Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Sklu_2380.528928914420.0
Kwal_14.8682822939731e-133
KLLA0E08030g3022248871e-120
CAGL0L09867g2602268701e-118
Scas_685.92001958531e-116
ACR170C2892218381e-113
YKL024C (URA6)2041927901e-107
KLLA0F13376g2272162205e-21
CAGL0K11418g2222212119e-20
AGR187W2772192112e-19
Scas_721.822212242082e-19
Kwal_56.234892252202056e-19
KLLA0C17754g2272172057e-19
CAGL0L11902g2511932032e-18
Kwal_27.116072272162003e-18
YDR226W (ADK1)2222161978e-18
AGR115C2512191943e-17
Scas_681.182482281935e-17
Sklu_2123.22282151872e-16
YER170W (ADK2)2251871555e-12
Sklu_2063.3208140820.016
AGL098W44779780.088
ADR282C221200760.11
Scas_617.742064730.32
AFR310C62355662.4
Sklu_2300.129351652.9
AAR041W51441653.5
CAGL0M02981g61745644.0
KLLA0D12012g53752635.0
Kwal_23.361122879616.7
YPL217C (BMS1)118342628.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Sklu_2380.5
         (289 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Sklu_2380.5 YKL024C, Contig c2380 11212-12081                         560   0.0  
Kwal_14.868                                                           379   e-133
KLLA0E08030g complement(724562..725470) some similarities with s...   346   e-120
CAGL0L09867g 1054344..1055126 some similarities with sp|P15700 S...   339   e-118
Scas_685.9                                                            333   e-116
ACR170C [1217] [Homologous to ScYKL024C (URA6) - SH] (653511..65...   327   e-113
YKL024C (URA6) [3231] chr11 complement(392169..392783) Uridine-m...   308   e-107
KLLA0F13376g 1234589..1235272 highly similar to sp|P07170 Saccha...    89   5e-21
CAGL0K11418g complement(1109653..1110321) highly similar to sp|P...    86   9e-20
AGR187W [4498] [Homologous to ScYDR226W (ADK1) - SH] complement(...    86   2e-19
Scas_721.82                                                            85   2e-19
Kwal_56.23489                                                          84   6e-19
KLLA0C17754g 1576357..1577040 similar to sp|P26364 Saccharomyces...    84   7e-19
CAGL0L11902g 1276048..1276803 similar to sp|P26364 Saccharomyces...    83   2e-18
Kwal_27.11607                                                          82   3e-18
YDR226W (ADK1) [1062] chr4 (916478..917146) Adenylate kinase (GT...    80   8e-18
AGR115C [4426] [Homologous to ScYER170W (ADK2) - SH] (959464..96...    79   3e-17
Scas_681.18                                                            79   5e-17
Sklu_2123.2 YDR226W, Contig c2123 4210-4896                            77   2e-16
YER170W (ADK2) [1598] chr5 (525969..526646) Adenylate kinase (GT...    64   5e-12
Sklu_2063.3 YDL166C, Contig c2063 1224-1850                            36   0.016
AGL098W [4214] [Homologous to ScYLR231C - SH] complement(519389....    35   0.088
ADR282C [2023] [Homologous to ScYMR157C - SH] (1182869..1183534)...    34   0.11 
Scas_617.7                                                             33   0.32 
AFR310C [3502] [Homologous to ScYGR130C - SH] (1001496..1003367)...    30   2.4  
Sklu_2300.1 YKL107W, Contig c2300 3026-3907 reverse complement         30   2.9  
AAR041W [227] [Homologous to ScYPR088C (SRP54) - SH] complement(...    30   3.5  
CAGL0M02981g 335863..337716 similar to sp|Q03262 Saccharomyces c...    29   4.0  
KLLA0D12012g 1024590..1026203 similar to sgd|S0005951 Saccharomy...    29   5.0  
Kwal_23.3611                                                           28   6.7  
YPL217C (BMS1) [5232] chr16 complement(139619..143170) Protein i...    28   8.9  

>Sklu_2380.5 YKL024C, Contig c2380 11212-12081
          Length = 289

 Score =  560 bits (1442), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 274/289 (94%), Positives = 274/289 (94%)

Query: 1   MLRTVARTTIAKRTPNCLPLFINRGLSMTRLYSTQNQQGGQHQEKDQRPTKXXXXXXXXX 60
           MLRTVARTTIAKRTPNCLPLFINRGLSMTRLYSTQNQQGGQHQEKDQRPTK         
Sbjct: 1   MLRTVARTTIAKRTPNCLPLFINRGLSMTRLYSTQNQQGGQHQEKDQRPTKGRGRALLLL 60

Query: 61  XXXXXXSTLFSISYQKNPPVEFMENAPEDKGPAFSPEDVSVVFVLGGPGAGKGTQCTKLV 120
                 STLFSISYQKNPPVEFMENAPEDKGPAFSPEDVSVVFVLGGPGAGKGTQCTKLV
Sbjct: 61  GALALGSTLFSISYQKNPPVEFMENAPEDKGPAFSPEDVSVVFVLGGPGAGKGTQCTKLV 120

Query: 121 KDYGFVHLSAGDLLRAEQNRKGSEYGALIKHYIKEGLIVPQEVTVALLQNAIRENFEDGK 180
           KDYGFVHLSAGDLLRAEQNRKGSEYGALIKHYIKEGLIVPQEVTVALLQNAIRENFEDGK
Sbjct: 121 KDYGFVHLSAGDLLRAEQNRKGSEYGALIKHYIKEGLIVPQEVTVALLQNAIRENFEDGK 180

Query: 181 KRFLVDGFPRKMDQAITFEKQIVPSKFTLFFDCPETVMLERLLERGKTSGRTDDNIESIK 240
           KRFLVDGFPRKMDQAITFEKQIVPSKFTLFFDCPETVMLERLLERGKTSGRTDDNIESIK
Sbjct: 181 KRFLVDGFPRKMDQAITFEKQIVPSKFTLFFDCPETVMLERLLERGKTSGRTDDNIESIK 240

Query: 241 KRFRTFIETSMPVVEYFEKQNKVIKVSCDQPIDEVYKKVQTAVEAKIEN 289
           KRFRTFIETSMPVVEYFEKQNKVIKVSCDQPIDEVYKKVQTAVEAKIEN
Sbjct: 241 KRFRTFIETSMPVVEYFEKQNKVIKVSCDQPIDEVYKKVQTAVEAKIEN 289

>Kwal_14.868
          Length = 282

 Score =  379 bits (973), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 196/293 (66%), Positives = 228/293 (77%), Gaps = 18/293 (6%)

Query: 1   MLRTVARTTIAK----RTPNCLPLFINRGLSMTRLYSTQNQQGGQHQEKDQRPTKXXXXX 56
           ML+TV R+ I      RT   LP+ I +   + R+YS+ N   G  Q      TK     
Sbjct: 1   MLKTVFRSRIPSPLIGRTARALPVRIPQ---IARVYSSNN---GPQQ------TKSRGKL 48

Query: 57  XXXXXXXXXXSTLFSISYQKNPPVEFME--NAPEDKGPAFSPEDVSVVFVLGGPGAGKGT 114
                     STL SISYQKN PVEF+E  N+    GPAFS +DVSV+FVLGGPGAGKGT
Sbjct: 49  LALVAALAVGSTLVSISYQKNGPVEFVEEENSKASTGPAFSDKDVSVIFVLGGPGAGKGT 108

Query: 115 QCTKLVKDYGFVHLSAGDLLRAEQNRKGSEYGALIKHYIKEGLIVPQEVTVALLQNAIRE 174
           QC  LV+DY FVHLSAGDLLRAEQNR+GS+YGALIKHYIKEGLIVPQEVTVALLQ AI++
Sbjct: 109 QCANLVRDYQFVHLSAGDLLRAEQNREGSKYGALIKHYIKEGLIVPQEVTVALLQQAIQD 168

Query: 175 NFEDGKKRFLVDGFPRKMDQAITFEKQIVPSKFTLFFDCPETVMLERLLERGKTSGRTDD 234
           N++ G KRFLVDGFPRKMDQAITFE+QIVPSKFTLFFDCPE VML+RLLERGKTSGR+DD
Sbjct: 169 NYDQGHKRFLVDGFPRKMDQAITFEEQIVPSKFTLFFDCPEKVMLQRLLERGKTSGRSDD 228

Query: 235 NIESIKKRFRTFIETSMPVVEYFEKQNKVIKVSCDQPIDEVYKKVQTAVEAKI 287
           N+ESIKKRF+TFIETSMPVVEYFEKQ+KV+ VSCD  +++VY++V+ AV+ KI
Sbjct: 229 NVESIKKRFKTFIETSMPVVEYFEKQDKVVSVSCDHSVEKVYEQVKAAVKEKI 281

>KLLA0E08030g complement(724562..725470) some similarities with
           sp|P15700 Saccharomyces cerevisiae YKL024c URA6
           uridine-monophosphate kinase singleton, hypothetical
           start
          Length = 302

 Score =  346 bits (887), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 166/224 (74%), Positives = 191/224 (85%), Gaps = 3/224 (1%)

Query: 67  STLFSISYQKNPPVEFMENAPED---KGPAFSPEDVSVVFVLGGPGAGKGTQCTKLVKDY 123
           S++ S+SYQKNPPV F E    D   K PAFS +DV VVFVLGGPGAGKGTQC KLVKD+
Sbjct: 77  SSVVSLSYQKNPPVAFEEGPVSDDKKKTPAFSKDDVLVVFVLGGPGAGKGTQCAKLVKDF 136

Query: 124 GFVHLSAGDLLRAEQNRKGSEYGALIKHYIKEGLIVPQEVTVALLQNAIRENFEDGKKRF 183
           GFVHLSAGDLLRAEQ R+GS+YG LIK  IK+G IVPQEVTVALL+NAI  N+    K+F
Sbjct: 137 GFVHLSAGDLLRAEQAREGSQYGELIKKCIKDGEIVPQEVTVALLKNAITSNYNSSNKKF 196

Query: 184 LVDGFPRKMDQAITFEKQIVPSKFTLFFDCPETVMLERLLERGKTSGRTDDNIESIKKRF 243
           LVDGFPRKMDQAITFE++IVPS  TLFFDCPE +MLERLL+RGKTSGR DDNIESI+KRF
Sbjct: 197 LVDGFPRKMDQAITFEEEIVPSTMTLFFDCPEKIMLERLLQRGKTSGRIDDNIESIQKRF 256

Query: 244 RTFIETSMPVVEYFEKQNKVIKVSCDQPIDEVYKKVQTAVEAKI 287
           +TF+ETS+PVVEYFEKQNKV+KVSC+QP+DEVY+ V  A++ KI
Sbjct: 257 KTFVETSVPVVEYFEKQNKVVKVSCNQPVDEVYQHVTEAIKDKI 300

>CAGL0L09867g 1054344..1055126 some similarities with sp|P15700
           Saccharomyces cerevisiae YKL024c URA6
           uridine-monophosphate kinase, hypothetical start
          Length = 260

 Score =  339 bits (870), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 161/226 (71%), Positives = 190/226 (84%), Gaps = 6/226 (2%)

Query: 67  STLFSISYQKNPPVEFME------NAPEDKGPAFSPEDVSVVFVLGGPGAGKGTQCTKLV 120
           +T++S+S +K  P EF+E         +  GPAFS + VSV+FVLGGPGAGKGTQC KLV
Sbjct: 32  TTIYSVSNEKGEPKEFLEAEKRAGKQEKQAGPAFSEDQVSVIFVLGGPGAGKGTQCAKLV 91

Query: 121 KDYGFVHLSAGDLLRAEQNRKGSEYGALIKHYIKEGLIVPQEVTVALLQNAIRENFEDGK 180
            DY FVHLSAGDLLRAEQNR+GSE+G LIKHYIKEGLIVPQE+T++LLQ AI+EN+E   
Sbjct: 92  NDYKFVHLSAGDLLRAEQNREGSEFGELIKHYIKEGLIVPQEITLSLLQKAIKENYEKNY 151

Query: 181 KRFLVDGFPRKMDQAITFEKQIVPSKFTLFFDCPETVMLERLLERGKTSGRTDDNIESIK 240
            +FLVDGFPRKMDQA++FEKQIVPSKFTLFF+CPE VMLERLLERGKTSGR DDNIESIK
Sbjct: 152 TKFLVDGFPRKMDQALSFEKQIVPSKFTLFFECPEQVMLERLLERGKTSGRADDNIESIK 211

Query: 241 KRFRTFIETSMPVVEYFEKQNKVIKVSCDQPIDEVYKKVQTAVEAK 286
           KRFRTF ETSMPVV YF+ Q+KV+KV CD P+++VY +V+ A+ AK
Sbjct: 212 KRFRTFEETSMPVVRYFDSQDKVVKVRCDHPVEDVYNQVKQALTAK 257

>Scas_685.9
          Length = 200

 Score =  333 bits (853), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 153/195 (78%), Positives = 179/195 (91%)

Query: 93  AFSPEDVSVVFVLGGPGAGKGTQCTKLVKDYGFVHLSAGDLLRAEQNRKGSEYGALIKHY 152
           AF+P+ VSV+FVLGGPGAGKGTQC KLV DYGFVHLSAGDLLRAEQNR+GSE+G LIKHY
Sbjct: 5   AFTPDQVSVIFVLGGPGAGKGTQCAKLVADYGFVHLSAGDLLRAEQNREGSEFGTLIKHY 64

Query: 153 IKEGLIVPQEVTVALLQNAIRENFEDGKKRFLVDGFPRKMDQAITFEKQIVPSKFTLFFD 212
           I EGLIVPQE+T+ALL+NAI+EN++ G K+FLVDGFPRKMDQA++FE+QIVPSKF LFFD
Sbjct: 65  ITEGLIVPQEITLALLKNAIQENYDKGMKKFLVDGFPRKMDQALSFEEQIVPSKFILFFD 124

Query: 213 CPETVMLERLLERGKTSGRTDDNIESIKKRFRTFIETSMPVVEYFEKQNKVIKVSCDQPI 272
           CPE VMLERLL+RGKTSGR DDNIESIKKRF+TF ETSMPVV+YFE Q+KVIK+ CD P+
Sbjct: 125 CPEDVMLERLLDRGKTSGRVDDNIESIKKRFKTFEETSMPVVKYFEDQHKVIKIRCDSPV 184

Query: 273 DEVYKKVQTAVEAKI 287
           D+VYK+V+ AV+ +I
Sbjct: 185 DDVYKQVKAAVDERI 199

>ACR170C [1217] [Homologous to ScYKL024C (URA6) - SH]
           (653511..654380) [870 bp, 289 aa]
          Length = 289

 Score =  327 bits (838), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 153/221 (69%), Positives = 186/221 (84%), Gaps = 2/221 (0%)

Query: 67  STLFSISYQKNPPVEFMENAPEDKGPAFSPEDVSVVFVLGGPGAGKGTQCTKLVKDYGFV 126
           +TL+SI YQK PP E  E   E   P   P D SVVFVLGGPG+GKGTQC++LV+   FV
Sbjct: 68  TTLYSIMYQKAPPRELREAEDESARPL--PADASVVFVLGGPGSGKGTQCSRLVERMQFV 125

Query: 127 HLSAGDLLRAEQNRKGSEYGALIKHYIKEGLIVPQEVTVALLQNAIRENFEDGKKRFLVD 186
           H+ AGDLLR EQNR GS+YG LIKH+IKEGLIVPQEVTVALL+ AI E++  G+++FLVD
Sbjct: 126 HVGAGDLLRDEQNRPGSQYGELIKHHIKEGLIVPQEVTVALLRRAIEEHYRAGRRKFLVD 185

Query: 187 GFPRKMDQAITFEKQIVPSKFTLFFDCPETVMLERLLERGKTSGRTDDNIESIKKRFRTF 246
           GFPRKMDQA TFEK +VPSKF LFFDCPE VMLERLL RG+TSGR+DDNIESIKKRFRT+
Sbjct: 186 GFPRKMDQAFTFEKTVVPSKFVLFFDCPERVMLERLLTRGQTSGRSDDNIESIKKRFRTY 245

Query: 247 IETSMPVVEYFEKQNKVIKVSCDQPIDEVYKKVQTAVEAKI 287
           +ETSMPVVE+F +Q+KV+++SCDQP++EVYK+V+ AV+ ++
Sbjct: 246 VETSMPVVEHFAQQDKVVRLSCDQPVEEVYKQVEAAVKERL 286

>YKL024C (URA6) [3231] chr11 complement(392169..392783)
           Uridine-monophosphate kinase (uridylate kinase),
           catalyzes the conversion of ATP and UMP to ADP and UDP
           [615 bp, 204 aa]
          Length = 204

 Score =  308 bits (790), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 143/192 (74%), Positives = 168/192 (87%)

Query: 92  PAFSPEDVSVVFVLGGPGAGKGTQCTKLVKDYGFVHLSAGDLLRAEQNRKGSEYGALIKH 151
           PAFSP+ VSV+FVLGGPGAGKGTQC KLVKDY FVHLSAGDLLRAEQ R GS+YG LIK+
Sbjct: 9   PAFSPDQVSVIFVLGGPGAGKGTQCEKLVKDYSFVHLSAGDLLRAEQGRAGSQYGELIKN 68

Query: 152 YIKEGLIVPQEVTVALLQNAIRENFEDGKKRFLVDGFPRKMDQAITFEKQIVPSKFTLFF 211
            IKEG IVPQE+T+ALL+NAI +N +  K +FL+DGFPRKMDQAI+FE+ IV SKF LFF
Sbjct: 69  CIKEGQIVPQEITLALLRNAISDNVKANKHKFLIDGFPRKMDQAISFERDIVESKFILFF 128

Query: 212 DCPETVMLERLLERGKTSGRTDDNIESIKKRFRTFIETSMPVVEYFEKQNKVIKVSCDQP 271
           DCPE +MLERLLERGKTSGR+DDNIESIKKRF TF ETSMPV+EYFE ++KV++V CD+ 
Sbjct: 129 DCPEDIMLERLLERGKTSGRSDDNIESIKKRFNTFKETSMPVIEYFETKSKVVRVRCDRS 188

Query: 272 IDEVYKKVQTAV 283
           +++VYK VQ A+
Sbjct: 189 VEDVYKDVQDAI 200

>KLLA0F13376g 1234589..1235272 highly similar to sp|P07170
           Saccharomyces cerevisiae YDR226w ADK1 adenylate kinase,
           cytosolic, start by similarity
          Length = 227

 Score = 89.4 bits (220), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 59/216 (27%), Positives = 107/216 (49%), Gaps = 36/216 (16%)

Query: 96  PEDVSVVFVLGGPGAGKGTQCTKLVKDYGFVHLSAGDLLRAEQNRKGSEYGALIKHYIKE 155
           PE + +V + G PGAGKGTQ   L + +   HL+ GD+LR+ Q  K +  G   K  + +
Sbjct: 9   PESIRMVLI-GPPGAGKGTQAPNLTERFCACHLATGDMLRS-QVAKQTPLGIEAKKIMDD 66

Query: 156 GLIVPQEVTVALLQNAIRENFEDGKKRFLVDGFPRKMDQA-------------------I 196
           G +V  E+ + ++++ +  N +D KK F++DGFPR + QA                   +
Sbjct: 67  GKLVSDEIMINMIKDELTNN-QDCKKGFILDGFPRTIPQAEKLDEMLAQQGRPLEKAVEL 125

Query: 197 TFEKQIVPSKFT-------------LFFDCPETVMLERLLERGKTSGRTDDNIESIKKRF 243
             + +++ S+ T               F+ P+T M + +        R+DDN+E++KKR 
Sbjct: 126 KIDDELLVSRITGRLVHPASGRSYHKVFNPPKTEMKDDITGEDLVQ-RSDDNVEALKKRL 184

Query: 244 RTFIETSMPVVEYFEKQNKVIKVSCDQPIDEVYKKV 279
            ++ + + P+V++++K      V   QP   V+  +
Sbjct: 185 TSYHKQTEPIVDFYKKTGIWAGVDASQPPKTVWSDI 220

>CAGL0K11418g complement(1109653..1110321) highly similar to
           sp|P07170 Saccharomyces cerevisiae YDR226w ADK1
           adenylate kinase, start by similarity
          Length = 222

 Score = 85.9 bits (211), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 58/221 (26%), Positives = 105/221 (47%), Gaps = 33/221 (14%)

Query: 94  FSPEDVSVVFVLGGPGAGKGTQCTKLVKDYGFVHLSAGDLLRAEQNRKGSEYGALIKHYI 153
            S  D   + ++G PGAGKGTQ   LV+ +   HL+ GD+LR+ Q  KG+E G   K  +
Sbjct: 1   MSSSDSIRMVLIGPPGAGKGTQAPNLVERFHAAHLATGDMLRS-QISKGTELGLQAKKIM 59

Query: 154 KEGLIVPQEVTVALLQNAIRENFEDGKKRFLVDGFPRKMDQAITFEKQI----VPSKFTL 209
            +G +V  ++ V ++++ +  N    K  F++DGFPR + QA   +  +     P +  +
Sbjct: 60  DQGGLVSDDIMVNMIKDELTNN-PACKNGFILDGFPRTIPQAEKLDNMLKERGTPLEKAV 118

Query: 210 FFDCPETVMLERLLER--GKTSG-------------------------RTDDNIESIKKR 242
                + +++ R+  R     SG                         R+DDN +++KKR
Sbjct: 119 ELKIDDELLVARITGRLIHPASGRSYHKLFNPPKEDMKDDVTGEPLVQRSDDNEDALKKR 178

Query: 243 FRTFIETSMPVVEYFEKQNKVIKVSCDQPIDEVYKKVQTAV 283
              + + + P+V++++K      V   QP + V+  +  A+
Sbjct: 179 LGAYHDQTEPIVDFYKKTGIWADVDASQPPETVWSAILKAL 219

>AGR187W [4498] [Homologous to ScYDR226W (ADK1) - SH]
           complement(1102660..1103493) [834 bp, 277 aa]
          Length = 277

 Score = 85.9 bits (211), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 60/219 (27%), Positives = 104/219 (47%), Gaps = 34/219 (15%)

Query: 96  PEDVSVVFVLGGPGAGKGTQCTKLVKDYGFVHLSAGDLLRAEQNRKGSEYGALIKHYIKE 155
           PE + +V + G PGAGKGTQ  KL + +   HL+ GD+LR+ Q  K +  G   K  + +
Sbjct: 60  PEAIRMVLI-GPPGAGKGTQAPKLKEKFCVCHLATGDMLRS-QVAKQTALGVQAKKIMDQ 117

Query: 156 GLIVPQEVTVALLQNAIRENFEDGKKRFLVDGFPRKMDQAITFEKQIV----PSKFTLFF 211
           G +V  E+ V ++++ +R N E     F++DGFPR + QA   ++ +V    P    +  
Sbjct: 118 GGLVSDEIMVNMIKDELRSNPECANG-FILDGFPRTIPQAQKLDEMLVAQGKPLDRAVEL 176

Query: 212 DCPETVMLERLLER--GKTSG-------------------------RTDDNIESIKKRFR 244
              + +++ R+  R     SG                         R+DDN +++KKR  
Sbjct: 177 KIDDELLVARITGRLVHPASGRSYHKLFNPPKVAMTDDVTGDPLVQRSDDNADALKKRLD 236

Query: 245 TFIETSMPVVEYFEKQNKVIKVSCDQPIDEVYKKVQTAV 283
            +   + P+V++++K      V   QP   V+  +  A+
Sbjct: 237 AYHAQTEPIVDFYKKTGIWAGVDASQPPKTVWSDILKAL 275

>Scas_721.82
          Length = 221

 Score = 84.7 bits (208), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 60/224 (26%), Positives = 106/224 (47%), Gaps = 34/224 (15%)

Query: 94  FSPEDVSVVFVLGGPGAGKGTQCTKLVKDYGFVHLSAGDLLRAEQNRKGSEYGALIKHYI 153
            S E + +V + G PGAGKGTQ   LV+ +   HLS GD+LR+ Q  K +E G   K  +
Sbjct: 1   MSTESIRMVLI-GPPGAGKGTQAPNLVEKFHACHLSTGDMLRS-QIAKNTELGQEAKKIM 58

Query: 154 KEGLIVPQEVTVALLQNAIRENFEDGKKRFLVDGFPRKMDQAITFEKQIV----PSKFTL 209
            +G +V  E+ V ++++ +  N    K  F++DGFPR + QA   ++ +     P +  +
Sbjct: 59  DQGGLVSDEIMVNMIKDELTNN-PACKNGFILDGFPRTIPQAEKLDQMLAERGTPLQRAV 117

Query: 210 FFDCPETVMLERLLER--GKTSG-------------------------RTDDNIESIKKR 242
                + +++ R+  R     SG                         R+DDN +++KKR
Sbjct: 118 ELQVDDDLLVARITGRLIHPASGRSYHKLFNPPKVDMVDDVTGEPLIQRSDDNADALKKR 177

Query: 243 FRTFIETSMPVVEYFEKQNKVIKVSCDQPIDEVYKKVQTAVEAK 286
              +   + P+V++++K      V   QP   V+ ++  ++  K
Sbjct: 178 LAGYHAQTEPIVDFYKKTGIWSGVDASQPPATVWDEILKSLSQK 221

>Kwal_56.23489
          Length = 225

 Score = 83.6 bits (205), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 64/220 (29%), Positives = 104/220 (47%), Gaps = 41/220 (18%)

Query: 102 VFVLGGPGAGKGTQCTKLVKDYGFVH-LSAGDLLRAEQNRKGSEYGALIKHYIKEGLIVP 160
           + +LG PG+GKGTQ +KL+  + ++  +S+GDLLR E  +K +  G+L   YI +G ++P
Sbjct: 6   ILLLGAPGSGKGTQTSKLLSHFKYIRSISSGDLLRQEIQKK-THLGSLASEYISQGKLLP 64

Query: 161 QEVTVALLQNAI-RENFEDGKKRFLVDGFPRKMDQAITFEKQIVPS----KFTLFFDCPE 215
             +   L+ N +           FL+DGFPR +DQA +   ++ P        +  D P 
Sbjct: 65  DSLVTELVTNELTARGLLSSDSSFLLDGFPRTLDQAKSLRSKLAPHGSPLNLVVELDVPS 124

Query: 216 TVMLERLLER--------------------GK-------TSGRTDDNIESIKKRFRTFIE 248
           +V+LER+  R                    GK        + R DD  E   KR   + +
Sbjct: 125 SVILERIENRYVHVPSGRVYNLTYNPPLVAGKDDVTGEPLTKRPDDTAEVFGKRLENYAQ 184

Query: 249 TSMPVVEYFEKQNKVIKVSCD-------QPIDEVYKKVQT 281
           T  P+ +++     + KVS +       Q +D V KK++T
Sbjct: 185 TVEPLKQFYADLGILHKVSGETSDIIFPQLLDLVSKKMRT 224

>KLLA0C17754g 1576357..1577040 similar to sp|P26364 Saccharomyces
           cerevisiae YER170w ADK2 adenylate kinase, mitochondrial,
           start by similarity
          Length = 227

 Score = 83.6 bits (205), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 61/217 (28%), Positives = 106/217 (48%), Gaps = 35/217 (16%)

Query: 106 GGPGAGKGTQCTKLVKDYGFVH-LSAGDLLRAEQNRKGSEYGALIKHYIKEGLIVPQEVT 164
           G PG+GKGTQ +KL+K++G +  +S+GDLLR +Q   G+  G     YI++G ++P ++ 
Sbjct: 13  GAPGSGKGTQTSKLLKEFGSIKAISSGDLLR-KQIEHGTPLGLSASSYIEKGQLLPDDLI 71

Query: 165 VALLQNAIRE-NFEDGKKRFLVDGFPRKMDQAITFEKQIVPSKFTLF----FDCPETVML 219
             ++ + ++   + +    +L+DGFPR + QA   +K ++    +L      D P  V+L
Sbjct: 72  TGVVCDELKSRGWLNPNATWLLDGFPRTVGQAEVLDKSLLEHDASLNLVVELDVPHEVIL 131

Query: 220 ERLLER--------------------GK-------TSGRTDDNIESIKKRFRTFIETSMP 252
           ER+  R                    GK        + R DD  E   KR   + +T  P
Sbjct: 132 ERIENRYVHVPSGRVYNLQYNPPKVDGKDDITGEPLTKRPDDTAEVFGKRLEQYNKTVTP 191

Query: 253 VVEYFEKQNKVIKVSCDQPIDEVYKKVQTAVEAKIEN 289
           + E++ KQ  +  +S +   D +Y K+ + +  K  N
Sbjct: 192 LKEHYLKQGILSTISGNTS-DIIYPKLVSLILQKFAN 227

>CAGL0L11902g 1276048..1276803 similar to sp|P26364 Saccharomyces
           cerevisiae YER170w KAD2, hypothetical start
          Length = 251

 Score = 82.8 bits (203), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 60/193 (31%), Positives = 98/193 (50%), Gaps = 34/193 (17%)

Query: 110 AGKGTQCTKLVKDY-GFVHLSAGDLLRAEQNRKGSEYGALIKHYIKEGLIVPQEV-TVAL 167
           +GKGTQ +KL+K       +S+GD+LR E  + G+E G L   YI +G ++P +V T  L
Sbjct: 19  SGKGTQTSKLLKVLPELKSVSSGDILRHEL-KSGTELGVLAAKYIAQGKLIPDKVITQVL 77

Query: 168 LQNAIRENFEDGKKRFLVDGFPRKMDQAITFEKQIVP--SKFTLF--FDCPETVMLERLL 223
           + +  +E + + +  +L+DGFPR   QA + +  +    +K  L    D PE V+LER+ 
Sbjct: 78  IAHLSKEKWLNPQSSWLLDGFPRTERQAFSLDSTLGENNAKLNLVVELDVPEEVILERID 137

Query: 224 ER----------------GKTSG-----------RTDDNIESIKKRFRTFIETSMPVVEY 256
            R                 K +G           R+DDN++  KKR + + +T  P+ E+
Sbjct: 138 NRYIHVGSGRVYNLQYNPPKVAGKDDVTGEPLVKRSDDNVQVFKKRMKEYKKTLGPIKEH 197

Query: 257 FEKQNKVIKVSCD 269
           + KQ  +  +S D
Sbjct: 198 YAKQGILATISGD 210

>Kwal_27.11607
          Length = 227

 Score = 81.6 bits (200), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 59/216 (27%), Positives = 106/216 (49%), Gaps = 36/216 (16%)

Query: 96  PEDVSVVFVLGGPGAGKGTQCTKLVKDYGFVHLSAGDLLRAEQNRKGSEYGALIKHYIKE 155
           PE V +V + G PGAGKGTQ   L + +   HL+ GD+LR++  +K +E G   K  + +
Sbjct: 9   PESVRMVLI-GPPGAGKGTQAPNLKERFCACHLATGDMLRSQVAQK-TELGLEAKKIMDQ 66

Query: 156 GLIVPQEVTVALLQNAIRENFEDGKKRFLVDGFPR------KMDQAIT------------ 197
           G +V  ++ V ++++ +  N E  K  F++DGFPR      K+DQ +T            
Sbjct: 67  GGLVSDDIMVKMIKHELITNPE-CKSGFILDGFPRTIPQAEKLDQMLTEQGRPLEKAIEL 125

Query: 198 -FEKQIVPSKFT-------------LFFDCPETVMLERLLERGKTSGRTDDNIESIKKRF 243
             + +++ S+ T               F+ P+  M + +        R+DDN +++KKR 
Sbjct: 126 KIDDELLVSRITGRLVHPASGRSYHKIFNPPKKEMTDDVTGEALVQ-RSDDNADALKKRL 184

Query: 244 RTFIETSMPVVEYFEKQNKVIKVSCDQPIDEVYKKV 279
             + + + P+V++++K      V   QP   V+  +
Sbjct: 185 GAYHQQTEPIVDFYKKTGIWSGVDASQPPKTVWADI 220

>YDR226W (ADK1) [1062] chr4 (916478..917146) Adenylate kinase
           (GTP:AMP phosphotransferase), cytoplasmic and
           mitochondrial [669 bp, 222 aa]
          Length = 222

 Score = 80.5 bits (197), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 57/216 (26%), Positives = 102/216 (47%), Gaps = 34/216 (15%)

Query: 95  SPEDVSVVFVLGGPGAGKGTQCTKLVKDYGFVHLSAGDLLRAEQNRKGSEYGALIKHYIK 154
           S E + +V + G PGAGKGTQ   L + +   HL+ GD+LR+ Q  KG++ G   K  + 
Sbjct: 3   SSESIRMVLI-GPPGAGKGTQAPNLQERFHAAHLATGDMLRS-QIAKGTQLGLEAKKIMD 60

Query: 155 EGLIVPQEVTVALLQNAIRENFEDGKKRFLVDGFPRKMDQAITFEK----QIVPSKFTLF 210
           +G +V  ++ V ++++ +  N    K  F++DGFPR + QA   ++    Q  P +  + 
Sbjct: 61  QGGLVSDDIMVNMIKDELTNN-PACKNGFILDGFPRTIPQAEKLDQMLKEQGTPLEKAIE 119

Query: 211 FDCPETVMLERLLER--GKTSG-------------------------RTDDNIESIKKRF 243
               + +++ R+  R     SG                         R+DDN +++KKR 
Sbjct: 120 LKVDDELLVARITGRLIHPASGRSYHKIFNPPKEDMKDDVTGEALVQRSDDNADALKKRL 179

Query: 244 RTFIETSMPVVEYFEKQNKVIKVSCDQPIDEVYKKV 279
             +   + P+V++++K      V   QP   V+  +
Sbjct: 180 AAYHAQTEPIVDFYKKTGIWAGVDASQPPATVWADI 215

>AGR115C [4426] [Homologous to ScYER170W (ADK2) - SH]
           (959464..960219) [756 bp, 251 aa]
          Length = 251

 Score = 79.3 bits (194), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 61/219 (27%), Positives = 105/219 (47%), Gaps = 35/219 (15%)

Query: 102 VFVLGGPGAGKGTQCTKLVKDY-GFVHLSAGDLLRAEQNRKGSEYGALIKHYIKEGLIVP 160
           + +LG PGAGKGTQ  +L++ + G   +++GDLLR E    GS  G     +I  G ++P
Sbjct: 33  LLLLGAPGAGKGTQMGRLLQRFPGLQAVASGDLLRREIA-AGSPLGEQAAAHIAAGRLLP 91

Query: 161 QE-VTVALLQNAIRENFEDGKKRFLVDGFPRKMDQAITFEKQI--VPSKFTLFFD--CPE 215
              V+ A+L    R  +  G   +L+DGFPR + QA   +  +    +  TL  +   PE
Sbjct: 92  DALVSSAILDELARRRWLHGGASWLLDGFPRTVAQAQELDAALERADAALTLVVEVAVPE 151

Query: 216 TVMLERLLER------GKT---------------------SGRTDDNIESIKKRFRTFIE 248
            V+L+R+ +R      G+                      S R DD  E   KR + +  
Sbjct: 152 DVILDRIQKRFVHVPSGRVYNLDYNPPCEAGRDDVTGEPLSRRPDDTPEVFYKRMQEYAA 211

Query: 249 TSMPVVEYFEKQNKVIKVSCDQPIDEVYKKVQTAVEAKI 287
           T+ P+ E++ +Q  +++       D V+ +++  V+A++
Sbjct: 212 TAGPLKEHYARQG-ILRTVRGPTSDIVFPQLERLVQAQL 249

>Scas_681.18
          Length = 248

 Score = 79.0 bits (193), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 61/228 (26%), Positives = 116/228 (50%), Gaps = 44/228 (19%)

Query: 101 VVFVLGGPGAGKGTQCTKLVKDYGFVH-LSAGDLLRAEQNRKGSEYGALIKHYIKEGLIV 159
           +VF LG PG+GKGTQ ++L++    V+ +S+GD+LR E   + ++ G L   +I +G ++
Sbjct: 10  LVF-LGAPGSGKGTQISRLIQLLPTVNRISSGDILRQEIQAE-TKLGQLASQFIAQGKLI 67

Query: 160 PQEVTVALLQNAIRE-NFEDGKKR--FLVDGFPRKMDQAITFEKQIVPS----KFTLFFD 212
           P ++   LL + ++E N+  G+ +  +++DGFPR + QA  F++ +          +  D
Sbjct: 68  PDDLIDKLLISKLQEQNWLAGRSKSSWVLDGFPRTITQAQKFDETLDKYNKNLNLVVELD 127

Query: 213 CPETVMLERLLER--------------------GKTS-------GRTDDNIESIKKRFRT 245
            P  V+LER+  R                    GK          R+DD+  + KKR + 
Sbjct: 128 VPTEVILERIENRYVHIPSGRIYNLQFNPPRVPGKDDITGEPLVKRSDDSAATFKKRLQE 187

Query: 246 FIETSMPVVEYFEKQNKVIKVSCD-------QPIDEVYKKVQTAVEAK 286
           + ET  P+ EY++ Q  +  +S +       + ++ ++K+  T ++ +
Sbjct: 188 YHETLGPLKEYYQSQGLLQTISGETSDIIFPKLLNMIHKRFHTGIQIR 235

>Sklu_2123.2 YDR226W, Contig c2123 4210-4896
          Length = 228

 Score = 76.6 bits (187), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 54/215 (25%), Positives = 101/215 (46%), Gaps = 34/215 (15%)

Query: 96  PEDVSVVFVLGGPGAGKGTQCTKLVKDYGFVHLSAGDLLRAEQNRKGSEYGALIKHYIKE 155
           PE + +V + G PGAGKGTQ   L + +   HL+ GD+LR++  +K +  G   K  + +
Sbjct: 10  PESIRMVLI-GPPGAGKGTQAPNLKERFCACHLATGDMLRSQVAKK-TALGLEAKKIMDQ 67

Query: 156 GLIVPQEVTVALLQNAIRENFEDGKKRFLVDGFPRKMDQAITFEKQIV----PSKFTLFF 211
           G +V  ++ V +++  +  N E  K  F++DGFPR + QA   ++ +     P +  +  
Sbjct: 68  GGLVSDDIMVNMIKEELATNPE-CKNGFILDGFPRTIPQAEKLDEMLAEQGKPLERAIEL 126

Query: 212 DCPETVMLERLLER--GKTSG-------------------------RTDDNIESIKKRFR 244
              + +++ R+  R     SG                         R+DDN +++KKR  
Sbjct: 127 KIDDELLVARITGRLVHPASGRSYHKLFNPPKVDMKDDVTGEPLVQRSDDNADALKKRLN 186

Query: 245 TFIETSMPVVEYFEKQNKVIKVSCDQPIDEVYKKV 279
            + + + P+V++++K      V   Q    V+  +
Sbjct: 187 AYHQQTEPIVDFYKKTGIWSGVDASQAPSTVWSDI 221

>YER170W (ADK2) [1598] chr5 (525969..526646) Adenylate kinase
           (GTP:AMP phosphotransferase), mitochondrial [678 bp, 225
           aa]
          Length = 225

 Score = 64.3 bits (155), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 51/187 (27%), Positives = 85/187 (45%), Gaps = 34/187 (18%)

Query: 106 GGPGAGKGTQCTKLVKDY-GFVHLSAGDLLRAEQNRKGSEYGALIKHYIKEGLIVPQEVT 164
           G PG+GKGTQ ++L+K       +S+GD+LR E   + S  G     YI +G ++P ++ 
Sbjct: 21  GAPGSGKGTQTSRLLKQIPQLSSISSGDILRQEIKSE-STLGREATTYIAQGKLLPDDLI 79

Query: 165 VALLQNAIRE-NFEDGKKRFLVDGFPRKMDQAITFEKQIVPSKFTLF----FDCPETVML 219
             L+   +    +      +L+DGFPR   QA   ++ +     +L      D PE+ +L
Sbjct: 80  TRLITFRLSALGWLKPSAMWLLDGFPRTTAQASALDELLKQHDASLNLVVELDVPESTIL 139

Query: 220 ERLLER------GKT---------------------SGRTDDNIESIKKRFRTFIETSMP 252
           ER+  R      G+                      + R DD  E  KKR   + +T+ P
Sbjct: 140 ERIENRYVHVPSGRVYNLQYNPPKVPGLDDITGEPLTKRLDDTAEVFKKRLEEYKKTNEP 199

Query: 253 VVEYFEK 259
           + +Y++K
Sbjct: 200 LKDYYKK 206

>Sklu_2063.3 YDL166C, Contig c2063 1224-1850
          Length = 208

 Score = 36.2 bits (82), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 30/140 (21%), Positives = 64/140 (45%), Gaps = 25/140 (17%)

Query: 102 VFVLGGPGAGKGTQCTKLVK---DYGFVHLSAGDLLRAEQNRKGSEYGALIKHYIKEGLI 158
           + V G PG GK T C  LV+   DY + ++S  D  R  +   G +        +++  I
Sbjct: 10  ILVTGTPGCGKSTTCELLVRRLSDYTYYNIS--DFAREHKCYDGYD-------EVRKSHI 60

Query: 159 VPQEVTVALLQNAIRENFEDGKKRFLVDGFPRKMDQAITFEKQIVPSKFTLFFDCPETVM 218
           V ++  +  L+  +R      K + +VD     +     F ++++     +   C  +++
Sbjct: 61  VDEDKLLDELEPLLR------KGKSIVDWHVNDV-----FPERLI--DLVVVLRCDNSIL 107

Query: 219 LERLLERGKTSGRTDDNIES 238
            +RL +RG    + ++N+++
Sbjct: 108 YDRLHKRGYHDSKIEENLDA 127

>AGL098W [4214] [Homologous to ScYLR231C - SH]
           complement(519389..520732) [1344 bp, 447 aa]
          Length = 447

 Score = 34.7 bits (78), Expect = 0.088,   Method: Compositional matrix adjust.
 Identities = 20/79 (25%), Positives = 35/79 (44%), Gaps = 7/79 (8%)

Query: 189 PRKMDQAITFEKQIVPSKFTLFFDC-------PETVMLERLLERGKTSGRTDDNIESIKK 241
           PR     I  EKQ+ PS F  F++        P   +++     G+ + RT+D + +I+ 
Sbjct: 120 PRGRRTKILLEKQVFPSDFHAFWNQAALHGLDPAATLVQVAPRAGEHTLRTEDIVPAIET 179

Query: 242 RFRTFIETSMPVVEYFEKQ 260
                    +P V+Y+  Q
Sbjct: 180 HRAELALVCLPGVQYYTGQ 198

>ADR282C [2023] [Homologous to ScYMR157C - SH] (1182869..1183534)
           [666 bp, 221 aa]
          Length = 221

 Score = 33.9 bits (76), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 45/200 (22%), Positives = 71/200 (35%), Gaps = 32/200 (16%)

Query: 24  RGLSMTRLYSTQNQQGGQHQEKDQRPTKXXXXXXXXXXXXXXXSTLFSISYQKN-----P 78
           R L   RL   + QQG       + P                 STL  +   K+     P
Sbjct: 3   RRLVTPRLLRLRRQQGLSRPYASKAPGSEDLPSAWKMVGVAVVSTLIFVQAAKSIDRSKP 62

Query: 79  PVEFMENAPED-------KGPAFSPEDVSVVFVLG--------GPGAGKGTQCTKLVKDY 123
             EF E   E        +   F P+++ V+ VL          P   +  +  + ++ +
Sbjct: 63  QTEFSEAEFEKVRSGLRRRVTVFKPDELEVLAVLADVPVEKIRAPAGARAVRVQQALERF 122

Query: 124 GF-VHLSAGDLLRAEQNRKGSEYGALIKHYIKEGLIVPQEVTVALLQNAIRENFEDGKKR 182
               H     LL       G +Y A +          P+   VAL+   ++E  + G   
Sbjct: 123 RTDEHDKYHALLEELHAVHGDDYSAHL----------PKGALVALMGRYLKEVCQAGDSV 172

Query: 183 FLVDGFPRKMDQAITFEKQI 202
            L+ GFPR M +AI FE ++
Sbjct: 173 VLL-GFPRNMQEAIQFESEV 191

>Scas_617.7
          Length = 420

 Score = 32.7 bits (73), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 18/64 (28%), Positives = 32/64 (50%)

Query: 125 FVHLSAGDLLRAEQNRKGSEYGALIKHYIKEGLIVPQEVTVALLQNAIRENFEDGKKRFL 184
           F H+  G L +AE  +        I+   KE +++  E+T+ +  N  RE  ++  K F+
Sbjct: 238 FSHIELGSLTKAEPPQSEKLEDKAIEKISKEPVLLHSEITLKVPSNVSRERLDNTVKSFI 297

Query: 185 VDGF 188
            +GF
Sbjct: 298 EEGF 301

>AFR310C [3502] [Homologous to ScYGR130C - SH] (1001496..1003367)
           [1872 bp, 623 aa]
          Length = 623

 Score = 30.0 bits (66), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 28/55 (50%), Gaps = 10/55 (18%)

Query: 140 RKGSEYGALIKHYIKEGLIV----PQEVTVALLQN------AIRENFEDGKKRFL 184
           +KG + G L KH+ KE L+V    P+E  V LL N      A+ +   D +K  L
Sbjct: 259 QKGGKLGGLFKHHDKEQLLVPNGTPEEPEVVLLTNRGYMSKAVYDRLNDEEKAHL 313

>Sklu_2300.1 YKL107W, Contig c2300 3026-3907 reverse complement
          Length = 293

 Score = 29.6 bits (65), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 25/51 (49%)

Query: 80  VEFMENAPEDKGPAFSPEDVSVVFVLGGPGAGKGTQCTKLVKDYGFVHLSA 130
           V   E AP+   P+  P   + VFV+G PGAGK      L  D  +  +SA
Sbjct: 123 VILQETAPKLGRPSVLPGVGTRVFVMGYPGAGKVGNVDDLNSDKSYGVMSA 173

>AAR041W [227] [Homologous to ScYPR088C (SRP54) - SH]
           complement(414310..415854) [1545 bp, 514 aa]
          Length = 514

 Score = 29.6 bits (65), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 19/41 (46%), Positives = 22/41 (53%), Gaps = 4/41 (9%)

Query: 100 SVVFVLGGPGAGKGTQCTKLVKDY---GF-VHLSAGDLLRA 136
           +VV  +G  GAGK T C+KL   Y   GF V L   D  RA
Sbjct: 106 NVVMFVGLQGAGKSTSCSKLAVYYSKRGFKVGLVCADTFRA 146

>CAGL0M02981g 335863..337716 similar to sp|Q03262 Saccharomyces
           cerevisiae YMR278w, hypothetical start
          Length = 617

 Score = 29.3 bits (64), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 15/45 (33%), Positives = 27/45 (60%)

Query: 239 IKKRFRTFIETSMPVVEYFEKQNKVIKVSCDQPIDEVYKKVQTAV 283
           I    RT IE+ + + +  E +N+VIK+  DQ  DE++K+  + +
Sbjct: 6   IPVELRTAIESWLQLDKNEETRNEVIKLCNDQNWDELHKRFDSRI 50

>KLLA0D12012g 1024590..1026203 similar to sgd|S0005951 Saccharomyces
           cerevisiae YPL030w, hypothetical start
          Length = 537

 Score = 28.9 bits (63), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 27/52 (51%), Gaps = 5/52 (9%)

Query: 109 GAGKGTQCTKLVKDYGFVHLSAGDLLRAEQNRKGSEYGALIKHYIKEGLIVP 160
           G G G  C  L+++ GF  L     + A Q +  S Y A +K  +KE +I+P
Sbjct: 299 GCGNGVLCYILIQE-GFKGLG----IDARQRKSWSIYPAEVKRCLKEQVIIP 345

>Kwal_23.3611
          Length = 228

 Score = 28.1 bits (61), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 20/79 (25%), Positives = 38/79 (48%), Gaps = 12/79 (15%)

Query: 140 RKGSEYGALI--------KHYIKEGLIVPQEVTVALLQNAIRENFEDGKKRFLVDGFPRK 191
           ++G +Y AL+        KHY+++   +P  + V L+   ++E   +G    ++  FP  
Sbjct: 132 QEGDKYQALLNELLDSHGKHYVEK---LPSGMLVMLVGRYLKE-VCNGADNVVIANFPLN 187

Query: 192 MDQAITFEKQIVPSKFTLF 210
           +  AI FE ++      LF
Sbjct: 188 LKDAIKFENEVCVVDKVLF 206

>YPL217C (BMS1) [5232] chr16 complement(139619..143170) Protein
           involved rRNA processing and 40S ribosomal subunit
           biogenesis, contains a GTP-binding domain, and interacts
           genetically with BMH1 [3552 bp, 1183 aa]
          Length = 1183

 Score = 28.5 bits (62), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 16/42 (38%), Positives = 21/42 (50%), Gaps = 6/42 (14%)

Query: 80  VEFMENAPEDKGPAFSPEDVSVVFVLGGPGAGKGTQCTKLVK 121
           V  ++  PED  P F      +V V+G PG GK T    LV+
Sbjct: 56  VPMVDRTPEDDPPPF------IVAVVGPPGTGKTTLIRSLVR 91

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.318    0.135    0.385 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 8,899,670
Number of extensions: 374195
Number of successful extensions: 1088
Number of sequences better than 10.0: 44
Number of HSP's gapped: 1060
Number of HSP's successfully gapped: 45
Length of query: 289
Length of database: 16,596,109
Length adjustment: 101
Effective length of query: 188
Effective length of database: 13,099,691
Effective search space: 2462741908
Effective search space used: 2462741908
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 61 (28.1 bits)