKLAEICGKDRLVVDLSCKRVTKPDQEPK---WVVAMNKWQTLTDLELNERTFADLCQYT 177

Query: 1536 DSFTMHNKLISIYQLSEKFERAAELYRATA 1565
            D F +H   +         E  A LY+ TA
Sbjct: 178  DEFLVHAADVEGLCNGIDEELVAHLYKWTA 207

>CAGL0D01364g 152033..155479 similar to sp|P14922 Saccharomyces
            cerevisiae YBR112c CYC8 general repressor of
            transcription, hypothetical start
          Length = 1148

 Score = 32.0 bits (71), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 19/79 (24%), Positives = 37/79 (46%), Gaps = 2/79 (2%)

Query: 1507 IWIAMLNLENTFGTEETLDDAFKRSCQYMDSFTMH-NKLISIYQLSEKFERAAELYRATA 1565
             W+++ +L  T G  +    A+  + Q+  S T     L  +Y+  + F++AAELY   A
Sbjct: 50   TWLSIASLAETLGDADRAAMAYDATLQHNASSTKGLTSLAHLYRSRDMFQKAAELYEC-A 108

Query: 1566 KKFGSQKVSIWVSWGEFLI 1584
             +   +   +W + G   +
Sbjct: 109  LQVNPELSDVWATLGHCYL 127

>CAGL0M08206g complement(816472..817674) similar to sp|P46992
           Saccharomyces cerevisiae YJL171c, hypothetical start
          Length = 400

 Score = 31.6 bits (70), Expect = 6.7,   Method: Composition-based stats.
 Identities = 23/78 (29%), Positives = 35/78 (44%), Gaps = 3/78 (3%)

Query: 279 YPGVEELLPGTVFLGNVAKRSDRTVNVNFDFTSKNNKVSHIS---SIDAVIPGQSVDFLC 335
           Y G+E+L  G    G + + +  T+     F S  N VS IS   S D  +   +V+ L 
Sbjct: 285 YQGIEDLGTGIQSYGYIPRDTKGTMMGGVIFDSNGNTVSFISNSTSFDQTLSPSAVNSLL 344

Query: 336 QKISSNGIFGKTFGLVSG 353
           + I SN  +      +SG
Sbjct: 345 RAIPSNETYSTKLMSISG 362

>Scas_661.22
          Length = 877

 Score = 31.2 bits (69), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 28/101 (27%), Positives = 47/101 (46%), Gaps = 8/101 (7%)

Query: 1563 ATAKKFGSQKVSIWVSWGEFLISRNQNDEAHAVLGNALKALPKRDHIEVVRKFAQLEFSK 1622
            ATA +F S+  S+W+   E     ++    + V+  AL+A+P  + +   +    LE SK
Sbjct: 289  ATAIRFNSKSESLWLKAVEL---ESETFNKYRVVRKALQAIPYNEKL--WQMACNLEQSK 343

Query: 1623 GDAEQGRSLFEGLLADAPKRIDLWNVYIDQETKAGEKKKVE 1663
             +A +   + E  +A  PK  DLW   I  +      K +E
Sbjct: 344  TEALK---ILERAVAFVPKSKDLWTTLIKSQDYPEASKSLE 381

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.315    0.133    0.369 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 51,763,649
Number of extensions: 2215107
Number of successful extensions: 7221
Number of sequences better than 10.0: 53
Number of HSP's gapped: 7193
Number of HSP's successfully gapped: 98
Length of query: 1720
Length of database: 16,596,109
Length adjustment: 116
Effective length of query: 1604
Effective length of database: 12,580,421
Effective search space: 20178995284
Effective search space used: 20178995284
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 69 (31.2 bits)