Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Sklu_2380.41601607851e-109
KLLA0E08063g1861484207e-53
Scas_685.82521414162e-51
CAGL0F06919g2501564059e-50
CAGL0F06897g2581404014e-49
ACR171C2511454005e-49
YIR035C2541403962e-48
Scas_628.62521433936e-48
YIR036C2631523345e-39
ABR247W2501393292e-38
ABR249W2501393283e-38
ABR248W2611383215e-37
ABR246W2501452857e-32
KLLA0E09834g2681431602e-13
AER373C3001491435e-11
Scas_594.122671651338e-10
AFR561W2671641251e-08
YMR226C2671641232e-08
Kwal_26.91602671641213e-08
Sklu_1578.32681641205e-08
KLLA0B08371g2681641135e-07
Scas_662.43071561118e-07
KLLA0E24046g2801191092e-06
YLR426W3261131073e-06
KLLA0D02596g3471541065e-06
CAGL0G08690g2941601022e-05
Kwal_14.24442881471022e-05
KLLA0D15521g2561131012e-05
CAGL0M11242g2681641012e-05
KLLA0E13860g8891461012e-05
Scas_666.17*283114993e-05
Sklu_1570.1756143951e-04
Kwal_55.19569288122951e-04
Kwal_27.12155280122932e-04
ABL163W29293923e-04
Sklu_2267.535091923e-04
AGL060W891141933e-04
Kwal_26.7950897115924e-04
Scas_478.2920141907e-04
Kwal_34.16024292113880.001
KLLA0D18909g29080880.001
Kwal_14.151127796870.001
YIL124W (AYR1)297158870.001
Sklu_2348.5289147860.002
YNL202W (SPS19)29580850.002
CAGL0L02167g901148860.002
Sklu_268.124487840.003
CAGL0H08063g29080820.006
Kwal_26.828229829780.021
KLLA0F04455g305149770.027
Sklu_2420.5326162770.032
AAL089W328157760.041
YKR009C (FOX2)900103760.047
Kwal_47.17102285112750.054
Scas_675.1031263740.068
Kwal_23.457230082740.068
AER111W327108730.096
Sklu_2445.2438112730.11
Kwal_14.2598311100720.13
Scas_650.8326161710.16
Kwal_56.2386334475700.22
Scas_613.18286112700.24
CAGL0J04774g338135690.27
CAGL0H10450g311153690.32
AEL164C30741680.35
YKL055C (OAR1)27829680.38
Scas_674.1134676670.57
Sklu_1624.3316166660.69
Scas_721.4734465660.70
CAGL0H07513g35248660.87
Scas_574.937173650.97
ADL292C329103651.00
Sklu_1211.184382651.2
CAGL0K09152g327109641.3
KLLA0D06127g330159641.4
YBR265W (TSC10)32040641.4
Sklu_2404.1330129632.0
Kwal_56.2387568053622.6
Kwal_55.21822283126612.9
Kwal_14.165368848605.7
CAGL0K05269g76125595.9
KLLA0C19547g33366596.0
Kwal_23.4862173185597.3
Kwal_23.310724889587.5
KLLA0F08415g68889588.2
Kwal_26.8838323153579.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Sklu_2380.4
         (160 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Sklu_2380.4 YIR035C, Contig c2380 9858-10340                          306   e-109
KLLA0E08063g complement(726232..726792) some similarities with s...   166   7e-53
Scas_685.8                                                            164   2e-51
CAGL0F06919g complement(677473..678225) similar to sp|P40579 Sac...   160   9e-50
CAGL0F06897g complement(675416..676192) highly similar to sp|P40...   159   4e-49
ACR171C [1218] [Homologous to ScYIR035C - SH; ScYIR036C - SH] (6...   158   5e-49
YIR035C (YIR035C) [2699] chr9 complement(421023..421787) Member ...   157   2e-48
Scas_628.6                                                            155   6e-48
YIR036C (YIR036C) [2700] chr9 complement(422071..422862) Reducta...   133   5e-39
ABR247W [841] [Homologous to ScYIR035C - NSH; ScYIR036C - NSH] c...   131   2e-38
ABR249W [843] [Homologous to ScYIR035C - NSH; ScYIR036C - NSH] c...   130   3e-38
ABR248W [842] [Homologous to ScYIR035C - NSH; ScYIR036C - NSH] c...   128   5e-37
ABR246W [840] [Homologous to ScYIR035C - NSH; ScYIR036C - NSH] c...   114   7e-32
KLLA0E09834g complement(872888..873694) similar to sp|Q9ALU7 Ent...    66   2e-13
AER373C [2874] [Homologous to ScYIL124W (AYR1) - SH] (1327314..1...    60   5e-11
Scas_594.12                                                            56   8e-10
AFR561W [3753] [Homologous to ScYMR226C - SH] complement(1438981...    53   1e-08
YMR226C (YMR226C) [4182] chr13 complement(721592..722395) NADP+-...    52   2e-08
Kwal_26.9160                                                           51   3e-08
Sklu_1578.3 YMR226C, Contig c1578 1774-2580                            51   5e-08
KLLA0B08371g complement(747517..748323) highly similar to sp|Q05...    48   5e-07
Scas_662.4                                                             47   8e-07
KLLA0E24046g complement(2136583..2137425) similar to ca|CA3771|C...    47   2e-06
YLR426W (YLR426W) [3802] chr12 (987058..987137,987209..988109) M...    46   3e-06
KLLA0D02596g join(complement(219682..219797),complement(218659.....    45   5e-06
CAGL0G08690g complement(822798..823682) similar to sp|P40471 Sac...    44   2e-05
Kwal_14.2444                                                           44   2e-05
KLLA0D15521g 1311601..1312371 similar to sp|Q8TTF8 Methanosarcin...    44   2e-05
CAGL0M11242g complement(1105723..1106529) highly similar to sp|Q...    44   2e-05
KLLA0E13860g 1219430..1222099 similar to sp|Q02207 Saccharomyces...    44   2e-05
Scas_666.17*                                                           43   3e-05
Sklu_1570.1 YKR009C, Contig c1570 100-2370                             41   1e-04
Kwal_55.19569                                                          41   1e-04
Kwal_27.12155                                                          40   2e-04
ABL163W [429] [Homologous to ScYNL202W (SPS19) - SH] complement(...    40   3e-04
Sklu_2267.5 YNL202W, Contig c2267 5903-6955                            40   3e-04
AGL060W [4251] [Homologous to ScYKR009C (FOX2) - SH] complement(...    40   3e-04
Kwal_26.7950                                                           40   4e-04
Scas_478.2                                                             39   7e-04
Kwal_34.16024                                                          39   0.001
KLLA0D18909g complement(1592628..1593500) similar to sp|P32573 S...    39   0.001
Kwal_14.1511                                                           38   0.001
YIL124W (AYR1) [2552] chr9 (126204..127097) 1-Acyl dihydroxyacet...    38   0.001
Sklu_2348.5 YIL124W, Contig c2348 10212-11081 reverse complement       38   0.002
YNL202W (SPS19) [4400] chr14 (259568..260455) Peroxisomal 2,4-di...    37   0.002
CAGL0L02167g 253055..255760 highly similar to sp|Q02207 Saccharo...    38   0.002
Sklu_268.1 , Contig c268 57-791 reverse complement                     37   0.003
CAGL0H08063g 785331..786203 highly similar to sp|P32573 Saccharo...    36   0.006
Kwal_26.8282                                                           35   0.021
KLLA0F04455g complement(428010..428927) similar to sp|P40471 Sac...    34   0.027
Sklu_2420.5 YOR246C, Contig c2420 9342-10322 reverse complement        34   0.032
AAL089W [98] [Homologous to ScYOR246C - SH] complement(184564..1...    34   0.041
YKR009C (FOX2) [3265] chr11 complement(453995..456697) Multifunc...    34   0.047
Kwal_47.17102                                                          33   0.054
Scas_675.10                                                            33   0.068
Kwal_23.4572                                                           33   0.068
AER111W [2616] [Homologous to ScYLR426W - SH] complement(846805....    33   0.096
Sklu_2445.2 YDR179W-A, Contig c2445 357-1673 reverse complement        33   0.11 
Kwal_14.2598                                                           32   0.13 
Scas_650.8                                                             32   0.16 
Kwal_56.23863                                                          32   0.22 
Scas_613.18                                                            32   0.24 
CAGL0J04774g join(452094..452179,452259..453189) similar to tr|Q...    31   0.27 
CAGL0H10450g complement(1018805..1019740) similar to tr|Q07530 S...    31   0.32 
AEL164C [2342] [Homologous to ScYBR265W (TSC10) - SH] (326834..3...    31   0.35 
YKL055C (OAR1) [3204] chr11 complement(334966..335802) 3-Oxoacyl...    31   0.38 
Scas_674.11                                                            30   0.57 
Sklu_1624.3 YBR265W, Contig c1624 1338-2288                            30   0.69 
Scas_721.47                                                            30   0.70 
CAGL0H07513g 734835..735893 highly similar to sp|P38286 Saccharo...    30   0.87 
Scas_574.9                                                             30   0.97 
ADL292C [1449] [Homologous to ScYDL114W - SH] (189102..190091) [...    30   1.00 
Sklu_1211.1 YBR237W, Contig c1211 147-2678                             30   1.2  
CAGL0K09152g 909456..910439 highly similar to tr|Q08651 Saccharo...    29   1.3  
KLLA0D06127g complement(526164..527156) similar to sgd|S0005772 ...    29   1.4  
YBR265W (TSC10) [445] chr2 (738539..739501) 3-Ketosphinganine re...    29   1.4  
Sklu_2404.13 YKL055C, Contig c2404 24100-25005                         29   2.0  
Kwal_56.23875                                                          28   2.6  
Kwal_55.21822                                                          28   2.9  
Kwal_14.1653                                                           28   5.7  
CAGL0K05269g 512844..515129 similar to tr|Q12311 Saccharomyces c...    27   5.9  
KLLA0C19547g 1750548..1751549 some similarities with tr|Q55924 S...    27   6.0  
Kwal_23.4862                                                           27   7.3  
Kwal_23.3107                                                           27   7.5  
KLLA0F08415g 783785..785851 gi|120930|sp|P09609|GALX_KLULA Kluyv...    27   8.2  
Kwal_26.8838                                                           27   9.9  

>Sklu_2380.4 YIR035C, Contig c2380 9858-10340
          Length = 160

 Score =  306 bits (785), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 152/160 (95%), Positives = 152/160 (95%)

Query: 1   MAKVVLVTGASRGIGQAIVNNLCNDGNSEVVVVGIARSEGPLSAIKGVHGDKFEYIIGDI 60
           MAKVVLVTGASRGIGQAIVNNLCNDGNSEVVVVGIARSEGPLSAIKGVHGDKFEYIIGDI
Sbjct: 1   MAKVVLVTGASRGIGQAIVNNLCNDGNSEVVVVGIARSEGPLSAIKGVHGDKFEYIIGDI 60

Query: 61  SDEEVLKKYVEYAIKKFGRIDAVVANAGVLEPVQDVNNIDVAQWKRLFDVNFFSIXXXXX 120
           SDEEVLKKYVEYAIKKFGRIDAVVANAGVLEPVQDVNNIDVAQWKRLFDVNFFSI     
Sbjct: 61  SDEEVLKKYVEYAIKKFGRIDAVVANAGVLEPVQDVNNIDVAQWKRLFDVNFFSIVSLVS 120

Query: 121 XXXPHLKKFNGNIVFVSSGASTKPYVCIMGRSRKPTSTIY 160
              PHLKKFNGNIVFVSSGASTKPYVCIMGRSRKPTSTIY
Sbjct: 121 LSLPHLKKFNGNIVFVSSGASTKPYVCIMGRSRKPTSTIY 160

>KLLA0E08063g complement(726232..726792) some similarities with
           sp|P40579 Saccharomyces cerevisiae YIR035c, hypothetical
           start
          Length = 186

 Score =  166 bits (420), Expect = 7e-53,   Method: Compositional matrix adjust.
 Identities = 81/148 (54%), Positives = 108/148 (72%), Gaps = 1/148 (0%)

Query: 1   MAKVVLVTGASRGIGQAIVNNLCNDGNSEVVVVGIARSEGPLSAIKGVHGDKFEYIIGDI 60
           M+KV LVTG SRGIG +IV  LC+   +++V+ GIARS+  L  +K  +  KF+YI GD+
Sbjct: 1   MSKVFLVTGVSRGIGSSIVEKLCSIETTKIVI-GIARSKDKLEELKTQYSGKFDYICGDV 59

Query: 61  SDEEVLKKYVEYAIKKFGRIDAVVANAGVLEPVQDVNNIDVAQWKRLFDVNFFSIXXXXX 120
           SDEE + + V +   K+ R+D +VANAGVL+PV+DVNNI +++WK+LFD+NFFS+     
Sbjct: 60  SDEETITEAVNFIESKYKRLDGIVANAGVLDPVEDVNNIHISKWKQLFDINFFSVVSLVG 119

Query: 121 XXXPHLKKFNGNIVFVSSGASTKPYVCI 148
              P LK+ NGNIV VSSGASTK YVCI
Sbjct: 120 HALPLLKQSNGNIVLVSSGASTKSYVCI 147

>Scas_685.8
          Length = 252

 Score =  164 bits (416), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 82/141 (58%), Positives = 107/141 (75%), Gaps = 1/141 (0%)

Query: 1   MAKVVLVTGASRGIGQAIVNNLCNDGNSEVVVVGIARSEGPLSAIKGVHGDKFEYIIGDI 60
           M KV++VTG SRGIG++IV  +    +S+ +V GIARSE PL A+K  +GD+F Y+ GDI
Sbjct: 1   MGKVIIVTGVSRGIGKSIVERIFK-LSSDAIVYGIARSEAPLKALKETYGDRFFYVTGDI 59

Query: 61  SDEEVLKKYVEYAIKKFGRIDAVVANAGVLEPVQDVNNIDVAQWKRLFDVNFFSIXXXXX 120
           +D+  L+K V+ A K+ G+ID+VVANAGVLEPVQDVN+ID+  WK+LFD+NFFS+     
Sbjct: 60  TDQVALQKLVDGAAKEQGKIDSVVANAGVLEPVQDVNHIDIDAWKKLFDINFFSVVSLTS 119

Query: 121 XXXPHLKKFNGNIVFVSSGAS 141
              P+LKK NGNIVFVSS AS
Sbjct: 120 ITLPYLKKTNGNIVFVSSDAS 140

>CAGL0F06919g complement(677473..678225) similar to sp|P40579
           Saccharomyces cerevisiae YIR035c or sp|P40580
           Saccharomyces cerevisiae YIR036c, start by similarity
          Length = 250

 Score =  160 bits (405), Expect = 9e-50,   Method: Compositional matrix adjust.
 Identities = 86/156 (55%), Positives = 110/156 (70%), Gaps = 5/156 (3%)

Query: 1   MAKVVLVTGASRGIGQAIVNN-LCNDGNSEVVVVGIARSEGPLSAIKGVHGDKFEYIIGD 59
           M KVVLVTGASRGIG+AIV N L  D N+  VV GIAR+E  L ++K   G +F+Y+ GD
Sbjct: 1   MKKVVLVTGASRGIGEAIVKNILALDSNA--VVYGIARNEDALKSLKDTVGARFQYLAGD 58

Query: 60  ISDEEVLKKYVEYAIKKFGRIDAVVANAGVLEPVQDVNNIDVAQWKRLFDVNFFSIXXXX 119
           I+DE+ + + VE  + + GRID++VANAGVLEPV  V +  VA+WK+L+D+NFFSI    
Sbjct: 59  ITDEDKINEIVEKVVLEQGRIDSIVANAGVLEPVAKVGSSSVAEWKKLYDINFFSIIHLI 118

Query: 120 XXXXPHLKKFNGNIVFVSSGASTKPYV--CIMGRSR 153
               PHL+K  GN +FVSSGASTKPY   C  G S+
Sbjct: 119 NKTLPHLEKSEGNAIFVSSGASTKPYYGWCAYGSSK 154

>CAGL0F06897g complement(675416..676192) highly similar to sp|P40579
           Saccharomyces cerevisiae YIR035c, hypothetical start
          Length = 258

 Score =  159 bits (401), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 79/140 (56%), Positives = 108/140 (77%), Gaps = 3/140 (2%)

Query: 3   KVVLVTGASRGIGQAIVNNLCN-DGNSEVVVVGIARSEGPLSAIKGVHGDKFEYIIGDIS 61
           KV+LVTG SRGIG++IV+ L + D N  V+V GIARSE PL A+K  +GD+F Y +GDI+
Sbjct: 7   KVILVTGVSRGIGKSIVDTLFSLDKN--VIVYGIARSEAPLKALKDTYGDRFFYTVGDIT 64

Query: 62  DEEVLKKYVEYAIKKFGRIDAVVANAGVLEPVQDVNNIDVAQWKRLFDVNFFSIXXXXXX 121
           +++ LKKYV  AI+  G+I++++ANAGVLEPVQ++NNIDV  WK+L+++NFFSI      
Sbjct: 65  NDDTLKKYVNSAIEGHGKINSLIANAGVLEPVQNINNIDVNAWKQLYNINFFSIVSLVDI 124

Query: 122 XXPHLKKFNGNIVFVSSGAS 141
             PHLKK +G+ +FVSS AS
Sbjct: 125 ALPHLKKTHGSALFVSSDAS 144

>ACR171C [1218] [Homologous to ScYIR035C - SH; ScYIR036C - SH]
           (654580..654909,654959..655384) [756 bp, 251 aa]
          Length = 251

 Score =  158 bits (400), Expect = 5e-49,   Method: Compositional matrix adjust.
 Identities = 76/145 (52%), Positives = 105/145 (72%), Gaps = 3/145 (2%)

Query: 1   MAKVVLVTGASRGIGQAIVNNLCNDGNSEVVVVGIARSEGPLSAIKGVHGDKFEYIIGDI 60
           M ++++VTG SRGIG+++V  +C     + VV+G+ARSE  L  ++  +G++FEY++GD+
Sbjct: 1   MPRLIIVTGVSRGIGRSVVEKVCR--QPDTVVLGVARSEAALQELRATYGEQFEYVVGDV 58

Query: 61  SDEEVLKKYVEYAIKKFGRIDAVVANAGVLEPVQDVNNIDVAQWKRLFDVNFFSIXXXXX 120
           + E+     V  A   +GRIDAVVANAGVLEPVQDVN+IDVA W+RL++VNFFS+     
Sbjct: 59  ASEDAQDALVARATA-YGRIDAVVANAGVLEPVQDVNHIDVAAWRRLYEVNFFSVVGLVG 117

Query: 121 XXXPHLKKFNGNIVFVSSGASTKPY 145
              P LKK  G++VFVSSGASTK Y
Sbjct: 118 RALPLLKKAGGSVVFVSSGASTKAY 142

>YIR035C (YIR035C) [2699] chr9 complement(421023..421787) Member of
           the short-chain alcohol dehydrogenase family [765 bp,
           254 aa]
          Length = 254

 Score =  157 bits (396), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 79/140 (56%), Positives = 105/140 (75%), Gaps = 1/140 (0%)

Query: 1   MAKVVLVTGASRGIGQAIVNNLCNDGNSEVVVVGIARSEGPLSAIKGVHGDKFEYIIGDI 60
           M KV+LVTG SRGIG++IV+ L +  + + VV G+ARSE PL  +K  +GD+F Y++GDI
Sbjct: 1   MGKVILVTGVSRGIGKSIVDVLFS-LDKDTVVYGVARSEAPLKKLKEKYGDRFFYVVGDI 59

Query: 61  SDEEVLKKYVEYAIKKFGRIDAVVANAGVLEPVQDVNNIDVAQWKRLFDVNFFSIXXXXX 120
           +++ VLK+ V  A+K  G+ID++VANAGVLEPVQ+VN IDV  WK+L+D+NFFSI     
Sbjct: 60  TEDSVLKQLVNAAVKGHGKIDSLVANAGVLEPVQNVNEIDVNAWKKLYDINFFSIVSLVG 119

Query: 121 XXXPHLKKFNGNIVFVSSGA 140
              P LKK NGN+VFVSS A
Sbjct: 120 IALPELKKTNGNVVFVSSDA 139

>Scas_628.6
          Length = 252

 Score =  155 bits (393), Expect = 6e-48,   Method: Compositional matrix adjust.
 Identities = 79/143 (55%), Positives = 100/143 (69%), Gaps = 1/143 (0%)

Query: 3   KVVLVTGASRGIGQAIVNNLCNDGNSEVVVVGIARSEGPLSAIKGVHGDKFEYIIGDISD 62
           KV++VTG SRGIG+AIVN +    NS  VV GIAR+  PL  +K  HG+KF YI+GD+++
Sbjct: 4   KVIIVTGVSRGIGRAIVNKIIG-LNSNAVVFGIARTSAPLKELKSKHGEKFFYIVGDVTN 62

Query: 63  EEVLKKYVEYAIKKFGRIDAVVANAGVLEPVQDVNNIDVAQWKRLFDVNFFSIXXXXXXX 122
           +  +KK +  AI KFGR+D+VVANAGVLEPV +V  +D   WKRLFD+NFFSI       
Sbjct: 63  KSDVKKLITAAIDKFGRLDSVVANAGVLEPVAEVGKVDEEAWKRLFDINFFSIVSLVQST 122

Query: 123 XPHLKKFNGNIVFVSSGASTKPY 145
            P ++  N N VFVSSGAS K Y
Sbjct: 123 LPFMENTNRNYVFVSSGASVKAY 145

>YIR036C (YIR036C) [2700] chr9 complement(422071..422862) Reductase
           in the short-chain dehydrogenase/reductase (SDR) family
           of proteins [792 bp, 263 aa]
          Length = 263

 Score =  133 bits (334), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 73/152 (48%), Positives = 100/152 (65%), Gaps = 8/152 (5%)

Query: 1   MAKVVLVTGASRGIGQAIVNNLCNDGNSEVVVVGIARSEGPLSAIKGVHG-DKFEYIIGD 59
           M KV+L+TGASRGIG  +V  +  + + E +V G+AR+E  L +++  +G DKF Y + D
Sbjct: 1   MGKVILITGASRGIGLQLVKTVIEE-DDECIVYGVARTEAGLQSLQREYGADKFVYRVLD 59

Query: 60  ISDEEVLKKYVEYAIKKFGRIDAVVANAGVLEPVQDVNNI----DVAQWKRLFDVNFFSI 115
           I+D   ++  VE   +K G++D +VANAG+LEPV+ ++      D+ QW+RLFDVNFFSI
Sbjct: 60  ITDRSRMEALVEEIRQKHGKLDGIVANAGMLEPVKSISQSNSEHDIKQWERLFDVNFFSI 119

Query: 116 XXXXXXXXPHLKK--FNGNIVFVSSGASTKPY 145
                   P LK   F GNIVFVSSGAS KPY
Sbjct: 120 VSLVALCLPLLKSSPFVGNIVFVSSGASVKPY 151

>ABR247W [841] [Homologous to ScYIR035C - NSH; ScYIR036C - NSH]
           complement(858589..859341) [753 bp, 250 aa]
          Length = 250

 Score =  131 bits (329), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 62/139 (44%), Positives = 94/139 (67%), Gaps = 3/139 (2%)

Query: 3   KVVLVTGASRGIGQAIVNNLCNDGNSEVVVVGIARSEGPLSAIKGVHGDKFEYIIGDISD 62
           +VV+VTGASRGIG+A V  LC    ++VVVVG+AR+E  L  +K  HG KF+Y++GD++D
Sbjct: 2   RVVIVTGASRGIGEATVEKLCP--TADVVVVGVARAETKLQKLKARHGKKFDYVVGDVTD 59

Query: 63  EEVLKKYVEYAIKKFGRIDAVVANAGVLEPVQDVNNIDVAQWKRLFDVNFFSIXXXXXXX 122
           E V++  ++    ++GR+DAVVANAGV    + +   D+ +W+RLF++N FS+       
Sbjct: 60  ERVVQAVIDKVSSEYGRLDAVVANAGVSRH-ERIATADIKEWRRLFEINLFSVVNLVSKA 118

Query: 123 XPHLKKFNGNIVFVSSGAS 141
            P L++  G ++ VSSG S
Sbjct: 119 LPLLRESQGTVIVVSSGLS 137

>ABR249W [843] [Homologous to ScYIR035C - NSH; ScYIR036C - NSH]
           complement(861237..861989) [753 bp, 250 aa]
          Length = 250

 Score =  130 bits (328), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 63/139 (45%), Positives = 93/139 (66%), Gaps = 3/139 (2%)

Query: 3   KVVLVTGASRGIGQAIVNNLCNDGNSEVVVVGIARSEGPLSAIKGVHGDKFEYIIGDISD 62
           KV++VTGASRGIG A V+ LC+    +VVVVG+AR+E  L  +K  HG KF+Y++GD++D
Sbjct: 2   KVIIVTGASRGIGAATVDRLCS--TPDVVVVGVARAETKLQELKARHGKKFDYVVGDVTD 59

Query: 63  EEVLKKYVEYAIKKFGRIDAVVANAGVLEPVQDVNNIDVAQWKRLFDVNFFSIXXXXXXX 122
           E V++  ++    ++GR+DAVVANAGV    Q +   D+ +W+RLF++N FS+       
Sbjct: 60  ERVVQAVIDKVSSEYGRLDAVVANAGV-SYQQRIAEADIKEWRRLFEINLFSVVNLASKA 118

Query: 123 XPHLKKFNGNIVFVSSGAS 141
            P L+K  G  + V+SG S
Sbjct: 119 LPLLRKSQGAFIAVTSGLS 137

>ABR248W [842] [Homologous to ScYIR035C - NSH; ScYIR036C - NSH]
           complement(859663..860448) [786 bp, 261 aa]
          Length = 261

 Score =  128 bits (321), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 64/138 (46%), Positives = 92/138 (66%), Gaps = 7/138 (5%)

Query: 3   KVVLVTGASRGIGQAIVNNLCNDGNSEVVVVGIARSEGPLSAIKGVHGDKFEYIIGDISD 62
           KV++VTGASRGIG A V+ LC+    EVVVVG+AR+E  L  +K  HG KF+Y++GD++D
Sbjct: 13  KVIIVTGASRGIGAATVDRLCS--TPEVVVVGVARAETKLQELKARHGKKFDYVVGDVTD 70

Query: 63  EEVLKKYVEYAIKKFGRIDAVVANAGVL--EPVQDVNNIDVAQWKRLFDVNFFSIXXXXX 120
           E V++  ++     +GR+DAVVANAGV   E ++D    D+ +W+RLF++N FS+     
Sbjct: 71  ERVVQAVIDKVSSGYGRLDAVVANAGVAGHERIEDA---DIKEWRRLFEINLFSVVNLAS 127

Query: 121 XXXPHLKKFNGNIVFVSS 138
              P L+K  G  + VSS
Sbjct: 128 KALPLLRKSQGAFLVVSS 145

>ABR246W [840] [Homologous to ScYIR035C - NSH; ScYIR036C - NSH]
           complement(857415..858167) [753 bp, 250 aa]
          Length = 250

 Score =  114 bits (285), Expect = 7e-32,   Method: Compositional matrix adjust.
 Identities = 59/145 (40%), Positives = 89/145 (61%), Gaps = 4/145 (2%)

Query: 1   MAKVVLVTGASRGIGQAIVNNLCNDGNSEVVVVGIARSEGPLSAIKGVHGDKFEYIIGDI 60
           M +V++VTGASRGIG+A V  LC     +VVVVG+AR+E  L  +K  +G KF+Y+ GD+
Sbjct: 1   MVRVIIVTGASRGIGEATVEKLCT--APDVVVVGVARAEKTLKVLKERYGSKFDYVAGDV 58

Query: 61  SDEEVLKKYVEYAIKKFGRIDAVVANAGVLEPVQDVNNIDVAQWKRLFDVNFFSIXXXXX 120
           +DE V++  ++     +GR+DA++ANAGV    + +   D+ QWKR F++   S      
Sbjct: 59  TDESVVQAVLDKVSSDYGRLDAIIANAGV-SRFERIAEADIQQWKRTFEI-IVSAVSLVS 116

Query: 121 XXXPHLKKFNGNIVFVSSGASTKPY 145
              P L+K  G ++ V+SG S   Y
Sbjct: 117 KALPMLRKSQGTVIVVTSGLSKVGY 141

>KLLA0E09834g complement(872888..873694) similar to sp|Q9ALU7
           Enterobacter cloacae Putative oxidoreductase, start by
           similarity
          Length = 268

 Score = 66.2 bits (160), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 49/143 (34%), Positives = 71/143 (49%), Gaps = 9/143 (6%)

Query: 3   KVVLVTGASRGIGQAIVNNLCNDGNSEVVVVGIARSEGPLSAIKGVHGDKFEYIIGDISD 62
           +V+L+TGAS GIG +I   L + G     V G +R      +I G     F+ I  DI+D
Sbjct: 4   QVILITGASTGIGLSIAETLRSAGYE---VFGTSRK----GSIPGKEYS-FKMIKLDITD 55

Query: 63  EEVLKKYVEYAIKKFGRIDAVVANAGVLEPVQDVNNIDVAQWKRLFDVNFFSIXXXXXXX 122
           EE +K  V   I+K GRID +V NAG+      V        K +F+ NFF +       
Sbjct: 56  EESVKSAVNEVIEKAGRIDVLVNNAGIAFKWAAVEECSTDLAKTIFETNFFGVHRMTRAV 115

Query: 123 XPHLK-KFNGNIVFVSSGASTKP 144
            PH++ + +G I+ +SS     P
Sbjct: 116 LPHMREQRHGKIINISSMGGIMP 138

>AER373C [2874] [Homologous to ScYIL124W (AYR1) - SH]
           (1327314..1328216) [903 bp, 300 aa]
          Length = 300

 Score = 59.7 bits (143), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 52/149 (34%), Positives = 72/149 (48%), Gaps = 11/149 (7%)

Query: 2   AKVVLVTGASRGIGQAIVNNLCNDGNSEVVVVGIARSEGPLSAIKGVHG-DKFEYIIGDI 60
           AKVVLVTGAS GIG  +   L N G    VV   ARS  P+ A++   G +K   +  D+
Sbjct: 14  AKVVLVTGASSGIGYELTKELANRG---YVVYAAARSIEPIEALRDKCGPEKVIPVQLDV 70

Query: 61  SDEEVLKKYVEYAIKKF--GRIDAVVANAG--VLEPVQDVNNIDVAQWKRLFDVNFFSIX 116
           +DEE + K      K+   G++ A+  NAG     P  DV    +   ++ F VN F+  
Sbjct: 71  TDEEQVTKLRRRMSKEIPGGKLHALFNNAGQSCTMPAVDVTPEMI---EKCFRVNVFAPM 127

Query: 117 XXXXXXXPHLKKFNGNIVFVSSGASTKPY 145
                  P L + +G IVF  S A   P+
Sbjct: 128 NITREFAPLLIRAHGTIVFTGSLAGIIPF 156

>Scas_594.12
          Length = 267

 Score = 55.8 bits (133), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 49/165 (29%), Positives = 79/165 (47%), Gaps = 17/165 (10%)

Query: 3   KVVLVTGASRGIGQAIVNNLCNDGNSEVVVVGIARSEGPLSAIKGVHGDKF---EYIIG- 58
           K+V +TGAS GIGQA      +  N  V +V +AR    L  +K V   K+   +  IG 
Sbjct: 14  KIVFITGASAGIGQATALEYMDASNGTVKLVLVARRLEKLQQLKEVIEAKYPKSKVYIGK 73

Query: 59  -DISDEEVLKKYVEYAIKKFGRIDAVVANAGVLEPVQDVNNIDVAQWKRLFDVNFFSIXX 117
            D+++ E ++ +++   ++F  ID ++ NAG       V +ID+   K + D N   +  
Sbjct: 74  LDVTELETIQPFLDNLPEEFKDIDILINNAGKALGSDRVGDIDIKDVKGMMDTNVLGLIN 133

Query: 118 XXXXXXPHL--KKFNGNIVFVSSGASTKPYVCIMGRSRKPTSTIY 160
                  H+  KK +G+IV + S         + GR   PT +IY
Sbjct: 134 VTQAVL-HIFQKKNSGDIVNLGS---------VAGRDAYPTGSIY 168

>AFR561W [3753] [Homologous to ScYMR226C - SH]
           complement(1438981..1439784) [804 bp, 267 aa]
          Length = 267

 Score = 52.8 bits (125), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 45/164 (27%), Positives = 80/164 (48%), Gaps = 15/164 (9%)

Query: 3   KVVLVTGASRGIGQAIVNNLCNDGNSEVVVVGIARSEGPLSAIKGVHGDKF---EYIIG- 58
           K+VLVTGAS GIG+A   N  +  +  + ++ +AR    L+++K     K+   +  +G 
Sbjct: 14  KIVLVTGASAGIGRATAINYADATDGAIKLILVARRAEKLTSLKQEIESKYPNAKIHVGQ 73

Query: 59  -DISDEEVLKKYVEYAIKKFGRIDAVVANAGVLEPVQDVNNIDVAQWKRLFDVNFFSIXX 117
            D++  + ++ ++E   ++F  ID ++ NAG     + V  I +   + +F+ N   +  
Sbjct: 74  LDVTQLDQIRPFLEGLPEEFRDIDILINNAGKALGTERVGEISMDDIQEVFNTNVIGLVH 133

Query: 118 XXXXXXPHLK-KFNGNIVFVSSGASTKPYVCIMGRSRKPTSTIY 160
                 P +K K +G+IV V S         I GR   P  +IY
Sbjct: 134 LTQEVLPIMKAKNSGDIVNVGS---------IAGREAYPGGSIY 168

>YMR226C (YMR226C) [4182] chr13 complement(721592..722395)
           NADP+-dependent L-allo-threonine dehydrogenase, member
           of the short-chain dehydrogenase-reductase family, which
           are NAD- or NADP-dependent oxidoreductases [804 bp, 267
           aa]
          Length = 267

 Score = 52.0 bits (123), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 47/164 (28%), Positives = 71/164 (43%), Gaps = 15/164 (9%)

Query: 3   KVVLVTGASRGIGQAIVNNLCNDGNSEVVVVGIARSEGPLSAIKGVHGDKF-----EYII 57
           K VL+TGAS GIG+A         N ++ ++  AR    L  +K     +F         
Sbjct: 14  KTVLITGASAGIGKATALEYLEASNGDMKLILAARRLEKLEELKKTIDQEFPNAKVHVAQ 73

Query: 58  GDISDEEVLKKYVEYAIKKFGRIDAVVANAGVLEPVQDVNNIDVAQWKRLFDVNFFSIXX 117
            DI+  E +K ++E   ++F  ID +V NAG       V  I     + +FD N  ++  
Sbjct: 74  LDITQAEKIKPFIENLPQEFKDIDILVNNAGKALGSDRVGQIATEDIQDVFDTNVTALIN 133

Query: 118 XXXXXXPHLK-KFNGNIVFVSSGASTKPYVCIMGRSRKPTSTIY 160
                 P  + K +G+IV + S         I GR   PT +IY
Sbjct: 134 ITQAVLPIFQAKNSGDIVNLGS---------IAGRDAYPTGSIY 168

>Kwal_26.9160
          Length = 267

 Score = 51.2 bits (121), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 46/164 (28%), Positives = 72/164 (43%), Gaps = 15/164 (9%)

Query: 3   KVVLVTGASRGIGQAIVNNLCNDGNSEVVVVGIARSEGPLSAIKGVHGDKF---EYIIG- 58
           K VL+TGAS GIGQA      +  N  + ++  AR    L  IK      F   +  IG 
Sbjct: 14  KTVLITGASAGIGQATALEYLDASNGNIKLILAARRLEKLKEIKSQFEKDFPEAKVYIGQ 73

Query: 59  -DISDEEVLKKYVEYAIKKFGRIDAVVANAGVLEPVQDVNNIDVAQWKRLFDVNFFSIXX 117
            D++  + +K +++   ++F  ID ++ NAG       V  ID +  + +   N  ++  
Sbjct: 74  LDVTHTDEIKPFIDNLPEEFKDIDILINNAGKALGSDPVGTIDASDIEGMIQTNVVALIN 133

Query: 118 XXXXXXPHLKKFN-GNIVFVSSGASTKPYVCIMGRSRKPTSTIY 160
                 P  K  N G+IV + S         + GR   PT +IY
Sbjct: 134 MTQAVLPIFKAKNAGDIVNLGS---------VAGREAYPTGSIY 168

>Sklu_1578.3 YMR226C, Contig c1578 1774-2580
          Length = 268

 Score = 50.8 bits (120), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 45/164 (27%), Positives = 73/164 (44%), Gaps = 15/164 (9%)

Query: 3   KVVLVTGASRGIGQAIVNNLCNDGNSEVVVVGIARSEGPLSAIKGVHGDKFE----YI-I 57
           K V +TGAS GIGQA     C+  N ++ +V  AR    L  +K     ++     YI +
Sbjct: 14  KTVFITGASAGIGQATALEYCDASNGKINLVLSARRLEKLQELKDKITKEYPEAKVYIGV 73

Query: 58  GDISDEEVLKKYVEYAIKKFGRIDAVVANAGVLEPVQDVNNIDVAQWKRLFDVNFFSIXX 117
            D+++ E +K +++   ++F  ID ++ NAG       V  I     + + + N  ++  
Sbjct: 74  LDVTETEKIKPFLDGLPEEFKDIDILINNAGKALGSDPVGTIKTEDIEGMINTNVLALIN 133

Query: 118 XXXXXXPHLKKFN-GNIVFVSSGASTKPYVCIMGRSRKPTSTIY 160
                 P  K  N G+IV + S         + GR   PT  IY
Sbjct: 134 ITQAVLPIFKAKNFGDIVNLGS---------VAGRDAYPTGAIY 168

>KLLA0B08371g complement(747517..748323) highly similar to sp|Q05016
           Saccharomyces cerevisiae YMR226c, start by similarity
          Length = 268

 Score = 48.1 bits (113), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 44/164 (26%), Positives = 72/164 (43%), Gaps = 15/164 (9%)

Query: 3   KVVLVTGASRGIGQAIVNNLCNDGNSEVVVVGIARSEGPLSAIK---GVHGDKFEYIIG- 58
           K + +TGAS GIGQA      +  N  V ++  AR    L  +K        + +  IG 
Sbjct: 14  KTIFITGASAGIGQATALEYLDAANGNVKLILAARRLAKLEELKEKINAEYPQAKVYIGQ 73

Query: 59  -DISDEEVLKKYVEYAIKKFGRIDAVVANAGVLEPVQDVNNIDVAQWKRLFDVNFFSIXX 117
            D+++ E ++ +++   ++F  ID ++ NAG       V  I     K + D N  ++  
Sbjct: 74  LDVTETEKIQPFIDNLPEEFKDIDILINNAGKALGSDVVGTISSEDIKGMIDTNVVALIN 133

Query: 118 XXXXXXPHLK-KFNGNIVFVSSGASTKPYVCIMGRSRKPTSTIY 160
                 P  K K +G+IV + S         + GR   PT +IY
Sbjct: 134 VTQAVLPIFKAKNSGDIVNLGS---------VAGRDAYPTGSIY 168

>Scas_662.4
          Length = 307

 Score = 47.4 bits (111), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 46/156 (29%), Positives = 67/156 (42%), Gaps = 19/156 (12%)

Query: 3   KVVLVTGASRGIGQAIVNNLCNDGNSEVVVVGIARSEGPLSAIKGVHGDKFEYIIG---- 58
           K  +VTGAS GIG  I   L  +G    +V   AR  GP+  +      +    +     
Sbjct: 10  KTAIVTGASSGIGYEITKELARNG---FIVYACARRLGPIDDLINDLAPELTTELAKAVI 66

Query: 59  -----DISDEEVLKKYVEYAIKKF--GRIDAVVANAG--VLEPVQDVNNIDVAQWKRLFD 109
                DIS E+ +K++  +  K+   G++D +  NAG     P  DV N DV +  + F 
Sbjct: 67  KPYQLDISKEDEVKQFRVFLEKELPNGKLDLLYNNAGQSCTFPALDVTN-DVME--QCFK 123

Query: 110 VNFFSIXXXXXXXXPHLKKFNGNIVFVSSGASTKPY 145
           VN F           +L +  G IVF  S A   P+
Sbjct: 124 VNVFGHVNMCRELASYLIQARGTIVFTGSLAGITPF 159

>KLLA0E24046g complement(2136583..2137425) similar to
           ca|CA3771|CaSOU1 Candida albicans Sorbitol utilization
           protein Sou1p [Candida albicans], hypothetical start
          Length = 280

 Score = 46.6 bits (109), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 37/119 (31%), Positives = 58/119 (48%), Gaps = 12/119 (10%)

Query: 3   KVVLVTGASRGIGQAIVNNLCNDGNSEVVV----VGIARSEGPLSAIKGVHGDKFEYIIG 58
           KV +VTGAS GIG A+   L   G S  V       +      LSA   V    ++    
Sbjct: 31  KVAVVTGASSGIGYAVAEGLAQAGASLAVWYNSNAALVERAVELSAKYNVKVVAYQ---C 87

Query: 59  DISDEEVLKKYVEYAIKKFGRIDAVVANAGVLE---PVQDV--NNIDVAQWKRLFDVNF 112
            +++E  +KK +E  I++FG+ID  +ANAGV     P+ +   +  D  +W ++   +F
Sbjct: 88  PVTEEAKVKKTIEDVIQEFGKIDVFIANAGVPWTKGPLVEAAESGTDTDEWNKVIHTDF 146

>YLR426W (YLR426W) [3802] chr12 (987058..987137,987209..988109)
           Member of the short chain alcohol dehydrogenase/ribitol
           dehydrogenase family [981 bp, 326 aa]
          Length = 326

 Score = 45.8 bits (107), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 33/113 (29%), Positives = 57/113 (50%), Gaps = 10/113 (8%)

Query: 4   VVLVTGASRGIGQAIVNNLCND-GNSEVVVVGIARSEGPLSAIKGVHGDKFEYIIGDISD 62
           +VL+TG S+G+G+AIV+ L  D  N  ++ V I  S         V   + + +I D+SD
Sbjct: 72  IVLITGGSKGLGRAIVSQLLQDYSNLTILNVDICPS--------SVRNTRVKDLICDLSD 123

Query: 63  EEVLKKYVEYAIKKF-GRIDAVVANAGVLEPVQDVNNIDVAQWKRLFDVNFFS 114
           +E +   +    +K+   I  +V NAGV       N ++     ++F +N F+
Sbjct: 124 DEEVAALLNLLKRKYKNEIRLIVNNAGVRANFTGFNGMERDNLDKIFKINTFA 176

>KLLA0D02596g
           join(complement(219682..219797),
           complement(218659..219586)) similar to sgd|S0004418
           Saccharomyces cerevisiae YLR426w, start by similarity
          Length = 347

 Score = 45.4 bits (106), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 36/154 (23%), Positives = 74/154 (48%), Gaps = 9/154 (5%)

Query: 4   VVLVTGASRGIGQAIVNNLCND-GNSEVVVVGIARSEGPLSAIKGVHGDKFEYIIGDISD 62
           V ++TG S G+G  +V +L +D  + ++V++ +   +  LS  K    D+ E++  D+S 
Sbjct: 85  VCVITGGSLGLGNELVKSLMSDIPDIKIVILDVVDPKLDLSITK----DRIEFLRCDLSS 140

Query: 63  EEVLKKYVEYAIKKFGRIDAVVANAGVLEPVQDVNNIDVAQWKRLFDVNFFSIXXXXXXX 122
           +E ++  ++    KF ++D ++ NA +      + ++   +  ++F  N  S        
Sbjct: 141 DEEVENAIKTIKNKFPKVDLLINNAAIRGRFSRLADMPCVEMNKIFHANVLSTIRLIQAF 200

Query: 123 XPHLKKFNGNIVFVSSGASTKPYVCIMGRSRKPT 156
            P  K  N +  +V + AS    + IM  +R  T
Sbjct: 201 HPK-KSANNDFYYVVNIASA---LGIMSPARAST 230

>CAGL0G08690g complement(822798..823682) similar to sp|P40471
           Saccharomyces cerevisiae YIL124w AYR1
           1-Acyldihydroxyacetone-phosphate reductase, hypothetical
           start
          Length = 294

 Score = 43.9 bits (102), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 47/160 (29%), Positives = 70/160 (43%), Gaps = 17/160 (10%)

Query: 3   KVVLVTGASRGIGQAIVNNLCNDGNSEVVVVGIARSEGPLSAIKGVHGDKFEYIIG---D 59
           KV +VTGAS GIG  +   L   G     V   AR   P+  +    G   E I+    D
Sbjct: 8   KVAVVTGASSGIGYEVTKELARKGFK---VFACARRTAPIEPLVNSFGK--ELIVPHHLD 62

Query: 60  ISDEEVLKKYVEYAIKKF--GRIDAVVANAG--VLEPVQDVNNIDVAQWKRLFDVNFFSI 115
           IS+ + + K+ E+   +    ++D +  NAG     P  DV+N DV +  + F VN F  
Sbjct: 63  ISELDEVLKFKEFLASELPEQKLDILYNNAGQSCTFPALDVSN-DVME--QCFKVNVFGH 119

Query: 116 XXXXXXXXPHLKKFNGNIVFVSS--GASTKPYVCIMGRSR 153
                    +L    G ++F  S  G ST P+  I   ++
Sbjct: 120 INMTRELAQYLINAKGTVIFTGSIAGFSTLPFGSIYAATK 159

>Kwal_14.2444
          Length = 288

 Score = 43.9 bits (102), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 43/147 (29%), Positives = 62/147 (42%), Gaps = 10/147 (6%)

Query: 3   KVVLVTGASRGIGQAIVNNLCNDGNSEVVVVGIARSEGPLSAIKGVHGDKFEYIIGDISD 62
           KV +VTGAS GIG  +   L + G     V   AR E  L  +     +    +  D+S+
Sbjct: 5   KVAVVTGASSGIGYELTRQLASKGYK---VYAAARREQRLETLAKEFPELVVPVKLDVSE 61

Query: 63  EEVLKKYVEYAIKKF--GRIDAVVANAG--VLEPVQDVNNIDVAQWKRLFDVNFFSIXXX 118
            E +    E   K+    ++D +  NAG     P  DV N DV +  + F VN F     
Sbjct: 62  PEQIIHLRERLAKELPSQKLDVLYNNAGQSCTFPASDVTN-DVLE--QAFKVNVFGPVNL 118

Query: 119 XXXXXPHLKKFNGNIVFVSSGASTKPY 145
                P + K  G ++F  S A   P+
Sbjct: 119 CKELLPFVIKAKGTVLFTGSVAGLMPF 145

>KLLA0D15521g 1311601..1312371 similar to sp|Q8TTF8 Methanosarcina
           acetivorans Cyclohexanol dehydrogenase, start by
           similarity
          Length = 256

 Score = 43.5 bits (101), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 30/113 (26%), Positives = 56/113 (49%), Gaps = 7/113 (6%)

Query: 3   KVVLVTGASRGIGQAIVNNLCNDGNSEVVVVGIARSEGPLSAIKGVHGDKFEYIIG---D 59
           K+ LVTGAS G+G+ I   L   G + V+    +R    +    G        +IG   D
Sbjct: 9   KIALVTGASTGVGEGIARALFVRGATVVIT---SRHLSEVQETAGNIDPSGSRVIGKEVD 65

Query: 60  ISDEEVLKKYVEYAIKKFGRIDAVVANAGVLEPVQD-VNNIDVAQWKRLFDVN 111
           ++  + ++  ++   ++FG +  +V NAG+  P Q  + + D+  W+++ D N
Sbjct: 66  VTVAKAVEDLIQEIREEFGALHYLVNNAGITGPHQTGIEDYDIDSWRQVIDTN 118

>CAGL0M11242g complement(1105723..1106529) highly similar to
           sp|Q05016 Saccharomyces cerevisiae YMR226c, start by
           similarity
          Length = 268

 Score = 43.5 bits (101), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 47/164 (28%), Positives = 73/164 (44%), Gaps = 15/164 (9%)

Query: 3   KVVLVTGASRGIGQAIVNNLCNDGNSEVVVVGIARSEGPLSAIKGVHGDKF---EYIIG- 58
           K+  +TGAS GIG+A      +  N  V +V  AR    L  +K     ++   +  IG 
Sbjct: 14  KIAFITGASAGIGKATAIEYLDASNGSVKLVLGARRMEKLEELKKELLAQYPDAKIHIGK 73

Query: 59  -DISDEEVLKKYVEYAIKKFGRIDAVVANAGVLEPVQDVNNIDVAQWKRLFDVNFFSIXX 117
            D++D E +K+++    ++F  ID ++ NAG       V +ID      + + N  ++  
Sbjct: 74  LDVTDFENVKQFLADLPEEFKDIDILINNAGKALGSDKVGDIDPEDIAGMVNTNVLALIN 133

Query: 118 XXXXXXPHLKKFN-GNIVFVSSGASTKPYVCIMGRSRKPTSTIY 160
                 P  KK N G+IV + S         I GR   PT  IY
Sbjct: 134 LTQLLLPLFKKKNSGDIVNLGS---------IAGRDAYPTGAIY 168

>KLLA0E13860g 1219430..1222099 similar to sp|Q02207 Saccharomyces
           cerevisiae YKR009c FOX2
           hydratase-dehydrogenase-epimerase, peroxisomal
           singleton, start by similarity
          Length = 889

 Score = 43.5 bits (101), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 40/146 (27%), Positives = 66/146 (45%), Gaps = 22/146 (15%)

Query: 3   KVVLVTGASRGIGQAIVNNLCNDG---------NSEVVVVGIARSEGPLSAIKGVHGDKF 53
           KVV++TG+  G+G++        G         +   VV  I +  G  SA+   H    
Sbjct: 314 KVVIITGSGSGLGKSHAQWFARYGAKVVINDIRDPSAVVDEINKKYGSGSAVADTH---- 369

Query: 54  EYIIGDISDEEVLKKYVEYAIKKFGRIDAVVANAGVLEPVQDVNNIDVAQWKRLFDVNFF 113
                DI  E   ++ V+ A+ KFGR+D +V NAG+L   +    +   +W  + +V+ F
Sbjct: 370 -----DIVKEA--QQVVQTAVDKFGRVDILVNNAGILRD-RSFAKMTEDEWNAVINVHLF 421

Query: 114 SIXXXXXXXXP-HLKKFNGNIVFVSS 138
           S         P  LK+ +G I+  +S
Sbjct: 422 STFALSKAVWPIFLKQKSGYIINTTS 447

 Score = 40.0 bits (92), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 37/129 (28%), Positives = 61/129 (47%), Gaps = 7/129 (5%)

Query: 3   KVVLVTGASRGIGQAIVNNLCNDGNSEVVVVGIARS--EGPLSAIKGVHGDKFEYIIGD- 59
           +VV++TGA  G+G+         G  +VVV  + RS  +  +  IK + G+       D 
Sbjct: 8   RVVIITGAGGGLGRVYALEYAKRG-GKVVVNDLGRSAADSVVQEIKKLGGEGDAVANYDS 66

Query: 60  ISDEEVLKKYVEYAIKKFGRIDAVVANAGVLEPVQDVNNIDVAQWKRLFDVNFFSIXXXX 119
           +SD       VE AI  FGR+D ++ NAG+L        +   Q++++ DV+        
Sbjct: 67  VSDNGA--AIVETAISNFGRVDILINNAGILRD-SSFAKMSEKQFQQVIDVHLNGAFKLT 123

Query: 120 XXXXPHLKK 128
               PH++K
Sbjct: 124 RAAWPHMRK 132

>Scas_666.17*
          Length = 283

 Score = 42.7 bits (99), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 29/114 (25%), Positives = 58/114 (50%), Gaps = 8/114 (7%)

Query: 2   AKVVLVTGASRGIGQAIVNNLCNDGNSEVVVVGIARSEGPLSAIKGVHGDKFEYIIGDIS 61
           +  V++TG S G+G AIV    N    ++ ++ + +   P    + V       I  D+S
Sbjct: 25  SPCVVITGGSHGLGHAIVVRFLNKV-PKITIINVDKISSPQDDPRMV------TIQCDLS 77

Query: 62  DEEVLKKYVEYAIKKFG-RIDAVVANAGVLEPVQDVNNIDVAQWKRLFDVNFFS 114
           ++  ++K +    +K+G RI  ++ NAG+    Q+  ++D  +  R+F +N F+
Sbjct: 78  NQVEMEKTLSLIKRKYGERIAVIINNAGMRMKYQNFQHLDQNECMRVFQLNTFN 131

>Sklu_1570.1 YKR009C, Contig c1570 100-2370
          Length = 756

 Score = 41.2 bits (95), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 41/143 (28%), Positives = 68/143 (47%), Gaps = 16/143 (11%)

Query: 3   KVVLVTGASRGIGQAIVNNLCNDGNSEVVVVGIARSEGPLSAIKGVHG------DKFEYI 56
           K+V+VTGA  G+G++        G ++VVV  I   E  +  I  ++G      DK + +
Sbjct: 185 KIVIVTGAGGGLGRSHALWFAKYG-AKVVVNDIKAPEPVVDEINKIYGGGSAIPDKHDVV 243

Query: 57  IGDISDEEVLKKYVEYAIKKFGRIDAVVANAGVLEPVQDVNNIDVAQWKRLFDVNFFSIX 116
                  E++K     A++ FGR+D +V NAG+L     +   D  +W  +  V+ FS  
Sbjct: 244 T---QPTEIVKT----ALEAFGRVDVLVNNAGILRDRSFLKMTD-EEWYAVLKVHLFSTY 295

Query: 117 XXXXXXXP-HLKKFNGNIVFVSS 138
                  P  LK+ +G I+  +S
Sbjct: 296 GLSKAVWPVFLKQRSGYIINTTS 318

>Kwal_55.19569
          Length = 288

 Score = 41.2 bits (95), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 36/122 (29%), Positives = 58/122 (47%), Gaps = 18/122 (14%)

Query: 3   KVVLVTGASRGIGQAIVNNLCNDG-------NSEVVVVGIARSEGPLSAIKGVHGDKFEY 55
           KV  ++GAS GIG A+       G       NS   ++  A+    LS   GV    ++ 
Sbjct: 39  KVACISGASSGIGGAVAVAFAQAGADIAVWYNSNDKLIQTAKE---LSETYGVRAKAYKC 95

Query: 56  IIGDISDEEVLKKYVEYAIKKFGRIDAVVANAGVLE---PVQDVNNIDVA--QWKRLFDV 110
               ++DE  +K+ +    K F +ID  VANAGV     P+ +     VA  +W+++F+ 
Sbjct: 96  ---PVTDEAKVKETILQVEKDFSKIDIFVANAGVPWSEGPLIEAEERGVATKEWEKVFNT 152

Query: 111 NF 112
           +F
Sbjct: 153 DF 154

>Kwal_27.12155
          Length = 280

 Score = 40.4 bits (93), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 36/122 (29%), Positives = 53/122 (43%), Gaps = 18/122 (14%)

Query: 3   KVVLVTGASRGIGQAIVNNLCNDG-------NSEVVVVGIARSEGPLSAIKGVHGDKFEY 55
           KV  ++GAS GIG A+       G       NS   +V  AR       +   +  +   
Sbjct: 31  KVACISGASSGIGAAVAEAFAQAGADLAVWYNSHPALVETARD------LANTYHVRVVA 84

Query: 56  IIGDISDEEVLKKYVEYAIKKFGRIDAVVANAGVLE---PVQDVNNIDVA--QWKRLFDV 110
               + DE+ ++  +   I +FGRID  VANAGV     P+ D     VA  +W R+   
Sbjct: 85  YKCPVDDEQQVQATIARVITEFGRIDVFVANAGVAWHEGPLLDAQRRSVADQEWNRIIQT 144

Query: 111 NF 112
           +F
Sbjct: 145 DF 146

>ABL163W [429] [Homologous to ScYNL202W (SPS19) - SH]
           complement(93017..93895) [879 bp, 292 aa]
          Length = 292

 Score = 40.0 bits (92), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 25/93 (26%), Positives = 44/93 (47%), Gaps = 5/93 (5%)

Query: 50  GDKFEYIIG----DISDEEVLKKYVEYAIKKFGRIDAVVANAGVLEPVQDVNNIDVAQWK 105
           GD  + ++G    D+ +   +K+ VE  +  FGRID V+A A     + D+ N+    +K
Sbjct: 70  GDSADCVLGIGGVDVREVADMKRAVEQTVAAFGRIDYVIAGAAG-NFLADMTNLSSRAFK 128

Query: 106 RLFDVNFFSIXXXXXXXXPHLKKFNGNIVFVSS 138
            + D++              L K  G ++FVS+
Sbjct: 129 TVLDIDLVGSYNTVKATLSELAKNKGAVLFVSA 161

>Sklu_2267.5 YNL202W, Contig c2267 5903-6955
          Length = 350

 Score = 40.0 bits (92), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 27/91 (29%), Positives = 42/91 (46%), Gaps = 2/91 (2%)

Query: 49  HGDKFEYIIG-DISDEEVLKKYVEYAIKKFGRIDAVVANAGVLEPVQDVNNIDVAQWKRL 107
           HG     + G D+ D + L+  V   + +FGRID V+A A     + D  N+    +K +
Sbjct: 132 HGTSVLPVYGVDVRDIKQLEDAVSQTVNEFGRIDFVIAGAAG-NFISDFTNLSSNAFKSV 190

Query: 108 FDVNFFSIXXXXXXXXPHLKKFNGNIVFVSS 138
             ++            P LKK  G I+FVS+
Sbjct: 191 VSIDLLGSFNTVKACFPQLKKNKGAIIFVSA 221

>AGL060W [4251] [Homologous to ScYKR009C (FOX2) - SH]
           complement(595270..597945) [2676 bp, 891 aa]
          Length = 891

 Score = 40.4 bits (93), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 39/141 (27%), Positives = 69/141 (48%), Gaps = 12/141 (8%)

Query: 3   KVVLVTGASRGIGQAIVNNLCNDGNSEVVVVGIARSEGPLSAIKGVHGDKFEYIIGD--- 59
           KVV++TGA  G+G++        G + VVV  +  ++G ++ I   +G+     + D   
Sbjct: 320 KVVIITGAGAGLGRSHALWFAKYG-ARVVVNDLKGADGVVAEINSQYGEG--RAVADSHN 376

Query: 60  -ISDEEVLKKYVEYAIKKFGRIDAVVANAGVLEPVQDVNNIDVAQWKRLFDVNFFSIXXX 118
            ++D   +   VE A+K F R+D +V NAG+L     V   D  +W  +  V+  S+   
Sbjct: 377 IVTDAAAV---VETAMKAFERVDVLVNNAGILRDRSFVKMTD-DEWNSVLQVHLLSVFAL 432

Query: 119 XXXXXP-HLKKFNGNIVFVSS 138
                P  +++ +G IV  +S
Sbjct: 433 SKAVWPIFMQQRSGVIVNTTS 453

 Score = 30.4 bits (67), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 30/105 (28%), Positives = 46/105 (43%), Gaps = 26/105 (24%)

Query: 3   KVVLVTGASRGIGQAIVNNLCNDGNSEVVVVGIARSEGPLSAIKGVHGDKFEYIIGDISD 62
           +VV++TGA  G+G+    +    G ++VVV  +  + G         G   +    D   
Sbjct: 8   RVVIITGAGGGLGREYALDYAKRG-AKVVVNDLGGTLG---------GSGHDTRAADKVV 57

Query: 63  EEVLK----------------KYVEYAIKKFGRIDAVVANAGVLE 91
           EE+ K                K V+ AI  FGR+D +V NAG+L 
Sbjct: 58  EEIRKAGGTAVANYDTVTDGDKIVKTAIDAFGRVDVIVNNAGILR 102

>Kwal_26.7950
          Length = 897

 Score = 40.0 bits (92), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 36/115 (31%), Positives = 60/115 (52%), Gaps = 9/115 (7%)

Query: 3   KVVLVTGASRGIGQAIVNNLCNDGNSEVVVVGIARSEGPLSAIKGVHGDKFEYIIGDISD 62
           KVV++TGA  G+G++        G ++VVV  I      +S I+ ++G      + D  D
Sbjct: 325 KVVIITGAGAGLGRSHALTFAKYG-AKVVVNDIKDPHTVVSEIEKLYGR--NSAVADKHD 381

Query: 63  EEVLK---KYVEYAIKKFGRIDAVVANAGVLEPVQDVNNIDVAQWKRLFDVNFFS 114
             V+K   + V+ A + FGR+D +V NAGVL   +    +   +W+ +  V+ FS
Sbjct: 382 --VVKDPGEIVKSAFQTFGRVDILVNNAGVLRD-RSFAKMSDEEWEIVLKVHLFS 433

 Score = 36.6 bits (83), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 43/158 (27%), Positives = 65/158 (41%), Gaps = 32/158 (20%)

Query: 3   KVVLVTGASRGIGQAIVNNLCNDGNSEVVVVGIARSEGPLSAIKGVHGDKFEYIIGDISD 62
           +VV++TGA  G+G+         G ++VVV  +  S G         G+       D+  
Sbjct: 11  RVVVITGAGGGLGKVYALEFAKRG-AKVVVNDLGGSLG---------GEGHNSRAADVVV 60

Query: 63  EEVLKKY------------------VEYAIKKFGRIDAVVANAGVLEPVQDVNNIDVAQW 104
            E+ +KY                  V+ A+  FGR+D ++ NAG+L      N  D A +
Sbjct: 61  SEIREKYKTQAAANYDSVTENAAAIVQTAVDNFGRVDIIINNAGILRDSSFANMSDSA-F 119

Query: 105 KRLFDVNFFSIXXXXXXXXPHLK--KFNGNIVFVSSGA 140
             + DV+            PH+K  KF G IV   S A
Sbjct: 120 ASVVDVHLTGAYNLTRAAWPHMKNQKF-GRIVNTCSPA 156

>Scas_478.2
          Length = 920

 Score = 39.3 bits (90), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 35/141 (24%), Positives = 64/141 (45%), Gaps = 7/141 (4%)

Query: 3   KVVLVTGASRGIGQAIVNNLCNDGNSEVVVVGIARSEGPLSAIKGVHG--DKFEYIIGDI 60
           KVV++TGA+ G+G++        G ++V++  I   E  ++ I    G    F      I
Sbjct: 326 KVVIITGANGGLGKSHAMWFAKYG-AKVIINDITNPETTVNEINSKFGADTAFPDSHNII 384

Query: 61  SDEEVLKKYVEYAIKKFGRIDAVVANAGVLEPVQDVNNIDVAQWKRLFDVNFFSIXXXXX 120
           ++ E++   V+ AI  FG +D +V NAG+L   +    +   +W  +  V+  +      
Sbjct: 385 TESELV---VKTAIDHFGHVDILVNNAGILRD-KSFLKMTEKEWYPVLQVHLQATFAMCK 440

Query: 121 XXXPHLKKFNGNIVFVSSGAS 141
              PH  K N   +  ++  S
Sbjct: 441 AVWPHFSKQNSGFIINTTSTS 461

 Score = 31.2 bits (69), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 22/73 (30%), Positives = 38/73 (52%), Gaps = 4/73 (5%)

Query: 70  VEYAIKKFGRIDAVVANAGVLEPVQDVNNIDVAQWKRLFDVNFFSIXXXXXXXXPHLK-- 127
           ++ AI  FG+ID ++ NAG+L  V   N +   +++ + DV+            P++K  
Sbjct: 86  IKTAIDNFGKIDILINNAGILRDV-SFNKMSEKEFQAVIDVHLNGAFQLTHAAWPYMKAQ 144

Query: 128 KFNGNIVFVSSGA 140
           KF G I+  +S A
Sbjct: 145 KF-GRIINTASPA 156

>Kwal_34.16024
          Length = 292

 Score = 38.5 bits (88), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 34/113 (30%), Positives = 55/113 (48%), Gaps = 5/113 (4%)

Query: 3   KVVLVTGASRGIGQAIVNNLCNDGNSEVVVVGIARSEGPLSAIKGVHGDKFEYIIGDISD 62
           K+V+VTGA+  IG+AI     + G ++V VV         + +   +G +      DI++
Sbjct: 40  KLVIVTGAAGVIGRAICEGFASAG-ADVCVVDYKYDADLATLLAQKYGVEARAYQVDITN 98

Query: 63  EEVLKKYVEYAIKKFGR--IDAVVANAGVLEPVQDVNNIDVA--QWKRLFDVN 111
           +E ++  ++   K F    ID  +ANAGV      V N       W+R+ DVN
Sbjct: 99  DEDVRACIQAVQKDFPSRDIDTFIANAGVAWTHGSVLNESATPEAWRRVMDVN 151

>KLLA0D18909g complement(1592628..1593500) similar to sp|P32573
           Saccharomyces cerevisiae YNL202w SPS19 peroxisomal 2,
           4-dienoyl-CoA reductase singleton, start by similarity
          Length = 290

 Score = 38.5 bits (88), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/80 (28%), Positives = 41/80 (51%), Gaps = 1/80 (1%)

Query: 59  DISDEEVLKKYVEYAIKKFGRIDAVVANAGVLEPVQDVNNIDVAQWKRLFDVNFFSIXXX 118
           D+ + + L + V+ AI+KFGR+D V+A A     + D  ++    +K +  ++       
Sbjct: 83  DVRNVDQLHEAVKVAIQKFGRLDYVIAGAAG-NFLADFTHLSSNAFKSVVSIDLLGSFNT 141

Query: 119 XXXXXPHLKKFNGNIVFVSS 138
                P L K  G+++FVSS
Sbjct: 142 VKACFPELVKTKGSVLFVSS 161

>Kwal_14.1511
          Length = 277

 Score = 38.1 bits (87), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 29/96 (30%), Positives = 48/96 (50%), Gaps = 9/96 (9%)

Query: 1  MAKVVLVTGASRGIGQAIVNNLCNDGNSEVVVVGIARSEGPLSAIK-------GVHGDKF 53
          M K +L+TGA++GIG+AI  +L   G    +     ++E   + +K       GV    F
Sbjct: 1  MPKTILITGAAQGIGKAIAVDLARKGYQLAIADLPQQNEKAQAVLKEIKELQSGVKAPIF 60

Query: 54 EYIIGDISDEEVLKKYVEYAIKKFGRIDAVVANAGV 89
            I  D+S++E +   V+     FG  D ++ NAG+
Sbjct: 61 LPI--DVSNKESVFGVVDKVASHFGAFDVMINNAGI 94

>YIL124W (AYR1) [2552] chr9 (126204..127097) 1-Acyl dihydroxyacetone
           phosphate reductase [894 bp, 297 aa]
          Length = 297

 Score = 38.1 bits (87), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 45/158 (28%), Positives = 64/158 (40%), Gaps = 13/158 (8%)

Query: 3   KVVLVTGASRGIGQAIVNNLCNDGNSEVVVVGIARSEGPLSAIKGVHG-DKFEYIIGDIS 61
           K+ +VTGAS GIG  +   L  +G    +V   AR   P++ +    G D  +    DIS
Sbjct: 10  KIAVVTGASGGIGYEVTKELARNG---YLVYACARRLEPMAQLAIQFGNDSIKPYKLDIS 66

Query: 62  DEEVLKKYVEYAIKKF--GRIDAVVANAG--VLEPVQDVNNIDVAQWKRLFDVNFFSIXX 117
             E +  +  +       G++D +  NAG     P  D  +  V Q    F VN F    
Sbjct: 67  KPEEIVTFSGFLRANLPDGKLDLLYNNAGQSCTFPALDATDAAVEQ---CFKVNVFGHIN 123

Query: 118 XXXXXXPHLKKFNGNIVFVSS--GASTKPYVCIMGRSR 153
                   L K  G IVF  S  G  + P+  I   S+
Sbjct: 124 MCRELSEFLIKAKGTIVFTGSLAGVVSFPFGSIYSASK 161

>Sklu_2348.5 YIL124W, Contig c2348 10212-11081 reverse complement
          Length = 289

 Score = 37.7 bits (86), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 41/147 (27%), Positives = 59/147 (40%), Gaps = 10/147 (6%)

Query: 3   KVVLVTGASRGIGQAIVNNLCNDGNSEVVVVGIARSEGPLSAIKGVHGDKFEYIIGDISD 62
           KV LVTGAS GIG  I   L + G +   V   AR   P+  ++    +K   +  D+SD
Sbjct: 5   KVALVTGASSGIGYEITKLLASKGYT---VYAAARRTTPIKPLEEEFPEKVIAVSLDVSD 61

Query: 63  EEVLKKYVEYAIKKF--GRIDAVVANAG--VLEPVQDVNNIDVAQWKRLFDVNFFSIXXX 118
            + ++       +     ++  +  NAG     P  DV N  + Q    F VN F     
Sbjct: 62  LQQIQDLKARFSRDLPDSKLHILYNNAGQSCTFPAVDVGNDKIEQ---CFKVNVFGPMNL 118

Query: 119 XXXXXPHLKKFNGNIVFVSSGASTKPY 145
                  +    G IVF  S A   P+
Sbjct: 119 CREMSDFVINARGTIVFTGSLAGIVPF 145

>YNL202W (SPS19) [4400] chr14 (259568..260455) Peroxisomal
           2,4-dienoyl-CoA reductase [888 bp, 295 aa]
          Length = 295

 Score = 37.4 bits (85), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 24/80 (30%), Positives = 41/80 (51%), Gaps = 1/80 (1%)

Query: 59  DISDEEVLKKYVEYAIKKFGRIDAVVANAGVLEPVQDVNNIDVAQWKRLFDVNFFSIXXX 118
           D+ + E ++  V+  ++KFG+ID V+A A     V D  N+    +K + D++       
Sbjct: 88  DVRNFEQVENAVKKTVEKFGKIDFVIAGAAG-NFVCDFANLSPNAFKSVVDIDLLGSFNT 146

Query: 119 XXXXXPHLKKFNGNIVFVSS 138
                  LKK  G+I+FVS+
Sbjct: 147 AKACLKELKKSKGSILFVSA 166

>CAGL0L02167g 253055..255760 highly similar to sp|Q02207
           Saccharomyces cerevisiae YKR009c FOX2
           hydratase-dehydrogenase-epimerase peroxisomal, start by
           similarity
          Length = 901

 Score = 37.7 bits (86), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 40/148 (27%), Positives = 64/148 (43%), Gaps = 26/148 (17%)

Query: 3   KVVLVTGASRGIGQA-----------IVNNLCNDGNSEVVVVGIARSEGPLSAIKGVHGD 51
           KVV++TGA  G+G++           +V N   D N+ V  +     EG   AI   H  
Sbjct: 324 KVVIITGAGGGLGKSHALWFAKYGARVVVNDIKDPNTVVNEINSKYGEG--RAIPDTHNV 381

Query: 52  KFEYIIGDISDEEVLKKYVEYAIKKFGRIDAVVANAGVLEPVQDVNNIDVAQWKRLFDVN 111
             E             + +E A+K +GR+D +V NAG+L     +   D  +W  +  V+
Sbjct: 382 VTE-----------ANQVIETAMKAYGRVDVLVNNAGILRDRSFLKMTD-QEWFAVVQVH 429

Query: 112 FFSIXXXXXXXXP-HLKKFNGNIVFVSS 138
            +S         P  LK+  G+I+  +S
Sbjct: 430 LYSTFLLSKAVWPIFLKQKGGHIINTTS 457

 Score = 33.9 bits (76), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 40/157 (25%), Positives = 68/157 (43%), Gaps = 31/157 (19%)

Query: 3   KVVLVTGASRGIGQAIVNNLCNDGNSEVVVVGIARSEGPLSAIKGVHGDKFEYIIGDISD 62
           +VV++TGA  G+G+         G ++VVV  +  + G         G   +    D+  
Sbjct: 10  RVVVITGAGGGLGKVYALEYAKRG-AKVVVNDLGGTLG---------GSGHDSKAADVVV 59

Query: 63  EEVLK-----------------KYVEYAIKKFGRIDAVVANAGVLEPVQDVNNIDVAQWK 105
           +E++K                 + VE AIK FGRID ++ NAG+L  V     +   ++ 
Sbjct: 60  DEIVKSGGTAVANYDSVNDNGEQIVETAIKAFGRIDILINNAGILRDV-SFAKMTEKEFS 118

Query: 106 RLFDVNFFSIXXXXXXXXPHLK--KFNGNIVFVSSGA 140
            + DV+            P+++  KF G I+  +S A
Sbjct: 119 AVLDVHLTGAYRLTKAAWPYMRQQKF-GRIINTASPA 154

>Sklu_268.1 , Contig c268 57-791 reverse complement
          Length = 244

 Score = 37.0 bits (84), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 27/87 (31%), Positives = 42/87 (48%), Gaps = 5/87 (5%)

Query: 5  VLVTGASRGIGQAIVNNLCNDGNSEVVVVGIARSEGPLSAIKGVHGDK--FEYIIGDISD 62
          V+VTGA+ GIG+AIVN    +G S   V+    +E  L  +K    D    +    D+  
Sbjct: 7  VIVTGAASGIGKAIVNQCLQEGAS---VIACDLNEQALLVLKESLNDSTVLDTYPMDVRK 63

Query: 63 EEVLKKYVEYAIKKFGRIDAVVANAGV 89
           E +  +  Y   +   +D +V NAG+
Sbjct: 64 YEEVAAFFAYVETEHSDVDGLVNNAGI 90

>CAGL0H08063g 785331..786203 highly similar to sp|P32573
           Saccharomyces cerevisiae YNL202w SPS19, start by
           similarity
          Length = 290

 Score = 36.2 bits (82), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 21/80 (26%), Positives = 40/80 (50%), Gaps = 1/80 (1%)

Query: 59  DISDEEVLKKYVEYAIKKFGRIDAVVANAGVLEPVQDVNNIDVAQWKRLFDVNFFSIXXX 118
           D+ + + L+  V+  + ++GRID V+A A     + D N++    +K +  ++       
Sbjct: 83  DVREVKQLESAVKRTVDRYGRIDYVIAGAAG-NFICDFNHLSANAFKSVVSIDLLGSFNT 141

Query: 119 XXXXXPHLKKFNGNIVFVSS 138
                P L K  G+I+FVS+
Sbjct: 142 AKATMPELIKSRGSILFVSA 161

>Kwal_26.8282
          Length = 298

 Score = 34.7 bits (78), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 16/29 (55%), Positives = 23/29 (79%)

Query: 4  VVLVTGASRGIGQAIVNNLCNDGNSEVVV 32
          V LVTGA+RGIG+AIV+ L + G S +++
Sbjct: 37 VALVTGATRGIGRAIVDKLADKGVSCLMI 65

>KLLA0F04455g complement(428010..428927) similar to sp|P40471
           Saccharomyces cerevisiae YIL124w AYR1
           1-Acyldihydroxyacetone-phosphate reductase, hypothetical
           start
          Length = 305

 Score = 34.3 bits (77), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 40/149 (26%), Positives = 59/149 (39%), Gaps = 12/149 (8%)

Query: 2   AKVVLVTGASRGIGQAIVNNLCNDGNSEVVVVGIARSEGPLSAIKGVHGDKFEYIIGDIS 61
            K  LVTGAS GIG  +   L   G     V   AR   P+  ++   GD+      D+S
Sbjct: 4   TKYALVTGASSGIGYEVTKELLRRG---WYVYACARRTHPMEELRAEFGDRCIPRKLDVS 60

Query: 62  DEE---VLKKYVEYAIKKFGRIDAVVANAGVLEPVQDVNNIDVAQW--KRLFDVNFFSIX 116
           ++     LK  +E  +    ++  +  NAG       +  IDV++      F VN +   
Sbjct: 61  NQNDITQLKLKLEQELPD-QKLHLLYNNAG---QSCSLPAIDVSEEIIDNTFRVNVYGPI 116

Query: 117 XXXXXXXPHLKKFNGNIVFVSSGASTKPY 145
                  P +    G IVF  S A   P+
Sbjct: 117 NSCREFAPLIINAKGTIVFTGSLAGICPF 145

>Sklu_2420.5 YOR246C, Contig c2420 9342-10322 reverse complement
          Length = 326

 Score = 34.3 bits (77), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 46/162 (28%), Positives = 67/162 (41%), Gaps = 37/162 (22%)

Query: 3   KVVLVTGASRGIGQAIVNNLCNDG--------NSEVVVVGI------ARSEGPLSAIKGV 48
           KV LVTG + GIG   V +L   G        NS  V   I      A+S    S  KG+
Sbjct: 19  KVALVTGGNSGIGWYTVLHLYMHGFIVYVGGRNSSRVNQAIKAIQNEAKSRQRKSTFKGL 78

Query: 49  HGD----KFEYIIGDISDEEVLKKYVEYAIKKFG----RIDAVVANAGVL----EPVQDV 96
             +    K  ++  D+SD     + V+ A  KF      +D ++ NAGV+    E  +D 
Sbjct: 79  KLERNFGKLHFLSLDLSD----LRSVDKAAAKFKGLELSLDVLINNAGVMALPYEITKDG 134

Query: 97  NNIDVAQWKRLFDVNFFSIXXXXXXXXPHLKKFNGNIVFVSS 138
             I +         N+ S         P +K+ NG ++ VSS
Sbjct: 135 FEIQL-------QTNYISHFLLTMRLLPRIKRCNGRVITVSS 169

>AAL089W [98] [Homologous to ScYOR246C - SH]
           complement(184564..185550) [987 bp, 328 aa]
          Length = 328

 Score = 33.9 bits (76), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 44/157 (28%), Positives = 66/157 (42%), Gaps = 26/157 (16%)

Query: 3   KVVLVTGASRGIGQAIVNNLCNDG--------NSEVVVVGI----ARSEGPLSAIKGVHG 50
           KV LVTG + GIG   V +L   G        NS  V   I      +E  L   +    
Sbjct: 20  KVALVTGGNSGIGWYTVLHLYMHGFIVYVGGRNSSRVHKAIKEIKQEAENRLETARQDPH 79

Query: 51  DKFEYIIGDIS----DEEVLKKYVEYAIKKF----GRIDAVVANAGVLE-PVQDVNNIDV 101
           D+ E  +G++     D   L+  VE A KKF      +D ++ NAGV+  P +  ++   
Sbjct: 80  DELERCLGELRYLPIDLTDLRS-VEKAAKKFRAQESTLDVLINNAGVMALPYELTHDGFE 138

Query: 102 AQWKRLFDVNFFSIXXXXXXXXPHLKKFNGNIVFVSS 138
            Q       N+ S         P++K+  G +V +SS
Sbjct: 139 VQ----MQTNYVSHFLLTMRLLPYVKRSGGRVVTLSS 171

>YKR009C (FOX2) [3265] chr11 complement(453995..456697)
           Multifunctional enzyme of the peroxisomal fatty acid
           beta-oxidation pathway possessing 2-enoyl-CoA hydratase
           2 and D-3-hydroxyacyl-CoA dehydrogenase activities [2703
           bp, 900 aa]
          Length = 900

 Score = 33.9 bits (76), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 30/103 (29%), Positives = 52/103 (50%), Gaps = 17/103 (16%)

Query: 3   KVVLVTGASRGIGQAIVNNLCNDGNSEVVVVGIARSEGPLSAIKGVHGDKFEYIIGDI-- 60
           +VV++TGA  G+G+       + G ++VVV  +  + G      G +    + ++ +I  
Sbjct: 10  RVVVITGAGGGLGKVYALAYASRG-AKVVVNDLGGTLGG----SGHNSKAADLVVDEIKK 64

Query: 61  ----------SDEEVLKKYVEYAIKKFGRIDAVVANAGVLEPV 93
                     S  E  +K +E AIK+FGR+D ++ NAG+L  V
Sbjct: 65  AGGIAVANYDSVNENGEKIIETAIKEFGRVDVLINNAGILRDV 107

 Score = 30.4 bits (67), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 19/72 (26%), Positives = 31/72 (43%), Gaps = 1/72 (1%)

Query: 70  VEYAIKKFGRIDAVVANAGVLEPVQDVNNIDVAQWKRLFDVNFFSIXXXXXXXXPHLKKF 129
           ++ AI KF R+D +V NAG+L     +   D  +W  +  V+ FS         P   K 
Sbjct: 388 IQTAISKFQRVDILVNNAGILRDKSFLKMKD-EEWFAVLKVHLFSTFSLSKAVWPIFTKQ 446

Query: 130 NGNIVFVSSGAS 141
               +  ++  S
Sbjct: 447 KSGFIINTTSTS 458

>Kwal_47.17102
          Length = 285

 Score = 33.5 bits (75), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 27/112 (24%), Positives = 52/112 (46%), Gaps = 9/112 (8%)

Query: 4   VVLVTGASRGIGQAIVNN-LCNDGNSEVVVVGIARSEGPLSAIKGVHGDKFEYIIGDISD 62
           V +VTG S G+G+AIV   L    N  ++ + I   E P  +   V+     +   D+S+
Sbjct: 34  VCVVTGGSNGLGRAIVQEFLLKLPNVTLISLDI---EPPKKSFPNVY-----HYTCDLSN 85

Query: 63  EEVLKKYVEYAIKKFGRIDAVVANAGVLEPVQDVNNIDVAQWKRLFDVNFFS 114
              + + ++   +  G +  ++ NAG+    Q+   +      ++F VN F+
Sbjct: 86  SSDVDQTLKIVKRNHGDVTVLINNAGIRAKYQNFRELSKEVADKVFQVNVFT 137

>Scas_675.10
          Length = 312

 Score = 33.1 bits (74), Expect = 0.068,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 38/63 (60%), Gaps = 3/63 (4%)

Query: 3  KVVLVTGASRGIGQAIVNNLCNDGNSEVVVVGIARSEGPLSAIKGVHGDKFEYIIGDISD 62
          ++VL+TG S+G+G+   +   ++GN+  ++V ++RSE  L  IK V     + +  ++S 
Sbjct: 8  QIVLITGGSQGLGREFAHKYYHEGNNSKIIV-VSRSEKKL--IKAVDAISGKTVGTNLSP 64

Query: 63 EEV 65
          EE 
Sbjct: 65 EET 67

>Kwal_23.4572
          Length = 300

 Score = 33.1 bits (74), Expect = 0.068,   Method: Compositional matrix adjust.
 Identities = 20/82 (24%), Positives = 40/82 (48%), Gaps = 5/82 (6%)

Query: 59  DISDEEVLKKYVEYAIKKFGRIDAVVANAG--VLEPVQDVNNIDVAQWKRLFDVNFFSIX 116
           D+ + E L++ V   +++FGRID V+A A    + P    + +    +K +  ++     
Sbjct: 93  DVREIEQLEEAVARTVERFGRIDFVIAGAAGNFIAP---FSKLSANAFKSVVSIDLLGSF 149

Query: 117 XXXXXXXPHLKKFNGNIVFVSS 138
                    L++  G+I+FVS+
Sbjct: 150 NTAKACLAELQRTKGSILFVSA 171

>AER111W [2616] [Homologous to ScYLR426W - SH]
           complement(846805..846884,846937..847840) [984 bp, 327
           aa]
          Length = 327

 Score = 32.7 bits (73), Expect = 0.096,   Method: Compositional matrix adjust.
 Identities = 21/108 (19%), Positives = 49/108 (45%), Gaps = 7/108 (6%)

Query: 7   VTGASRGIGQAIVNNLCNDGNSEVVVVGIARSEGPLSAIKGVHGDKFEYIIGDISDEEVL 66
           +TG ++G+G  I+ NL            +      ++    VH  +  ++  D+S    +
Sbjct: 76  LTGGAQGLGACILRNLLAQFPR------LTVVVVDVADPAVVH-RRVRFLRADLSKPADV 128

Query: 67  KKYVEYAIKKFGRIDAVVANAGVLEPVQDVNNIDVAQWKRLFDVNFFS 114
           ++ +E   +++ R+D ++  AG+    Q +  +   +  + F VN F+
Sbjct: 129 ERVLEQVTREYSRVDVLINCAGMRSRYQGLQAVAPEELHKTFQVNVFA 176

>Sklu_2445.2 YDR179W-A, Contig c2445 357-1673 reverse complement
          Length = 438

 Score = 32.7 bits (73), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 35/112 (31%), Positives = 52/112 (46%), Gaps = 14/112 (12%)

Query: 1   MAKVVLVTGASRGIGQAIVNNLCNDGNSEVVVVGIARSEGPLSAIKGVHGDKFEYIIGDI 60
           M KVV     S+ +G A  N LC   N    V+ +++  GPL     +     E +IGD+
Sbjct: 163 MRKVV-----SQDLGYAEFNRLCLYDNRYPKVI-VSKIIGPLDNGSELQRTFLEALIGDL 216

Query: 61  SDEEVLKKYVEYAIKKFGRIDAVVANAGVLE----PVQDVNNIDVAQWKRLF 108
              +VL++ VE  I     I A + N  +LE    PV  ++ I   +W R F
Sbjct: 217 LLSKVLERIVEPFI--LMEIIASICNKLLLEVEEKPVSALDRI--RKWARSF 264

>Kwal_14.2598
          Length = 311

 Score = 32.3 bits (72), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 28/100 (28%), Positives = 53/100 (53%), Gaps = 11/100 (11%)

Query: 3   KVVLVTGASRGIGQAIVNNLCNDGNSEVVVVGIARSEGPL-SAIKGVHGDKFEYIIGDIS 61
           +VVL+ G S+G+G+A  +   N+G++  V+V ++RS   L +A+  V G K    +  + 
Sbjct: 9   QVVLIAGGSQGLGKAFASKFYNEGSNNKVIV-VSRSRTKLQNAVCDVSGLKTAPEL--LP 65

Query: 62  DEEVLKK-----YVEYAIKKFGRIDAVVAN--AGVLEPVQ 94
           D E+ K      Y    + ++ +++ +  +  A  LEP Q
Sbjct: 66  DTEIPKNGNHIWYSPCDLAEYAQVEKLYESLKACSLEPTQ 105

>Scas_650.8
          Length = 326

 Score = 32.0 bits (71), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 37/161 (22%), Positives = 65/161 (40%), Gaps = 33/161 (20%)

Query: 3   KVVLVTGASRGIGQAIVNNLCNDGNSEVVVVG-------------IARSEGPLSAI---- 45
           KV ++TG + GIG   V +L   G + V + G                +E  L  +    
Sbjct: 17  KVAVITGGNSGIGWYTVLHLYMHGFT-VYLCGRTSHKIKKAINEITIEAEARLGLLEKEV 75

Query: 46  ----KGVHGDKFEYIIGDISDEEVLKKYVEYAIKKFGRIDAVVANAGVL----EPVQDVN 97
               K +H     YI  D++D + ++K  +  +K   +ID ++ NA +L    E  +D  
Sbjct: 76  DDFGKDIHLGSLRYIHMDLTDLKCVEKAAQKLLKLEDKIDVLINNAAILAIPYELTKDGF 135

Query: 98  NIDVAQWKRLFDVNFFSIXXXXXXXXPHLKKFNGNIVFVSS 138
            I +         N+ +         P +KK +G I+ + S
Sbjct: 136 EIQL-------QTNYIAHFLLTMRLLPAIKKCHGRIITLGS 169

>Kwal_56.23863
          Length = 344

 Score = 31.6 bits (70), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 39/75 (52%), Gaps = 8/75 (10%)

Query: 1  MAKVVLVTGASRGIGQAIVNNLCNDGNSEVVVVGIARS-EGPLSAIKGVHGDKFE-YIIG 58
          MA+ VL+TGA+  + Q I+N L    NS   V+G  RS E  +   +  + D+ +  ++ 
Sbjct: 3  MAETVLITGANNYVAQHIINVLLK--NSNYNVIGTVRSNEKAVKLSENFNSDRLKCEVVS 60

Query: 59 DISDE----EVLKKY 69
          D+  +    EV  KY
Sbjct: 61 DMGSQNAFDEVFSKY 75

>Scas_613.18
          Length = 286

 Score = 31.6 bits (70), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 29/112 (25%), Positives = 52/112 (46%), Gaps = 11/112 (9%)

Query: 4   VVLVTGASRGIGQAIVNNLCNDGNSEVVVVGIARSEGPLSAIKGVHGDKFEYIIGDISDE 63
           V LVTG S G+G  IV  L +     V+++ I        A K +      Y   D+  +
Sbjct: 37  VALVTGGSSGLGLEIVKQLLSK-RCTVIILDIYPPNIQFGADKAL-----TYYKCDVGSQ 90

Query: 64  EVLKKYVEYAIKKFGRIDAVVANAGV--LEPVQDVNNIDVAQWKRLFDVNFF 113
           E ++K  +   K    I  ++ NAG+  L+P+ + +  +V    ++ +VN+ 
Sbjct: 91  EEIEKTYKRISKDHASIHILINNAGITCLKPITEFSKEEV---NKVINVNYL 139

>CAGL0J04774g join(452094..452179,452259..453189) similar to
           tr|Q06417 Saccharomyces cerevisiae YLR426w
          Length = 338

 Score = 31.2 bits (69), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 30/135 (22%), Positives = 60/135 (44%), Gaps = 5/135 (3%)

Query: 4   VVLVTGASRGIGQAIVNNLCNDGNSEVVVVGIARSEGPLSAIKGVHGDKFEYIIGDISDE 63
           +VL+TG S G+G+ I++ L    N+ + V+ +       S    V   + + +  D  + 
Sbjct: 71  IVLITGGSNGLGRCIIHKLLRSYNN-IKVINLDLDVQYWSEEARVINIECDLVNADGLEL 129

Query: 64  EVLKKYVEYAIKKFGRIDAVVANAGVLEPVQDVNNIDVAQWKRLFDVNFFSIXXXXXXXX 123
            + K  +EY      +I+ ++ NAGV        +  + + +R+ ++N +S         
Sbjct: 130 ALKKIKLEYE----DKINLLICNAGVRSRFNWFEDTPIDEMQRIMNINTWSTARILQAII 185

Query: 124 PHLKKFNGNIVFVSS 138
           P   +    IV +SS
Sbjct: 186 PRDNQRQLYIVTISS 200

>CAGL0H10450g complement(1018805..1019740) similar to tr|Q07530
           Saccharomyces cerevisiae YDL114w, hypothetical start
          Length = 311

 Score = 31.2 bits (69), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 36/153 (23%), Positives = 68/153 (44%), Gaps = 7/153 (4%)

Query: 4   VVLVTGASRGIGQAIVNNLCNDGNSEVVVVGIARSEGPLSAIKGVHGDKFEYIIGDISDE 63
           V L+TG S G+G  I   L     S  V+V I     P   +   + +   Y   DI+D 
Sbjct: 46  VALITGGSGGLGLEIAIALVQRYKS--VIVAIVDVVPPKKQLVKQYPNIIHYRC-DITDS 102

Query: 64  EVLKKYVEYAIKKFGRIDAVVANAGVLEPVQDVNNIDVAQWKRLFDVNFFSIXXXXXXXX 123
             +    +  +  FG+++ +V NA +   ++ + ++  A+ +R+ +VN  +         
Sbjct: 103 FQVAHMKKKVLLDFGKVNILVNNAAI-TIIKQLTDMTEAEIQRVINVNLIASYHLVSMFV 161

Query: 124 PH-LKKFNGNIVFVSS--GASTKPYVCIMGRSR 153
           P  L   NG I+ ++S  G  T   + + G ++
Sbjct: 162 PEMLYTKNGCIINIASVLGELTPSRLIVYGATK 194

>AEL164C [2342] [Homologous to ScYBR265W (TSC10) - SH]
          (326834..327757) [924 bp, 307 aa]
          Length = 307

 Score = 30.8 bits (68), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 16/41 (39%), Positives = 27/41 (65%), Gaps = 2/41 (4%)

Query: 3  KVVLVTGASRGIGQAIVNNLCNDGNSEVVVVGIARSEGPLS 43
          +VVL++G S+G+G+A       + +S VV+V  +RSE  L+
Sbjct: 8  QVVLISGGSQGLGRAFAQKYIEESDSTVVIV--SRSEEKLT 46

>YKL055C (OAR1) [3204] chr11 complement(334966..335802)
          3-Oxoacyl-[acyl-carrier-protein] reductase [837 bp, 278
          aa]
          Length = 278

 Score = 30.8 bits (68), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 14/29 (48%), Positives = 20/29 (68%)

Query: 4  VVLVTGASRGIGQAIVNNLCNDGNSEVVV 32
          V +VTGA+RGIG+AI   L   G S +++
Sbjct: 6  VAIVTGATRGIGKAICQKLFQKGLSCIIL 34

>Scas_674.11
          Length = 346

 Score = 30.4 bits (67), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 28/76 (36%), Positives = 39/76 (51%), Gaps = 10/76 (13%)

Query: 3  KVVLVTGASRGIGQAIVNNLCNDGNSEVVVVGIARSE---GPLSAIKGVHGDKFEYIIGD 59
          K V V+GA+  I   IVN+L N G     V+G ARS+   G L    G +      ++ D
Sbjct: 5  KTVFVSGATGFIALHIVNDLLNAGYR---VIGSARSQEKCGKLLEKFGNNPSLSMEVVKD 61

Query: 60 ISD----EEVLKKYVE 71
          ISD    +EV KK+ +
Sbjct: 62 ISDLNAFDEVFKKHAK 77

>Sklu_1624.3 YBR265W, Contig c1624 1338-2288
          Length = 316

 Score = 30.0 bits (66), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 35/166 (21%), Positives = 67/166 (40%), Gaps = 30/166 (18%)

Query: 3   KVVLVTGASRGIGQAIVNNLCNDGNSEVVVVGIARSEGPL-SAIKGVHGDKFE------- 54
           + +LV G S+G+G+        +G +  V+V ++RS   L +A+K + G   +       
Sbjct: 12  QTLLVAGGSQGLGKQFACKYFAEGTANTVIV-VSRSAAKLAAAVKDITGQDAQELTVDLE 70

Query: 55  ---------YIIGDISDEEVLKKYVEYAIKKFGRIDAVVANAGVLEP--VQDVNNIDV-- 101
                    YI  D+SD    +K  E  +++      V+  AG   P   +D+   ++  
Sbjct: 71  FDSKERNMFYIPCDLSDYHATEKMYELLLERNLSPTQVMLCAGGSTPKLFKDLTGDELVT 130

Query: 102 -AQWKRLFDVNFFSIXXXXXXXXPHLKKFNGNIVFVSSGASTKPYV 146
             Q   +  +N   +        PH       ++F SS  +  P++
Sbjct: 131 GVQVNYMTCLNLAHVLARKHSSLPH-------VIFFSSETAFFPFI 169

>Scas_721.47
          Length = 344

 Score = 30.0 bits (66), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 23/65 (35%), Positives = 34/65 (52%), Gaps = 7/65 (10%)

Query: 3   KVVLVTGASRGIGQAIVNNLCNDGNSEVVVVGIARSEGPLSAIK----GVHGDKFEYIIG 58
           K  +VTGAS GIG+   N +   G + V+   I+R+   L A+K      +G K E +  
Sbjct: 63  KYCVVTGASDGIGKEFANQMAARGFNLVL---ISRTLSKLEALKEEFEKKYGIKVEILAI 119

Query: 59  DISDE 63
           DIS +
Sbjct: 120 DISSD 124

>CAGL0H07513g 734835..735893 highly similar to sp|P38286
           Saccharomyces cerevisiae YBR159w, start by similarity
          Length = 352

 Score = 30.0 bits (66), Expect = 0.87,   Method: Compositional matrix adjust.
 Identities = 19/48 (39%), Positives = 28/48 (58%), Gaps = 3/48 (6%)

Query: 6   LVTGASRGIGQAIVNNLCNDGNSEVVVVGIARSEGPLSAIKGVHGDKF 53
           +VTGAS GIG+   + L + G + V+   I+R+E  L A+K     KF
Sbjct: 66  VVTGASDGIGKEFASQLASKGFNLVL---ISRTESKLVALKDELEGKF 110

>Scas_574.9
          Length = 371

 Score = 29.6 bits (65), Expect = 0.97,   Method: Compositional matrix adjust.
 Identities = 28/73 (38%), Positives = 36/73 (49%), Gaps = 10/73 (13%)

Query: 4   VVLVTGASRGIGQAIVNNLCNDGNSEVVVVGIARSE---GPLSAIKGVHGDKFEYIIGDI 60
            V V+GAS  I   +VN+L N G     V+G ARS+     L A    H      I+ DI
Sbjct: 31  TVFVSGASGFIALHVVNDLLNAGYK---VIGSARSQEKCDQLLAKFKNHPSLSMVIVPDI 87

Query: 61  SD----EEVLKKY 69
           SD    ++V KKY
Sbjct: 88  SDLNAFDDVFKKY 100

>ADL292C [1449] [Homologous to ScYDL114W - SH] (189102..190091) [990
           bp, 329 aa]
          Length = 329

 Score = 29.6 bits (65), Expect = 1.00,   Method: Compositional matrix adjust.
 Identities = 28/103 (27%), Positives = 48/103 (46%), Gaps = 11/103 (10%)

Query: 4   VVLVTGASRGIGQAIVNNLCNDGNSEVVVVGIARSEGP-LSAIKGVHGDKFEYIIGDISD 62
           + LVTG + G+G+ IV  L      ++V V +     P L ++ GVH     +   DIS 
Sbjct: 62  IALVTGGAGGLGKEIVREL---RRRQIVTVILDVVPPPDLESLTGVH-----FYACDISL 113

Query: 63  EEVLKKYVEYAIKKFGRIDAVVANAGVLE--PVQDVNNIDVAQ 103
              ++   E  I+  G +  ++ NA +    P+  V+N  + Q
Sbjct: 114 PGRIRVIHENIIRDVGHVTILINNAAITSDLPLDRVDNDKIEQ 156

>Sklu_1211.1 YBR237W, Contig c1211 147-2678
          Length = 843

 Score = 29.6 bits (65), Expect = 1.2,   Method: Composition-based stats.
 Identities = 24/82 (29%), Positives = 37/82 (45%), Gaps = 7/82 (8%)

Query: 32  VVGIARSEGPLSAIKGVHGDKFEYIIGDISDEEVLKKYVEYAIKKFGR-IDAVVANAGVL 90
           VV      G + +I    G + +  I D      LKK VE  +   GR ID +  N+G L
Sbjct: 345 VVKFTTGSGSIRSICCTGGSELKQQIND------LKKGVEVVVATPGRFIDLLTLNSGRL 398

Query: 91  EPVQDVNNIDVAQWKRLFDVNF 112
              + +  + + +  RLFD+ F
Sbjct: 399 LSTERITFVVMDEADRLFDLGF 420

>CAGL0K09152g 909456..910439 highly similar to tr|Q08651
           Saccharomyces cerevisiae YOR246c, hypothetical start
          Length = 327

 Score = 29.3 bits (64), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 27/109 (24%), Positives = 49/109 (44%), Gaps = 22/109 (20%)

Query: 3   KVVLVTGASRGIGQAIVNNLCNDGNSEVVVVG-----IARSEGPL---------SAIKGV 48
           +V +VTG + GIG   V +L   G   V V G     ++R+   +           +KG+
Sbjct: 18  RVAVVTGGNSGIGWFTVLHLYMHG-FRVYVCGRNSHKVSRAMDDIIEEAVRRHNLYLKGL 76

Query: 49  HGDK-------FEYIIGDISDEEVLKKYVEYAIKKFGRIDAVVANAGVL 90
           H  K        +Y+  D++D + + +     ++    +D +V NAGV+
Sbjct: 77  HDQKPTRYLGSLQYLHTDLTDLKCVDRAAAKILRMENHLDVLVNNAGVM 125

>KLLA0D06127g complement(526164..527156) similar to sgd|S0005772
           Saccharomyces cerevisiae YOR246c, start by similarity
          Length = 330

 Score = 29.3 bits (64), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 38/159 (23%), Positives = 61/159 (38%), Gaps = 28/159 (17%)

Query: 3   KVVLVTGASRGIGQAIVNNLCNDG--------NSEVVVVGI-------------ARSEGP 41
           KV LVTG + GIG   V +L   G        NS  V   I              + E P
Sbjct: 20  KVALVTGGNSGIGYYTVLHLYLHGFKVYLGGRNSSRVNHAIKEIKKEAEIRLRKGQDEKP 79

Query: 42  LSAIKGVHGDKFEYIIGDISDEEVLKKYVEYAIKKFGRIDAVVANAGVLEPVQDV--NNI 99
              +      K EY+  D++D   ++K       +   +D ++ NAGV+    ++  +N 
Sbjct: 80  HDGLMIRKTGKLEYLHIDLTDLNSVEKAATKFTVQEDHLDVLINNAGVMAIPYELTKDNF 139

Query: 100 DVAQWKRLFDVNFFSIXXXXXXXXPHLKKFNGNIVFVSS 138
           ++         N+ S         P +K   G ++ VSS
Sbjct: 140 EIQM-----QTNYVSHFLLTMRLLPLIKARKGRVITVSS 173

>YBR265W (TSC10) [445] chr2 (738539..739501) 3-Ketosphinganine
          reductase, catalyzes the second step in the synthesis
          of phytosphingosine [963 bp, 320 aa]
          Length = 320

 Score = 29.3 bits (64), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 13/40 (32%), Positives = 25/40 (62%), Gaps = 1/40 (2%)

Query: 3  KVVLVTGASRGIGQAIVNNLCNDGNSEVVVVGIARSEGPL 42
          +VVL+TG S+G+G+       N+  +  +++ ++RSE  L
Sbjct: 8  QVVLITGGSQGLGKEFAKKYYNEAENTKIII-VSRSEARL 46

>Sklu_2404.13 YKL055C, Contig c2404 24100-25005
          Length = 301

 Score = 28.9 bits (63), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 13/29 (44%), Positives = 20/29 (68%)

Query: 4  VVLVTGASRGIGQAIVNNLCNDGNSEVVV 32
          V ++TGA+RGIG++I   L  +G   V+V
Sbjct: 6  VAVITGATRGIGRSIAAKLSREGMCCVIV 34

>Kwal_56.23875
          Length = 680

 Score = 28.5 bits (62), Expect = 2.6,   Method: Composition-based stats.
 Identities = 13/53 (24%), Positives = 27/53 (50%), Gaps = 2/53 (3%)

Query: 53  FEYIIGDISDEEVLKKYVEYAI--KKFGRIDAVVANAGVLEPVQDVNNIDVAQ 103
           F Y +G    +++ K+Y+ + I  K+F R+  +       +P+ + N I  A+
Sbjct: 418 FGYALGTCPKQKIFKEYINFEIQLKEFDRVRKIYEQLLAFDPLSNANWIAYAE 470

>Kwal_55.21822
          Length = 283

 Score = 28.1 bits (61), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 34/126 (26%), Positives = 54/126 (42%), Gaps = 17/126 (13%)

Query: 3   KVVLVTGASRGIGQAIVNNLCNDGNSEVVVVGIARSEGP-----LSAIKGVHGDKFEYII 57
           KV  VTGAS GIG  +       G      V +  +  P     +  I   +G K +   
Sbjct: 31  KVAAVTGASSGIGYDVAVAFAQAGAD----VAMWYNSNPHITELVGEISEKYGVKVKAYK 86

Query: 58  GDISDEEVLKKYVEYAIKKF-GRIDAVVANAGVLE---PVQDVNNIDV----AQWKRLFD 109
             ++  + +   ++   K F G+ID +V NAGV     P+ D+   D     A+W ++ D
Sbjct: 87  CSVTSSKDVASTIDQIKKDFGGKIDIMVGNAGVAWSEGPLIDLVEKDEEKCDAEWNKVID 146

Query: 110 VNFFSI 115
           V+   I
Sbjct: 147 VDLNGI 152

>Kwal_14.1653
          Length = 688

 Score = 27.7 bits (60), Expect = 5.7,   Method: Composition-based stats.
 Identities = 17/48 (35%), Positives = 26/48 (54%), Gaps = 1/48 (2%)

Query: 66  LKKYVEYAIKKFGR-IDAVVANAGVLEPVQDVNNIDVAQWKRLFDVNF 112
           LKK VE  +   GR ID +  N+G L   + +  + + +  RLFD+ F
Sbjct: 230 LKKGVEIVVATPGRFIDLLTLNSGKLINTERITFVVMDEADRLFDLGF 277

>CAGL0K05269g 512844..515129 similar to tr|Q12311 Saccharomyces
           cerevisiae YPR031w, start by similarity
          Length = 761

 Score = 27.3 bits (59), Expect = 5.9,   Method: Composition-based stats.
 Identities = 10/25 (40%), Positives = 17/25 (68%)

Query: 81  DAVVANAGVLEPVQDVNNIDVAQWK 105
           + V AN   +EP++ V NI+ ++WK
Sbjct: 343 ELVFANLHYMEPIEGVENINKSRWK 367

>KLLA0C19547g 1750548..1751549 some similarities with tr|Q55924
          Synechocystis sp PCC 6803 Hypothetical protein slr0317,
          hypothetical start
          Length = 333

 Score = 27.3 bits (59), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 21/66 (31%), Positives = 31/66 (46%), Gaps = 6/66 (9%)

Query: 3  KVVLVTGASRGIGQAIVNNLCNDGNSEVVVVGIARSEGPLSAIKGVHGDKFEYIIGDISD 62
          K +LV GA+  IG  +  +L   G S  V+V   RSE    + K    +     +GD++ 
Sbjct: 10 KAILVVGATSTIGSGVAKSLSKLGASTTVLV---RSEEKGKSFK---EEGINVAVGDLAK 63

Query: 63 EEVLKK 68
           E L K
Sbjct: 64 PETLGK 69

>Kwal_23.4862
          Length = 1731

 Score = 27.3 bits (59), Expect = 7.3,   Method: Composition-based stats.
 Identities = 24/85 (28%), Positives = 40/85 (47%), Gaps = 9/85 (10%)

Query: 4   VVLVTGASRGIGQAIVNNLCNDGNSEVVVVGIARSEGPLS-AIK------GVHGDKFEYI 56
           +VLVT A  G+   ++N L   G+  VVV+   R +   + A++      G  G K   +
Sbjct: 713 LVLVTDAEDGLALEVINALLQAGS--VVVIATQRYDRETTRALQKCYQNYGSTGSKLIVL 770

Query: 57  IGDISDEEVLKKYVEYAIKKFGRID 81
             +IS +  + ++ EY     G ID
Sbjct: 771 PLNISSKLDVLRFAEYLFSNIGDID 795

>Kwal_23.3107
          Length = 248

 Score = 26.9 bits (58), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 22/89 (24%), Positives = 40/89 (44%), Gaps = 3/89 (3%)

Query: 3  KVVLVTGASRGIGQAIVNNLCNDGNSEVVVV--GIARSEGPLS-AIKGVHGDKFEYIIGD 59
          KV L+TG ++ +G+     L +   + + +        E  L+  +   +  K E   G+
Sbjct: 6  KVALITGGTKNLGRLTAIELASRHKANLFLHYNSTQGDEKKLADELSSKYNVKVELYQGN 65

Query: 60 ISDEEVLKKYVEYAIKKFGRIDAVVANAG 88
          +   + ++K  E A  KFG ID  + N G
Sbjct: 66 LGSAKNVEKLFEAAKAKFGSIDIAINNVG 94

>KLLA0F08415g 783785..785851 gi|120930|sp|P09609|GALX_KLULA
          Kluyveromyces lactis GAL10 bifunctional protein
          [Includes: UDP-glucose 4-epimerase (Galactowaldenase);
          Aldose 1-epimerase (Mutarotase)], start by similarity
          Length = 688

 Score = 26.9 bits (58), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 25/89 (28%), Positives = 45/89 (50%), Gaps = 8/89 (8%)

Query: 3  KVVLVTGASRGIGQAIVNNLCNDGNSEVVVVGIARSE-GPLSAIKGVHGDKFEYIIGDIS 61
          K  LVTG +  IG   V  LC  G   +VV  ++ S    ++ ++ + G + ++   D+ 
Sbjct: 5  KYCLVTGGAGYIGSHTVVELCEAGYKCIVVDNLSNSSYESVARMELLTGQEIKFAKIDLC 64

Query: 62 DEEVLKK-YVEYAIKKFGRIDAVVANAGV 89
          + E L K + +Y      +ID+V+  AG+
Sbjct: 65 ELEPLNKLFDDY------KIDSVLHFAGL 87

>Kwal_26.8838
          Length = 323

 Score = 26.6 bits (57), Expect = 9.9,   Method: Compositional matrix adjust.
 Identities = 41/153 (26%), Positives = 63/153 (41%), Gaps = 22/153 (14%)

Query: 3   KVVLVTGASRGIGQAIVNNLCNDGNSEVVVVGIARSEGPLSAIKGVHGDKFEYI------ 56
           KV LVTG + GIG   V +L   G +  V V    S     AIK +  +    I      
Sbjct: 19  KVALVTGGNSGIGWYTVLHLYLHGFA--VYVAGRNSSRVNRAIKDIKKEARTRIKKEDPE 76

Query: 57  ----IGD---ISDEEVLKKYVEYAIKKF----GRIDAVVANAGVLEPVQDVNNIDVAQWK 105
               +G+   +S +    K V+ A K+F     R+D ++ NAGV+     V       ++
Sbjct: 77  SRHPVGELYFLSLDLTELKLVDKAAKRFRSLETRLDVLINNAGVMALPYSVTE---DGFE 133

Query: 106 RLFDVNFFSIXXXXXXXXPHLKKFNGNIVFVSS 138
                N+ +         P +K+  G I+ VSS
Sbjct: 134 IQLQTNYIAHFLLTMRLLPSVKRCRGRIITVSS 166

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.319    0.138    0.397 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 4,842,864
Number of extensions: 186880
Number of successful extensions: 685
Number of sequences better than 10.0: 99
Number of HSP's gapped: 628
Number of HSP's successfully gapped: 105
Length of query: 160
Length of database: 16,596,109
Length adjustment: 93
Effective length of query: 67
Effective length of database: 13,376,635
Effective search space: 896234545
Effective search space used: 896234545
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 57 (26.6 bits)