Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Sklu_2380.362262232440.0
Kwal_14.86362863920640.0
ACR172W61263719450.0
Scas_685.764565518110.0
KLLA0E08085g65665617280.0
YKL025C (PAN3)67969514390.0
CAGL0L09889g71745313161e-174
ADR313W578139860.025
ADR379C492182820.078
YHR102W (KIC1)1080141820.093
Sklu_2382.21261100770.37
KLLA0F11143g813143760.45
Scas_580.61015141750.65
CAGL0D02244g487123740.67
YDL025C620171730.87
ADR090W1233152740.89
AEL063W131467711.7
Scas_691.433461692.3
Kwal_33.15153186134684.4
CAGL0L11550g1072154675.3
Scas_683.1633882656.6
CAGL0L05676g221144667.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Sklu_2380.3
         (622 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Sklu_2380.3 YKL025C, Contig c2380 7858-9726 reverse complement       1254   0.0  
Kwal_14.863                                                           799   0.0  
ACR172W [1219] [Homologous to ScYKL025C (PAN3) - SH] complement(...   753   0.0  
Scas_685.7                                                            702   0.0  
KLLA0E08085g 727056..729026 similar to sp|P36102 Saccharomyces c...   670   0.0  
YKL025C (PAN3) [3230] chr11 complement(389883..391922) Component...   558   0.0  
CAGL0L09889g 1055765..1057918 similar to sp|P36102 Saccharomyces...   511   e-174
ADR313W [2054] [Homologous to ScYDL025C - SH] complement(1255932...    38   0.025
ADR379C [2120] [Homologous to ScYOR351C (MEK1) - SH] (1386601..1...    36   0.078
YHR102W (KIC1) [2390] chr8 (316574..319816) Serine/threonine pro...    36   0.093
Sklu_2382.2 YDL195W, Contig c2382 2146-5931 reverse complement         34   0.37 
KLLA0F11143g complement(1026129..1028570) similar to sp|P22216 S...    34   0.45 
Scas_580.6                                                             33   0.65 
CAGL0D02244g complement(229504..230967) similar to sp|P24719 Sac...    33   0.67 
YDL025C (YDL025C) [836] chr4 complement(405341..407203) Serine/t...    33   0.87 
ADR090W [1831] [Homologous to ScYDL195W (SEC31) - SH] complement...    33   0.89 
AEL063W [2443] [Homologous to ScYJR033C (RAV1) - SH] complement(...    32   1.7  
Scas_691.4                                                             31   2.3  
Kwal_33.15153                                                          31   4.4  
CAGL0L11550g 1229719..1232937 similar to sp|P38692 Saccharomyces...    30   5.3  
Scas_683.16                                                            30   6.6  
CAGL0L05676g 619734..626369 highly similar to sp|P07259 Saccharo...    30   7.8  

>Sklu_2380.3 YKL025C, Contig c2380 7858-9726 reverse complement
          Length = 622

 Score = 1254 bits (3244), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 604/622 (97%), Positives = 604/622 (97%)

Query: 1   MDKANTEWAKDIPCKNITIHGFCKFENDGCIFNHGSSGTKTGVNTPTGIMNSASKFNAKT 60
           MDKANTEWAKDIPCKNITIHGFCKFENDGCIFNHGSSGTKTGVNTPTGIMNSASKFNAKT
Sbjct: 1   MDKANTEWAKDIPCKNITIHGFCKFENDGCIFNHGSSGTKTGVNTPTGIMNSASKFNAKT 60

Query: 61  ASSFTPSKITSSDFNGVSGFTSDKXXXXXXXXXXXXXXXXXXFATNFNPYVADSFTPSGS 120
           ASSFTPSKITSSDFNGVSGFTSDK                  FATNFNPYVADSFTPSGS
Sbjct: 61  ASSFTPSKITSSDFNGVSGFTSDKSATVTTAPVAASVVNSPTFATNFNPYVADSFTPSGS 120

Query: 121 AGVSSPSFNPYSAPSGIGGASSTATHTQTAPVTGFTQRPPDPRSSLTSAGPIASSRVSAT 180
           AGVSSPSFNPYSAPSGIGGASSTATHTQTAPVTGFTQRPPDPRSSLTSAGPIASSRVSAT
Sbjct: 121 AGVSSPSFNPYSAPSGIGGASSTATHTQTAPVTGFTQRPPDPRSSLTSAGPIASSRVSAT 180

Query: 181 QNFPTIYPPPHSILQYHLYAPDPPPHLKVPLKPNERTPETLFIPNDLREELVKKNQSALQ 240
           QNFPTIYPPPHSILQYHLYAPDPPPHLKVPLKPNERTPETLFIPNDLREELVKKNQSALQ
Sbjct: 181 QNFPTIYPPPHSILQYHLYAPDPPPHLKVPLKPNERTPETLFIPNDLREELVKKNQSALQ 240

Query: 241 VFPSGGSLPEIVGDYFGLVPLEFHSRASYKQRYMGHQNSLYKVFSNSDGKIYIMRRIHDV 300
           VFPSGGSLPEIVGDYFGLVPLEFHSRASYKQRYMGHQNSLYKVFSNSDGKIYIMRRIHDV
Sbjct: 241 VFPSGGSLPEIVGDYFGLVPLEFHSRASYKQRYMGHQNSLYKVFSNSDGKIYIMRRIHDV 300

Query: 301 NITEATQVSRPFQMWQKVSCANVVKIKDAFITRAFNDSSLCVVHEYFPQSSSLYETHFVN 360
           NITEATQVSRPFQMWQKVSCANVVKIKDAFITRAFNDSSLCVVHEYFPQSSSLYETHFVN
Sbjct: 301 NITEATQVSRPFQMWQKVSCANVVKIKDAFITRAFNDSSLCVVHEYFPQSSSLYETHFVN 360

Query: 361 FTLTPITQDYLWAYLVQLTNALKEVHSQNLSINILGWDKVIVTGEPGRIKVSDCGVYDIL 420
           FTLTPITQDYLWAYLVQLTNALKEVHSQNLSINILGWDKVIVTGEPGRIKVSDCGVYDIL
Sbjct: 361 FTLTPITQDYLWAYLVQLTNALKEVHSQNLSINILGWDKVIVTGEPGRIKVSDCGVYDIL 420

Query: 421 HSLESRDIEEEQQKDFEELGKLLNGLVTKIASSKDTSTQDLKVDSDFKIVLDYLLLNDHK 480
           HSLESRDIEEEQQKDFEELGKLLNGLVTKIASSKDTSTQDLKVDSDFKIVLDYLLLNDHK
Sbjct: 421 HSLESRDIEEEQQKDFEELGKLLNGLVTKIASSKDTSTQDLKVDSDFKIVLDYLLLNDHK 480

Query: 481 KNVRELASLFTDRILSVVSSLQTHVECTEAYLSRELENGRLFRLMCKLNFIFGRTESRVD 540
           KNVRELASLFTDRILSVVSSLQTHVECTEAYLSRELENGRLFRLMCKLNFIFGRTESRVD
Sbjct: 481 KNVRELASLFTDRILSVVSSLQTHVECTEAYLSRELENGRLFRLMCKLNFIFGRTESRVD 540

Query: 541 INWSESGEKFPIILFYDYVFHQVDEAGKSIMDLTHVLRCLNKLDAGVTEKIMLVTPDEMN 600
           INWSESGEKFPIILFYDYVFHQVDEAGKSIMDLTHVLRCLNKLDAGVTEKIMLVTPDEMN
Sbjct: 541 INWSESGEKFPIILFYDYVFHQVDEAGKSIMDLTHVLRCLNKLDAGVTEKIMLVTPDEMN 600

Query: 601 CIIISYKELKDLIDSTFRSMTQ 622
           CIIISYKELKDLIDSTFRSMTQ
Sbjct: 601 CIIISYKELKDLIDSTFRSMTQ 622

>Kwal_14.863
          Length = 628

 Score =  799 bits (2064), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 398/639 (62%), Positives = 471/639 (73%), Gaps = 42/639 (6%)

Query: 1   MDKANTEWAKDIPCKNITIHGFCKFENDGCIFNHGSSGTKTGVNTPTGIMNSAS-KFNAK 59
           MDKAN EWAKDIPCKNITI+GFCK+EN+GCIFNHG++   T         NSA  KFNAK
Sbjct: 15  MDKANAEWAKDIPCKNITIYGFCKYENEGCIFNHGNANQNT---------NSAGLKFNAK 65

Query: 60  TASSFTPSKITSSDFNGVSGFTSDKXXXXXXXXXXX------XXXXXXXFATNFNPYVAD 113
           TASSFTPSK  S+  +  +   ++K                        F +++NPY A+
Sbjct: 66  TASSFTPSKALSTKNSTSTAIKAEKVAKALASAAEQPSTSSPLAAKSAPFGSSYNPYAAN 125

Query: 114 SFTPSGSAGVSSP--------SFNPYSAPSGIGGASSTATHTQTAPVTGFTQRPPDPRSS 165
            FTP GSAG S+P        SFNPYSAP+G+           T P     + P  P +S
Sbjct: 126 -FTPVGSAGTSTPPPAAASRTSFNPYSAPAGM-----------TTP----GEAPLQPGAS 169

Query: 166 LT--SAGPIASSRVSATQNFPTIYPPPHSILQYHLYAPDPPPHLKVPLKPNERTPETLFI 223
               S  P A        NFP+IYPP HSILQYHLYAPDPP HLKVPLK NERTPETLFI
Sbjct: 170 FIPGSPAPYAQDAPGRYTNFPSIYPPSHSILQYHLYAPDPPLHLKVPLKANERTPETLFI 229

Query: 224 PNDLREELVKKNQSALQVFPSGGSLPEIVGDYFGLVPLEFHSRASYKQRYMGHQNSLYKV 283
           PN++REEL+KKN +ALQVFPSGG+LPEIVGDYFGLVPLEFH+R S K RY GHQNSLYKV
Sbjct: 230 PNNMREELLKKNHAALQVFPSGGNLPEIVGDYFGLVPLEFHNRVSNKDRYQGHQNSLYKV 289

Query: 284 FSNSDGKIYIMRRIHDVNITEATQVSRPFQMWQKVSCANVVKIKDAFITRAFNDSSLCVV 343
           FSN DGK+YIMRRIHDV + E+ Q+ +PFQ W+KV  +NVV+ KDAFITRAFND+SLCVV
Sbjct: 290 FSNFDGKVYIMRRIHDVKMKESVQLFKPFQDWKKVVNSNVVETKDAFITRAFNDASLCVV 349

Query: 344 HEYFPQSSSLYETHFVNFTLTPITQDYLWAYLVQLTNALKEVHSQNLSINILGWDKVIVT 403
           HEYFPQSSSLYETHFV+F+ TPITQD LW+YLVQL +A++  H++NL+ N +  DKVIVT
Sbjct: 350 HEYFPQSSSLYETHFVSFSPTPITQDLLWSYLVQLCSAIQAAHTRNLAFNNICLDKVIVT 409

Query: 404 GEPGRIKVSDCGVYDILHSLESRDIEEEQQKDFEELGKLLNGLVTKIASSKDTSTQDLKV 463
           G PGR+K+ D  V+DIL+  + RD+ +EQ+ DF +LG LL  L  K+  S+D +   L V
Sbjct: 410 GNPGRVKIGDSCVHDILYFQDERDVLKEQKHDFADLGGLLKDLAAKLVGSQDNTVDSLAV 469

Query: 464 DSDFKIVLDYLLLNDHKKNVRELASLFTDRILSVVSSLQTHVECTEAYLSRELENGRLFR 523
           D DFK VL+YLL     K + EL +LF+ +IL ++SSLQT  E TE+ L+RELEN RLFR
Sbjct: 470 DDDFKQVLNYLLDPKSLKTLPELMALFSHKILPIISSLQTFTEYTESILARELENARLFR 529

Query: 524 LMCKLNFIFGRTESRVDINWSESGEKFPIILFYDYVFHQVDEAGKSIMDLTHVLRCLNKL 583
           LMCK+NFIFGR ESR+DINWSESGEKFPIILFYDYVFHQ DE GK +MDLTHVLRCLNKL
Sbjct: 530 LMCKMNFIFGRIESRIDINWSESGEKFPIILFYDYVFHQADETGKPVMDLTHVLRCLNKL 589

Query: 584 DAGVTEKIMLVTPDEMNCIIISYKELKDLIDSTFRSMTQ 622
           DAG+ EK+MLVTPDEMNCIIISYKELKDLIDSTFR++ Q
Sbjct: 590 DAGIGEKLMLVTPDEMNCIIISYKELKDLIDSTFRALAQ 628

>ACR172W [1219] [Homologous to ScYKL025C (PAN3) - SH]
           complement(655564..657402) [1839 bp, 612 aa]
          Length = 612

 Score =  753 bits (1945), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 386/637 (60%), Positives = 461/637 (72%), Gaps = 42/637 (6%)

Query: 1   MDKANTEWAKDIPCKNITIHGFCKFENDGCIFNHG---SSGTKTGVNTPTGIMNSA---- 53
           M+K+ T+WAKD PCKNITI+G+CK+ENDGCIFNHG   S+ + TG        +SA    
Sbjct: 3   MNKSKTDWAKDTPCKNITIYGYCKYENDGCIFNHGKPLSTSSNTGGAAAGSAEDSAASGG 62

Query: 54  --------SKFNAKTASSFTPSKITSSDFNGVSGFTSDKXXXXXXXXXXXXXXXXXXFAT 105
                   S FNAKTA+SFTPS +   DFN +  FT ++                  F  
Sbjct: 63  VTVGNTGKSTFNAKTATSFTPS-VAIPDFNNIPSFTPERIVSSPAGDGATA------FTP 115

Query: 106 NFNPYVADSFTPSGSAGVSSPSFNPYSAPSGIGGASSTATHTQTAPVTGFTQRPPDPRSS 165
           +FNPY +DSF PS  A VS P    ++A SG  GAS+TA                 PRS 
Sbjct: 116 SFNPYGSDSFNPS--ANVSGPGSAVFAAASGNAGASATAA----------------PRSQ 157

Query: 166 LTSAGPIASSRVSATQNFPTIYPPPHSILQYHLYAPDPPPHLKVPLKPNERTPETLFIPN 225
               G      ++ T  FPT+YPP HSILQYHLYAPDPPPHL+VPLK NERTPETLFIPN
Sbjct: 158 SVHVGTGGYLPLAGTA-FPTVYPPSHSILQYHLYAPDPPPHLQVPLKANERTPETLFIPN 216

Query: 226 DLREELVKKNQSALQVFPSGGSLPEIVGDYFGLVPLEFHSRASYKQRYMGHQNSLYKVFS 285
           +LRE L+K+N SALQVFPS G+LP+IVGDYFGLVPLEFH+R + K RY+GHQNSLYKVFS
Sbjct: 217 NLREHLLKRNLSALQVFPSDGNLPDIVGDYFGLVPLEFHNRQTGKGRYLGHQNSLYKVFS 276

Query: 286 NSDGKIYIMRRIHDVNITEATQVSRPFQMWQKVSCANVVKIKDAFITRAFNDSSLCVVHE 345
           N DGK+YI+RRIHDV  T+  Q+S PF+ WQKVSC NVVK+KDAF T AF DSSLCVVH+
Sbjct: 277 NFDGKVYIIRRIHDVKTTDVGQISLPFRKWQKVSCPNVVKVKDAFTTLAFGDSSLCVVHD 336

Query: 346 YFPQSSSLYETHFVNFTLTPITQDYLWAYLVQLTNALKEVHSQNLSINILGWDKVIVTGE 405
           Y+PQS+SLYETH  N+T+ P+TQ YLW+YLVQL+NAL EVH   LS+N +  DKVIVTG+
Sbjct: 337 YYPQSNSLYETHVANYTVVPVTQKYLWSYLVQLSNALNEVHRHGLSMNNISLDKVIVTGD 396

Query: 406 PGRIKVSDCGVYDILHSLESRDIEEEQQKDFEELGKLLNGLVTKIASSKDTSTQDLKVDS 465
           PGRIKV D  V+DIL   E RDI +EQQ D+  +G LL  L  ++  ++D     + +D 
Sbjct: 397 PGRIKVGDSAVHDILAFDEGRDIAKEQQADYSAVGALLMDLAQRMLGTRDQPLDSMDIDP 456

Query: 466 DFKIVLDYLLLNDHKKNVRELASLFTDRILSVVSSLQTHVECTEAYLSRELENGRLFRLM 525
            FK VL Y LL+D KK + E  +LF+ ++L ++SS QT+ E  E +LSRELENGRLFRLM
Sbjct: 457 LFKRVLAY-LLSDEKKTIAEFTALFSHKMLDIISSSQTYSEYIEQHLSRELENGRLFRLM 515

Query: 526 CKLNFIFGRTESRVDINWSESGEKFPIILFYDYVFHQVDEAGKSIMDLTHVLRCLNKLDA 585
           CKLNFIFGR ES +DI+WSE+G+KFPIILFYDYVFHQVDE GKS+MDLTHVLRCLNKLD 
Sbjct: 516 CKLNFIFGRMESSMDIHWSEAGDKFPIILFYDYVFHQVDENGKSVMDLTHVLRCLNKLDT 575

Query: 586 GVTEKIMLVTPDEMNCIIISYKELKDLIDSTFRSMTQ 622
           GV+EKI+LVTPDEMNCIIISYKELKD IDSTFRSMTQ
Sbjct: 576 GVSEKIILVTPDEMNCIIISYKELKDSIDSTFRSMTQ 612

>Scas_685.7
          Length = 645

 Score =  702 bits (1811), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 355/655 (54%), Positives = 438/655 (66%), Gaps = 43/655 (6%)

Query: 1   MDKANTEWAKDIPCKNITIHGFCKFENDGCIFNHGSSGTKTG-VNTPTGIMNS------- 52
           MDK N EWAKDIPC+N+TI+G+CK   DGC F H  +      +  P  +  S       
Sbjct: 1   MDKINAEWAKDIPCRNVTIYGYCKKIKDGCPFKHSETDEPAAEIQEPVPVQQSPVAPVPS 60

Query: 53  -ASKFNAKTASSFTPSKITSSDFNGVSGFTSDKXXXXXXXXXXXXXXXXXXFAT-----N 106
            + KFN K+++SFTP    + +   VS F                       A+     +
Sbjct: 61  FSRKFNPKSSASFTPMSSKTPELAAVSSFERSSNPSSPAPPASIPKPMNSPLASQSSNAS 120

Query: 107 FNPYVADSFTPSGSAGVSSPSFNPYSAPSGIGGASSTATHTQTAPVTGFTQRPPDPRSSL 166
           F P    S+  S S G      N    P GI      + H    P+T   +       +L
Sbjct: 121 FPPQPFYSYPASSSNGT---LLNNTILPDGI------SLHDPAFPLTQIDKTMLANDPNL 171

Query: 167 TSAG-PIASSRVSATQ----------------NFPTIYPPPHSILQYHLYAPDPPPHLKV 209
            SA  P+  S   A+                  +P+IYPPPHSILQYHLYAPDPPP L++
Sbjct: 172 PSANVPLQFSSSPASNIHQQMLNENNINNNNSRYPSIYPPPHSILQYHLYAPDPPPQLRL 231

Query: 210 PLKPNERTPETLFIPNDLREELVKKNQSALQVFPSGGSLPEIVGDYFGLVPLEFHSRASY 269
           PLKPNERTPETLFIPNDLRE+LVKKN ++LQ+FPSGG++P+IV DYFGLVPL+FH +   
Sbjct: 232 PLKPNERTPETLFIPNDLREQLVKKNLASLQIFPSGGAIPDIVQDYFGLVPLDFHQKEVT 291

Query: 270 KQRYMGHQNSLYKVFSNSDGKIYIMRRIHDVNITEATQVSRPFQMWQKVSCANVVKIKDA 329
           K RY GH+NSLYKVFSN DGK+YI+RRIHDV I +  Q+++PFQ W  + C  +VK++D 
Sbjct: 292 KDRYQGHKNSLYKVFSNLDGKVYILRRIHDVQIMDPQQIAKPFQKWNNLECNQIVKLRDL 351

Query: 330 FITRAFNDSSLCVVHEYFPQSSSLYETHFVNFTLTPITQDYLWAYLVQLTNALKEVHSQN 389
           F+T  F DSSLC+V++++PQ++SLYE HF NF L PITQDYLW YLVQLTNA+  VHS+ 
Sbjct: 352 FLTTKFGDSSLCLVYDFYPQANSLYEHHFTNFPLVPITQDYLWTYLVQLTNAINVVHSKG 411

Query: 390 LSINILGWDKVIVTGEPGRIKVSDCGVYDILHSLESRDIEEEQQKDFEELGKLLNGLVTK 449
             I ++ WDK+IVTG+PGRIK+S CG  D+L + E  D+  +QQ DFE LG+LL  L +K
Sbjct: 412 FYIGLIDWDKIIVTGDPGRIKLSGCGAIDVLGANEELDLHSKQQMDFENLGQLLFKLASK 471

Query: 450 IASSKDTSTQDLKVDSDFKIVLDYLLLND--HKKNVRELASLFTDRILSVVSSLQTHVEC 507
           I ++ +    +L VD  FK VL Y LLND   +K + EL+ LF D+ILS V S Q + E 
Sbjct: 472 IGNNANAKIDELSVDDQFKTVLQY-LLNDTNDRKTINELSQLFIDKILSNVESSQGYAEY 530

Query: 508 TEAYLSRELENGRLFRLMCKLNFIFGRTESRVDINWSESGEKFPIILFYDYVFHQVDEAG 567
           TE  LSRELENGRLFRL+CKLNFIFG+ ESRVDINWSESGEKFPIILFYD+VFHQVDE G
Sbjct: 531 TEGILSRELENGRLFRLICKLNFIFGKIESRVDINWSESGEKFPIILFYDFVFHQVDETG 590

Query: 568 KSIMDLTHVLRCLNKLDAGVTEKIMLVTPDEMNCIIISYKELKDLIDSTFRSMTQ 622
           KS+MDLTHVLRCLNKLDAG  EK++L TPDEMNCIIISYKELKDLID+TFRSMTQ
Sbjct: 591 KSVMDLTHVLRCLNKLDAGAPEKLILATPDEMNCIIISYKELKDLIDTTFRSMTQ 645

>KLLA0E08085g 727056..729026 similar to sp|P36102 Saccharomyces
           cerevisiae YKL025c PAN3 component of the PAB1P-dependent
           poly(A) ribonuclease singleton, start by similarity
          Length = 656

 Score =  670 bits (1728), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 357/656 (54%), Positives = 441/656 (67%), Gaps = 59/656 (8%)

Query: 10  KDIPCKNITIHGFCKFENDGCIFNHGSSGTKTG-----VNTPTGIMNSASKFNAKTASSF 64
           K   C+NI IHG+CKFEN+GC FNHG+S    G     V T   +     KFNAKT+SSF
Sbjct: 17  KGTQCRNIIIHGYCKFENEGCQFNHGNSKETEGQTTDEVPTQRSMTPLNVKFNAKTSSSF 76

Query: 65  TPSK---ITSSDFNGVSGFT-----------SDKXXXXXXXXXXXXXXXXXXFATNFNPY 110
           TP K   + S DF+ +  F            +D                   FA +FNPY
Sbjct: 77  TPGKSPAVRSPDFSSLPAFQPGAPVNDQPMLADGPQISGTMSPSLMNSNATAFAPSFNPY 136

Query: 111 VADSFTPSGSAGV-------------SSPSF------NPYSAPSGI-GGASSTATHTQTA 150
            ++SFTPS SAG              S+PS       NPY   +G+  G      H    
Sbjct: 137 ASESFTPSVSAGGIPSSQELAGTLHGSNPSIPSPVPSNPYVNSAGLPSGGMLGVGH---- 192

Query: 151 PVTGFTQRPPDPRSSLTSAGPIASSRVSATQNFPTIYPPPHSILQYHLYAPDPPPHLKVP 210
                      P   L    P  +  V+    FPT+YPP HS+LQYHLYAPDPPPHLK+P
Sbjct: 193 -----------PMQGLPPPPPPGALPVNPITQFPTVYPPTHSVLQYHLYAPDPPPHLKIP 241

Query: 211 LKPNERTPETLFIPNDLREELVKKNQSALQVFPSGGSLPEIVGDYFGLVPLEFHSRASYK 270
           LKPNERTPETLFI N LR+ LVK NQ+ALQVFP G SLP+IVGDYFGLVP++FH+R S K
Sbjct: 242 LKPNERTPETLFINNHLRDRLVKNNQTALQVFPRG-SLPDIVGDYFGLVPMDFHNRTSDK 300

Query: 271 QRYMGHQNSLYKVFSNSDGKIYIMRRIHDVNITEATQVSRPFQMWQKVSCANVVKIKDAF 330
           +RY GH+NSLYKVFSN DGKIY MRRIHDV IT++ QVS+PFQ W  +  AN+  +KD+F
Sbjct: 301 KRYNGHKNSLYKVFSNLDGKIYFMRRIHDVKITDSAQVSKPFQTWSHLRSANITVLKDSF 360

Query: 331 ITRAFNDSSLCVVHEYFPQSSSLYETHFVNFTLTPITQDYLWAYLVQLTNALKEVHSQNL 390
           +T AFNDSSLC+V +Y+PQS SLYET+ +  ++  + Q+YLWA+LVQLT AL+EVHS  L
Sbjct: 361 VTSAFNDSSLCMVFDYYPQSQSLYETYGLANSVNELNQEYLWAFLVQLTIALQEVHSNGL 420

Query: 391 SINILGWDKVIVTGEPGRIKVSDCGVYDIL-HSLESRDIEEEQQKDFEELGKLLNGLVTK 449
           ++N L W KVIVTGEPGRIKV+D GVYD L +  E R +  EQQ+++  L +LL  LV +
Sbjct: 421 ALNDLDWKKVIVTGEPGRIKVTDIGVYDTLNYHQEGRMLHTEQQQNYLSLAELLLNLVQR 480

Query: 450 I--ASSKDTSTQDLKVDSDFKIVLDYLL-LNDHKKNVRELASLFTDRILSVVSSLQTHVE 506
           +  AS      +   +D  FK  + YL   +++ KN+ +   LF+ ++LSVV+SLQ + E
Sbjct: 481 LCGASGPLDDVKSYHIDPLFKKCIQYLQDTSNNNKNIEDFTKLFSHKVLSVVNSLQYNSE 540

Query: 507 CTEAYLSRELENGRLFRLMCKLNFIFGRTESRVDINWSESGEKFPIILFYDYVFHQVDEA 566
             E  LSRELEN RLFRLMCKLN I+GR ESR+DINW+ESGEKFPIILF+DYVFHQ D+ 
Sbjct: 541 YLEQQLSRELENARLFRLMCKLNAIYGRLESRIDINWAESGEKFPIILFFDYVFHQKDDT 600

Query: 567 GKSIMDLTHVLRCLNKLDAGVTEKIMLVTPDEMNCIIISYKELKDLIDSTFRSMTQ 622
           GK++MDLTHVLRCLNKLDAGV+E++MLVTPDEMNCIIISYKELKDLIDSTFR++TQ
Sbjct: 601 GKNVMDLTHVLRCLNKLDAGVSERLMLVTPDEMNCIIISYKELKDLIDSTFRALTQ 656

>YKL025C (PAN3) [3230] chr11 complement(389883..391922) Component of
           Pab1p-stimulated poly(A) ribonuclease [2040 bp, 679 aa]
          Length = 679

 Score =  558 bits (1439), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 318/695 (45%), Positives = 418/695 (60%), Gaps = 89/695 (12%)

Query: 1   MDKANTEWAKDIPCKNITIHGFCKFENDGCIFNHGSSGTKTGVN------------TPTG 48
           MDK N +WAKDIPC+NITI+G+CK E +GC F H  + T T +N            TPT 
Sbjct: 1   MDKINPDWAKDIPCRNITIYGYCKKEKEGCPFKHSDNTTATTINDVPPPIDVGEATTPT- 59

Query: 49  IMNSASKFNAKTASSFTPSKITSSDFNGVSGFTSDKXXXXXXXXXXXXXXXXXXFATNFN 108
            M S  KFNAK ++SFTP  + S     V+  TS                         N
Sbjct: 60  -MTSVPKFNAKVSASFTPMTVGSDSLTTVTNTTSAATNATGNIAMAATSATASTVNPMIN 118

Query: 109 PYVADSFTPSGS----------AGVSSPSFNPYSAPSGIGGASSTATHTQTAPVTGFTQR 158
           P V  S   + +             SS +++P++AP  I   SST++    A    F   
Sbjct: 119 PIVNSSLVNNNNNNSNISISIPTTASSSNYDPFNAP--IFTPSSTSSIHTNANAHSF--- 173

Query: 159 PPDPRSSLTSAGPIASSRV-----------------------SATQNFPTIYPPPHSILQ 195
              P  S+ ++G I  +                         S+   +P IYPPPHS+LQ
Sbjct: 174 ---PFPSIANSGGININATDDNSNNMSMANNVPPPMQPPPIESSNLKYPRIYPPPHSLLQ 230

Query: 196 YHLYAPDPPPHLKVPLKPNERTPETLFIPNDLREELVKKNQSALQVFPSGGS-LPEIVGD 254
           YHLYAP+ P  LK  LKPNER+ + LFIPN++RE+L KKN S LQVFPS G  +P IV D
Sbjct: 231 YHLYAPEQPSSLKSLLKPNERSADQLFIPNNIREDLTKKNLSILQVFPSSGKVIPSIVQD 290

Query: 255 YFGLVPLEFHSRASYKQRYMGHQNSLYKVFSNSDGKIYIMRRIHDVNIT-EATQVSRPFQ 313
           YF LVP       ++      ++ +L+KVFSN DGK Y+++R+ +++ +    ++S+ +Q
Sbjct: 291 YFNLVP------LNFNNNDFLNKTTLFKVFSNYDGKAYVLKRLPNIDKSMNPNKISKIYQ 344

Query: 314 MWQKVSCANVVKIKDAFITRAFNDSSLCVVHEYFPQSSSLYETHFVNFTLTPITQDYLWA 373
           +W K++C N++K +D F T  F D S+C+V +Y+P S SLY+ HFVNF   PIT +YLW 
Sbjct: 345 IWSKINCTNLIKFRDIFQTTKFGDLSICLVFDYYPNSLSLYDYHFVNFPKFPITNNYLWI 404

Query: 374 YLVQLTNALKEVHSQNLSI-NILGWDKVIVTGEPGRIKVSDCGVYDILHSLES------- 425
           YLVQLTN +  +HSQNLSI N L W KV++TG+PGRIK+S C   D+L + ++       
Sbjct: 405 YLVQLTNVINSIHSQNLSIGNTLNWRKVLITGDPGRIKLSHCNFMDLLFNDDTDTVVSSG 464

Query: 426 -RDIEEEQQKDFEELGKLLNGLVT--------------KIASSKDTSTQDLK-VDSDFKI 469
              IE +QQ D++ LG+LL  L                ++      S  D++ +D  FK 
Sbjct: 465 GSTIEGQQQLDYKYLGELLFNLSINIENSNNNTAPKEYRLEEITPQSIDDMRQIDDKFKD 524

Query: 470 VLDYLLLN--DHKKNVRELASLFTDRILSVVSSLQTHVECTEAYLSRELENGRLFRLMCK 527
           VL YL+ +  D KK++ +L S F D++  V+ S QT+ E  E+ LSRELENGRLFRL+ K
Sbjct: 525 VLKYLISDNGDSKKSIHDLTSHFYDKMFMVLESSQTYTEYMESVLSRELENGRLFRLVNK 584

Query: 528 LNFIFGRTESRVDINWSESGEKFPIILFYDYVFHQVDEAGKSIMDLTHVLRCLNKLDAGV 587
           LN IFGR ESR+DINWSESG KFPIILFYDYVFHQVD  GK IMDLTHVLRCLNKLDAG+
Sbjct: 585 LNCIFGRIESRIDINWSESGTKFPIILFYDYVFHQVDSNGKPIMDLTHVLRCLNKLDAGI 644

Query: 588 TEKIMLVTPDEMNCIIISYKELKDLIDSTFRSMTQ 622
            EK+MLVTPDE+NCIIISYKELKDLI+STFRS+TQ
Sbjct: 645 QEKLMLVTPDELNCIIISYKELKDLIESTFRSITQ 679

>CAGL0L09889g 1055765..1057918 similar to sp|P36102 Saccharomyces
           cerevisiae YKL025c PAN3 component of the PAB1P-dependent
           poly(A) ribonuclease, start by similarity
          Length = 717

 Score =  511 bits (1316), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 251/453 (55%), Positives = 337/453 (74%), Gaps = 16/453 (3%)

Query: 183 FPTIYPPPHSILQYHLYAPDPPPHLKVPLKPNERTPETLFIPNDLREELVKKNQSALQVF 242
           +PTIYPP HSILQYHLYAPDPPP L++ LK NERTP  LFIPNDLREELVK+N ++LQ+F
Sbjct: 266 YPTIYPPTHSILQYHLYAPDPPPQLEIALKENERTPRMLFIPNDLREELVKRNLASLQLF 325

Query: 243 PSGGSLPEIVGDYFGLVPLEFHSRASYKQRYMGHQNSLYKVFSNSDGKIYIMRRIHDVNI 302
           PSGG+LP IV DYFGLVPL+FH R+S K RY  H+NSLYKVFSN DG+IY++RRIHDVNI
Sbjct: 326 PSGGNLPHIVKDYFGLVPLDFHQRSSVKDRYKKHKNSLYKVFSNVDGRIYLLRRIHDVNI 385

Query: 303 TEATQVSRPFQMWQKVSCANVVKIKDAFITRAFNDSSLCVVHEYFPQSSSLYETHFVNFT 362
           ++ T +S+ FQ W K+  +NVV +KD F+T AF DSSL +V++Y+P ++SLYE HFVN+ 
Sbjct: 386 SDPTIISKTFQKWSKIDSSNVVALKDLFLTTAFGDSSLGIVYDYYPNATSLYEAHFVNYP 445

Query: 363 LTPITQDYLWAYLVQLTNALKEVHSQN-LSINILGWDKVIVTGEPGRIKVSDCGVYDILH 421
              +T+D LW+Y VQ+ N L+E+H+ N ++I  L  DK+I+TG+ GRIK+S    YDI++
Sbjct: 446 TVEVTEDLLWSYAVQILNGLREIHNTNGVNIGDLDCDKIILTGK-GRIKISAGAEYDIMN 504

Query: 422 ------SLESRDIEEEQQKDFEELGKLLNGLVTKIASSKDTSTQDL-KVDSDFKIVLDYL 474
                 + +  + E+ ++++F +LG++L  L +K+ +       +L +V    K ++  L
Sbjct: 505 MCCPEDNEDDDNEEKLRKRNFVDLGEILFKLASKMCNCHGKDVANLAQVSEKLKNLIKSL 564

Query: 475 L---LNDHKKNVRELASLFT--DRILSVVSSLQTHVECTEAYLSRELENGRLFRLMCKLN 529
               L+D+  NV  +   +   D +  V+ + QT+ E  E  LSRELENGRLFRL+CKLN
Sbjct: 565 AFEQLHDY-VNVATIIEKYIGLDVVFKVMEAQQTYSEYAENVLSRELENGRLFRLICKLN 623

Query: 530 FIFGRTESRVDINWSESGEKFPIILFYDYVFHQVD-EAGKSIMDLTHVLRCLNKLDAGVT 588
           FIFGR E+R+DINWSE G+KF I+LFYDYVFHQ+D   GK + DLTHVLRCLNKLDAGV 
Sbjct: 624 FIFGRVENRLDINWSEPGDKFVIVLFYDYVFHQIDPNTGKPVTDLTHVLRCLNKLDAGVE 683

Query: 589 EKIMLVTPDEMNCIIISYKELKDLIDSTFRSMT 621
           E I+LVTPDE+N  ++SYK++K+L+D TFR+MT
Sbjct: 684 ENILLVTPDELNTAVVSYKKVKELVDKTFRAMT 716

 Score = 62.8 bits (151), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 57/227 (25%), Positives = 80/227 (35%), Gaps = 51/227 (22%)

Query: 1   MDKANTEWAKDIPCKNITIHGFCKFENDGCIFNHGSSGTKTGVNTPTGIMNSASKFNAKT 60
           MDK N +WA+D+PC+N+ I+GFCK + +GC F H        + TPT     A    A +
Sbjct: 1   MDKINPDWARDVPCRNVIIYGFCKKKTEGCPFKHDDD----DIATPTSTPKVADTVPAPS 56

Query: 61  ASSFTPSKITSSDFNGVSGFTSDKXXXXXXXXXXXXXXXXXXFATNFNPYVADSFTPSGS 120
                PSKI+ S    ++   S                        FN   + SFTP   
Sbjct: 57  GVIQQPSKISVSSLPSLNSQPSSTAPTSAPNATAHTGSKSQ--VPKFNAKASASFTPMSK 114

Query: 121 AGVSSPSFNPYSAPSGIGGASSTATHTQTAPVTGFTQRPPDPRSSLTSAGPIASSRVSAT 180
           A                 G   T      +PV G             S GPI  +     
Sbjct: 115 AA---------------DGTQETQAPYLESPVAG-------------SPGPILKAGT--- 143

Query: 181 QNFPTIYPPPHSILQYHLYAPDPPPHLKVPLKPNERTPETLFIPNDL 227
                    P S +Q ++Y+  P     VP   +   P  +  PND+
Sbjct: 144 ---------PVSFMQPNIYSTTP-----VPSPASMAMPNVVMPPNDM 176

>ADR313W [2054] [Homologous to ScYDL025C - SH]
           complement(1255932..1257668) [1737 bp, 578 aa]
          Length = 578

 Score = 37.7 bits (86), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 33/139 (23%), Positives = 61/139 (43%), Gaps = 18/139 (12%)

Query: 283 VFSNSDGKIYIMRRIHDVNITE-----ATQVSRPFQMWQKVSCANVVKIKDAFITRAFND 337
           V  ++DG+++ ++R       E     + +V+  F     +   N+++  D         
Sbjct: 280 VIKSTDGQLFAVKRFRPRAPRETLKEYSRKVTSEFCTGSTLRHQNIIETLDMLQEGEL-- 337

Query: 338 SSLCVVHEYFPQSSSLYETHFVNFTLT-PITQDYLWAYLVQLTNALKEVHSQNLSINILG 396
               VV EY P     Y+  F N  ++  +T+  +W Y  Q+   +  +HSQ L+   L 
Sbjct: 338 --FLVVMEYCP-----YD--FFNLVMSNQMTKHEVWCYFKQICRGVDYLHSQGLAHRDLK 388

Query: 397 WDKVIVTGEPGRIKVSDCG 415
            D  +VT + G +K+ D G
Sbjct: 389 LDNCVVTAD-GILKLIDFG 406

>ADR379C [2120] [Homologous to ScYOR351C (MEK1) - SH]
           (1386601..1388079) [1479 bp, 492 aa]
          Length = 492

 Score = 36.2 bits (82), Expect = 0.078,   Method: Compositional matrix adjust.
 Identities = 46/182 (25%), Positives = 78/182 (42%), Gaps = 12/182 (6%)

Query: 249 PEIVGD-YFGLVPLEFHSRASYKQRYMGHQNSLYKVFSNSDGK-IYIMRRIHDVNITEAT 306
           P++VG   FG V +     A  K R + +   + ++   +  K   I+ R++ V+  E T
Sbjct: 146 PQVVGSGTFGQVLVAERKSAHSKHRPLNYAVKVIRMKREALAKEASILVRLNHVSGIETT 205

Query: 307 QVSRPFQMWQKVSCANVVKIKDAFITRAFNDSSLCVVHEYFPQSSSLYETHFVNFTLTPI 366
                    Q     NV+K+ D F+    ND+    + E       L+        L PI
Sbjct: 206 GEEHVLTRGQ----PNVIKVHDTFVDE--NDN--IYIFEDLVAGGDLFSYLAKKDCLAPI 257

Query: 367 TQDYLWAYLVQLTNALKEVHSQNLSINILGWDKVIV-TGEP-GRIKVSDCGVYDILHSLE 424
           ++      + Q+  ALK +HS+ +    L  D +++ T EP  RI ++D G+   L S  
Sbjct: 258 SETEALVIVYQILQALKFLHSKGIVHRDLKLDNILLCTPEPCSRIVLADFGIAKDLPSTR 317

Query: 425 SR 426
            R
Sbjct: 318 VR 319

>YHR102W (KIC1) [2390] chr8 (316574..319816) Serine/threonine
           protein kinase involved in regulation of cell wall beta
           1,6-glucan levels, interacts with Cdc31p [3243 bp, 1080
           aa]
          Length = 1080

 Score = 36.2 bits (82), Expect = 0.093,   Method: Compositional matrix adjust.
 Identities = 33/141 (23%), Positives = 66/141 (46%), Gaps = 16/141 (11%)

Query: 280 LYKVFSNSDGKIYIMRRIH-DVNITEATQVSRPFQMWQKV-SCANVVKIKDAFITRAFND 337
           +YK ++   G++Y ++ ++ D +  E   V R  Q    +   +N+ +   +++     D
Sbjct: 37  VYKGYNVKTGRVYAIKVLNLDSDSDEVEDVQREIQFLASLKQISNITRYYGSYL----KD 92

Query: 338 SSLCVVHEYFPQSSSLYETHFVNFTLTP--ITQDYLWAYLVQLTNALKEVHSQNLSINIL 395
           +SL ++ E+    S       +   L P  I + Y+   + +L  ALK +H  N+    +
Sbjct: 93  TSLWIIMEHCAGGS-------LRSLLRPGKIDEKYIGVIMRELLVALKCIHKDNVIHRDI 145

Query: 396 GWDKVIVTGEPGRIKVSDCGV 416
               V++T E G +K+ D GV
Sbjct: 146 KAANVLITNE-GNVKLCDFGV 165

>Sklu_2382.2 YDL195W, Contig c2382 2146-5931 reverse complement
          Length = 1261

 Score = 34.3 bits (77), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 31/100 (31%), Positives = 42/100 (42%), Gaps = 17/100 (17%)

Query: 132  SAPSGIGGASSTATHTQTAPVTGFTQRPPDPRSSLTSAG------PIASSRVSATQNFPT 185
            +AP G+G    T++    A V      PP P S +TS+       P  S+  SA+ N   
Sbjct: 958  TAPIGVGVMPGTSSTPSNAGV------PPPPLSRVTSSANVIVPPPPKSTSRSASSNGSN 1011

Query: 186  IYPPP-----HSILQYHLYAPDPPPHLKVPLKPNERTPET 220
             Y PP     H+ +    YAP P  +   P  PN   P T
Sbjct: 1012 PYAPPPISNAHTPVASSPYAPPPATNFAQPAAPNPYAPST 1051

>KLLA0F11143g complement(1026129..1028570) similar to sp|P22216
           Saccharomyces cerevisiae YPL153c SPK1 ser/thr/tyr
           protein kinase, start by similarity
          Length = 813

 Score = 33.9 bits (76), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 36/143 (25%), Positives = 66/143 (46%), Gaps = 10/143 (6%)

Query: 279 SLYKVFSNSDGKIYIMRRIHDVNITEA-TQVSRPFQMWQKVSCANVVKIKDAFITRAFND 337
           ++ K    S GK + ++ IH   + +    V R   + QK++   +VK+KD F     ND
Sbjct: 205 TVKKAVERSTGKTFAVKIIHKRKVMDKFDGVKRELDVLQKLNHPRIVKLKDFF---EDND 261

Query: 338 SSLCVVHEYFPQSSSLYETHFVNFTLTPITQDYLWAYLVQLTNALKEVHSQNLSINILGW 397
           +   ++   F     L +  FV    T + +D       Q+  A+K +H Q +S   L  
Sbjct: 262 NYYMLME--FVSGGDLMD--FVAAHGT-VGEDAGREITRQVLEAVKYMHDQGISHRDLKP 316

Query: 398 DKVIV-TGEPGRIKVSDCGVYDI 419
           D +++   +P  IK++D G+  +
Sbjct: 317 DNIMIEQDDPVLIKITDFGLAKV 339

>Scas_580.6
          Length = 1015

 Score = 33.5 bits (75), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 34/141 (24%), Positives = 63/141 (44%), Gaps = 16/141 (11%)

Query: 280 LYKVFSNSDGKIYIMRRIH-DVNITEATQVSRPFQMWQKV-SCANVVKIKDAFITRAFND 337
           +YK +     +IY ++ ++ D +  E   V R  Q    +    N+ +   +++     D
Sbjct: 51  VYKGYHVRTKQIYAIKVLNLDSDEDEVEDVQREVQFLSSLKQIPNITRYYGSYL----KD 106

Query: 338 SSLCVVHEYFPQSSSLYETHFVNFTLTP--ITQDYLWAYLVQLTNALKEVHSQNLSINIL 395
           +SL ++ EY    S       +   L P  I + Y+   + +L  ALK +H  N+    +
Sbjct: 107 TSLWIIMEYCAGGS-------LRSLLRPGKIDEKYIGVIMRELLVALKYIHKDNVIHRDI 159

Query: 396 GWDKVIVTGEPGRIKVSDCGV 416
               V++T E G +K+ D GV
Sbjct: 160 KAANVLITNE-GSVKLCDFGV 179

>CAGL0D02244g complement(229504..230967) similar to sp|P24719
           Saccharomyces cerevisiae YOR351c MEK1 ser/thr protein
           kinase, hypothetical start
          Length = 487

 Score = 33.1 bits (74), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 27/123 (21%), Positives = 63/123 (51%), Gaps = 6/123 (4%)

Query: 306 TQVSRPFQMWQKVSCANVVKIKDAFITRAFNDSSLCVVHEYFPQSSSLYETHFVNFTLTP 365
           +++ +  ++  +++  N++K+   F T     ++L +  E  P    L+        L P
Sbjct: 200 SKLDKEAKILMQLNHPNIIKV---FKTHTDKSNNLYIFQELIP-GGDLFSYLAKGDCLMP 255

Query: 366 ITQDYLWAYLVQLTNALKEVHSQNLSINILGWDKVIV-TGEP-GRIKVSDCGVYDILHSL 423
           I+Q     ++ Q+ +ALK +H++ +    L  D +++ T EP  +I ++D G+   + ++
Sbjct: 256 ISQTEALVFVYQILHALKYLHTKGIVHRDLKLDNILLCTPEPFTKIVLADFGIARTVTTM 315

Query: 424 ESR 426
           +SR
Sbjct: 316 KSR 318

>YDL025C (YDL025C) [836] chr4 complement(405341..407203)
           Serine/threonine protein kinase with similarity to
           members of the NPR1 subfamily [1863 bp, 620 aa]
          Length = 620

 Score = 32.7 bits (73), Expect = 0.87,   Method: Compositional matrix adjust.
 Identities = 45/171 (26%), Positives = 72/171 (42%), Gaps = 29/171 (16%)

Query: 260 PLEFHSRASYKQRYMGHQNS-LYKVFSNSDGKIY---IMRRIHDVNITEATQVSRPFQMW 315
           P+E   +     R +G   S    V   +DGK++   + R+ H  N  E T  S+     
Sbjct: 294 PVELLEKYGIPGRKLGEGASGSVSVVERTDGKLFACKMFRKPHLNN--EGTNQSQLANYS 351

Query: 316 QKVSCA----------NVVKIKDAFITRAFNDSSLCVVHEYFPQSSSLYETHFVNFTLTP 365
           +KV+            N+V+  D        D+ L V+ EY P         F N  ++ 
Sbjct: 352 KKVTTEFCIGSTLHHENIVETLDMLTE---GDTYLLVM-EYAPYD-------FFNLVMSN 400

Query: 366 I-TQDYLWAYLVQLTNALKEVHSQNLSINILGWDKVIVTGEPGRIKVSDCG 415
           + TQD +  Y  QL + +  +HS  L+   L  D  +VT + G +K+ D G
Sbjct: 401 LMTQDEVNCYFKQLCHGVNYLHSMGLAHRDLKLDNCVVTKD-GILKLIDFG 450

>ADR090W [1831] [Homologous to ScYDL195W (SEC31) - SH]
            complement(868744..872445) [3702 bp, 1233 aa]
          Length = 1233

 Score = 33.1 bits (74), Expect = 0.89,   Method: Compositional matrix adjust.
 Identities = 47/152 (30%), Positives = 60/152 (39%), Gaps = 34/152 (22%)

Query: 108  NPYVADSFTPSGSAGVSSPSFNPYSAPSGI-GGASSTAT-----------HTQTA-PVTG 154
            NPY       +G   V SP  NPY APSG    A  T T           HT  A P++ 
Sbjct: 1000 NPYAPPV---TGRNAVQSPPLNPY-APSGAHAAAPPTGTYSPHLAGQAIDHTHRATPLSN 1055

Query: 155  FTQRP----PDP------RSSLTSAGPIASSR--VSATQNFPTIYPPPHSILQYHLYAPD 202
                P    P P      R S TS   I S+   +S+ Q  P   PPP    +  + AP 
Sbjct: 1056 MAAPPQKAMPGPPPKSMARKSTTSEKDIDSANQLLSSIQKAPNGGPPP----RKQVVAPQ 1111

Query: 203  PPPHLKVPL-KPNERTPETLFIPNDLREELVK 233
            P  H   P+ +P    P+   I    +EEL +
Sbjct: 1112 PSVHAASPVAEPVAIPPQQQLIIEFFKEELAR 1143

>AEL063W [2443] [Homologous to ScYJR033C (RAV1) - SH]
           complement(515396..519340) [3945 bp, 1314 aa]
          Length = 1314

 Score = 32.0 bits (71), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 20/67 (29%), Positives = 36/67 (53%), Gaps = 11/67 (16%)

Query: 244 SGGSLPEIVGDYFG-----LVPLEFHSRAS-----YKQRYMGHQNSLYKVFSNSDGK-IY 292
           SGG L  ++ D  G     L+PL+  +R +      + R+ GH  S+ +++ +SDG+ I 
Sbjct: 340 SGGQLSLVIHDLRGSIKHVLLPLDKLARPTSLGDILEHRFTGHSKSIQRLWRSSDGEAIL 399

Query: 293 IMRRIHD 299
            + R H+
Sbjct: 400 TISRFHE 406

>Scas_691.4
          Length = 334

 Score = 31.2 bits (69), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 30/61 (49%)

Query: 553 ILFYDYVFHQVDEAGKSIMDLTHVLRCLNKLDAGVTEKIMLVTPDEMNCIIISYKELKDL 612
           I F  Y F++     K    +T     L  + AG+TE +++V P E+  I +  + L DL
Sbjct: 88  IRFSSYEFYRNALTDKETRTITTGNTFLAGVGAGITEAVLVVNPMEVVKIRLQAQHLNDL 147

Query: 613 I 613
           I
Sbjct: 148 I 148

>Kwal_33.15153
          Length = 1861

 Score = 30.8 bits (68), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 16/34 (47%), Positives = 18/34 (52%)

Query: 127 SFNPYSAPSGIGGASSTATHTQTAPVTGFTQRPP 160
           S NP + P GI    ST  H  TAP TG  Q+ P
Sbjct: 171 SSNPAAGPVGIRRKMSTLIHGNTAPGTGPGQQGP 204

>CAGL0L11550g 1229719..1232937 similar to sp|P38692 Saccharomyces
           cerevisiae YHR102w NRK1 ser/thr protein kinase, start by
           similarity
          Length = 1072

 Score = 30.4 bits (67), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 38/154 (24%), Positives = 69/154 (44%), Gaps = 22/154 (14%)

Query: 280 LYKVFSNSDGKIYIMRRIH-DVNITEATQVSRPFQMWQKVSCANVVKIKDAFITRAFND- 337
           +YK +     ++Y ++ ++ D +  E   V R  Q       A++ +I +  ITR +   
Sbjct: 30  VYKGYHVKTKQVYAIKVLNLDSSEDEVEDVQREIQF-----LASLKQIPN--ITRYYGSY 82

Query: 338 ---SSLCVVHEYFPQSSSLYETHFVNFTLTP--ITQDYLWAYLVQLTNALKEVHSQNLSI 392
              +SL ++ EY    S       +   L P  I + Y+   + +L  ALK +H  N+  
Sbjct: 83  LRGTSLWIIMEYCAGGS-------LRSLLRPGKIDEKYIGVIMRELLVALKVIHKDNVIH 135

Query: 393 NILGWDKVIVTGEPGRIKVSDCGVYDILHSLESR 426
             +    V++T E G++K+ D GV   L+    R
Sbjct: 136 RDIKAANVLITNE-GQVKLCDFGVAAQLNQTSLR 168

>Scas_683.16
          Length = 338

 Score = 29.6 bits (65), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 22/82 (26%), Positives = 32/82 (39%), Gaps = 5/82 (6%)

Query: 112 ADSFTPSGSAGVSSPSFNPYSAPSGIGGASSTATHTQTAPVT--GFTQRPPDPRSSLTSA 169
           A   TP      + P    Y  PS   G+  T   T  +P +  G+  RP  P  ++  +
Sbjct: 59  APVMTPPNFLNNNRPPPLQYQPPSQHNGSHHTIQETFISPNSRPGYNTRPSPPAQNMNVS 118

Query: 170 GPIASSRVSATQNFPTIYPPPH 191
            P+    V  T N P    PP+
Sbjct: 119 NPMPIPHVGRTMNHPV---PPY 137

>CAGL0L05676g 619734..626369 highly similar to sp|P07259 Saccharomyces
            cerevisiae YJL130c URA2, start by similarity
          Length = 2211

 Score = 30.0 bits (66), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 18/44 (40%), Positives = 26/44 (59%), Gaps = 5/44 (11%)

Query: 215  ERTPETLFIPNDLREELVKKNQSALQVFPSGGSLP----EIVGD 254
            E+ PE +F+P +  +E   KN SA+  F S GS+P    EI G+
Sbjct: 1687 EQWPEAMFLPTEEDQEFFWKNLSAIDAF-SIGSVPTQLAEITGN 1729

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.317    0.133    0.394 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 20,890,671
Number of extensions: 929160
Number of successful extensions: 3881
Number of sequences better than 10.0: 93
Number of HSP's gapped: 3964
Number of HSP's successfully gapped: 118
Length of query: 622
Length of database: 16,596,109
Length adjustment: 108
Effective length of query: 514
Effective length of database: 12,857,365
Effective search space: 6608685610
Effective search space used: 6608685610
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 65 (29.6 bits)