Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Sklu_2380.257257228180.0
Kwal_14.85457057322350.0
CAGL0I00286g55554221440.0
CAGL0D02662g56457020730.0
CAGL0D02640g56457020730.0
Sklu_2376.557957220610.0
Sklu_2362.157256220530.0
YMR011W (HXT2)54153520290.0
Kwal_55.2007557155220080.0
YDR343C (HXT6)57054119990.0
YDR342C (HXT7)57054119980.0
Sklu_2415.257157519550.0
Scas_715.5055953719230.0
CAGL0A02211g55255319160.0
Scas_541.657354419060.0
Scas_658.2457054419000.0
YFL011W (HXT10)54652918960.0
YLR081W (GAL2)57456918970.0
CAGL0A02233g54955318930.0
CAGL0A01782g56855518940.0
KLLA0D13310g56756818790.0
CAGL0A01826g53351118750.0
CAGL0A00737g54955218740.0
YHR092C (HXT4)56053318700.0
YHR096C (HXT5)59257218530.0
YJL219W (HXT9)56757118150.0
YOL156W (HXT11)56755918080.0
YJL214W (HXT8)56955118060.0
AFL207C53950817980.0
Sklu_2304.657157518010.0
Scas_658.2356855417970.0
YHR094C (HXT1)57055417920.0
YDR345C (HXT3)56755517900.0
AFL205C54656517860.0
CAGL0A02321g55655417710.0
Scas_712.155854617710.0
Scas_541.759155717670.0
Scas_628.759352917620.0
CAGL0A01804g56355217380.0
Scas_687.461056717390.0
Scas_509.256854317200.0
Scas_550.957455117170.0
Kwal_26.668656952217050.0
Scas_552.257254617050.0
Scas_455.2*53552916710.0
Kwal_55.1958256754716700.0
Kwal_56.2228556754716600.0
Scas_657.2056956616390.0
AFL204C53549716100.0
Scas_685.556055416070.0
YEL069C (HXT13)56455815600.0
YNR072W (HXT17)56456115530.0
YDL245C (HXT15)56754815360.0
YJR158W (HXT16)56754815290.0
YIL170W (HXT12)45745414790.0
Scas_634.1647145413830.0
Kwal_26.668041638412971e-176
Scas_600.12932889681e-128
Kwal_55.200682672678741e-114
KLLA0E21021g5284898841e-112
AFR602W5584848751e-110
Scas_716.535235288171e-102
Kwal_56.248415114977683e-95
CAGL0M04103g5315227477e-92
YNL318C (HXT14)5404887488e-92
Kwal_27.96785134857283e-89
Kwal_55.200642382406956e-88
Scas_624.57984806293e-72
CAGL0I03872g7624835923e-67
YDL194W (SNF3)8844885893e-66
CAGL0J09020g8565265851e-65
Kwal_56.244697095225763e-65
YDL138W (RGT2)7634995563e-62
ADR091W6645305341e-59
Scas_701.448764995323e-58
KLLA0F05181g7875425267e-58
Kwal_34.162613272714665e-53
KLLA0F26246g5834894239e-45
AEL042C5475124182e-44
Kwal_33.149115705004141e-43
Kwal_34.161905565614088e-43
KLLA0A11110g5515514061e-42
Sklu_2439.205714963963e-41
ADR139C5585093902e-40
YDR536W (STL1)5695023902e-40
Scas_637.96074243842e-39
KLLA0E00264g5114583769e-39
Scas_552.0d1121013479e-39
KLLA0C12309g5696013752e-38
Kwal_56.227245784363664e-37
Sklu_2313.35785563505e-35
Scas_581.65873943435e-34
Kwal_27.116387234993431e-33
AFR343C5714933401e-33
YDR497C (ITR1)5844263373e-33
YOL103W (ITR2)6095343374e-33
Sklu_2427.85784803338e-33
CAGL0I07447g5704873241e-31
KLLA0A03223g6775083242e-31
KLLA0D00374g5565783072e-29
KLLA0E25025g5565132949e-28
Kwal_34.162661581572711e-27
ABR223C6244482861e-26
KLLA0B00264g5764952734e-25
KLLA0D00253g5844952734e-25
CAGL0M01672g5473662716e-25
Kwal_55.212895375222637e-24
KLLA0E14696g4773942601e-23
Sklu_2144.65273792592e-23
YBR241C4883842546e-23
Kwal_14.11055224792549e-23
KLLA0E08987g5664852512e-22
AFL034W4743952466e-22
KLLA0F06853g5284382451e-21
Kwal_27.128111811772281e-21
KLLA0B14861g5874982442e-21
Kwal_27.128151981882292e-21
Kwal_27.106646535102433e-21
KLLA0E02970g5403572388e-21
YIL171W (HXT12)109702123e-20
Scas_105.156532073e-20
YDR387C5555332308e-20
Kwal_33.129505664892309e-20
YJR160C (MPH3)6025242211e-18
YDL247W (MPH2)6095242192e-18
KLLA0D05379g4964632155e-18
CAGL0C01771g4853742145e-18
YBR298C (MAL31)6145122166e-18
YFL040W5405072156e-18
YGL104C (VPS73)4864032102e-17
Sklu_2375.16134732086e-17
KLLA0E06743g6673852077e-17
AGL277W6713922014e-16
KLLA0E01782g5723672004e-16
Scas_632.145532051942e-15
Kwal_27.110796135581933e-15
Kwal_14.16255064221905e-15
CAGL0K12716g4844271834e-14
Sklu_2080.45234301835e-14
Scas_597.54894011825e-14
KLLA0C19481g3903341798e-14
YGR289C (MAL11)6164071746e-13
Scas_652.124784801647e-12
Kwal_27.113852222161127e-06
KLLA0C19459g149127920.001
CAGL0B02475g580389960.002
CAGL0M06281g542263930.004
Scas_626.1570495880.015
YPR156C (TPO3)622303860.023
Sklu_1959.3531158860.027
YDL199C687513840.045
Sklu_2304.5565253820.070
Scas_660.3568108820.071
Scas_692.8625258810.089
KLLA0F13684g571147810.10
AFR322C592164810.10
KLLA0F10043g528145790.16
KLLA0F18106g589194790.17
Sklu_2121.1602177780.21
CAGL0I10384g630317770.29
Kwal_26.6669590139760.36
CAGL0J01375g564108760.40
Sklu_2253.3523154750.45
Sklu_1567.2569123750.47
YML123C (PHO84)587194750.48
KLLA0E03729g609194750.48
CAGL0E03674g577249750.51
YLL028W (TPO1)586166740.60
YDR119W768145740.67
Kwal_47.18919640193730.97
Scas_713.30630170721.2
YJL163C55580721.3
Sklu_2083.159831702.0
Kwal_47.18976534152692.3
Scas_694.19581164692.4
YGR138C (TPO2)614255692.9
Sklu_2444.1255764692.9
KLLA0D10615g45163683.1
Scas_713.17572263683.4
CAGL0G03927g567172674.4
CAGL0J00363g498138674.4
AGR076C68690675.2
Kwal_33.1426856945665.8
Scas_712.56620188657.7
Scas_676.25634288657.9
Sklu_2183.350446649.2
KLLA0F01727g40467649.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Sklu_2380.2
         (572 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Sklu_2380.2 YMR011W, Contig c2380 4381-6099 reverse complement       1090   0.0  
Kwal_14.854                                                           865   0.0  
CAGL0I00286g complement(20521..22188) highly similar to sp|P2358...   830   0.0  
CAGL0D02662g complement(278099..279793) highly similar to sp|P23...   803   0.0  
CAGL0D02640g 274285..275979 highly similar to sp|P23585 Saccharo...   803   0.0  
Sklu_2376.5 , Contig c2376 9071-10810 reverse complement              798   0.0  
Sklu_2362.1 YDR342C, Contig c2362 924-2642                            795   0.0  
YMR011W (HXT2) [3975] chr13 (288078..289703) High-affinity hexos...   786   0.0  
Kwal_55.20075                                                         778   0.0  
YDR343C (HXT6) [1171] chr4 complement(1159598..1161310) High-aff...   774   0.0  
YDR342C (HXT7) [1170] chr4 complement(1154206..1155918) High-aff...   774   0.0  
Sklu_2415.2 YJL214W, Contig c2415 2182-3897 reverse complement        757   0.0  
Scas_715.50                                                           745   0.0  
CAGL0A02211g complement(224864..226522) highly similar to sp|P39...   742   0.0  
Scas_541.6                                                            738   0.0  
Scas_658.24                                                           736   0.0  
YFL011W (HXT10) [1671] chr6 (112339..113979) Member of the hexos...   734   0.0  
YLR081W (GAL2) [3496] chr12 (290213..291937) Galactose and gluco...   735   0.0  
CAGL0A02233g complement(231128..232777) highly similar to sp|P39...   733   0.0  
CAGL0A01782g complement(170326..172032) highly similar to sp|P39...   734   0.0  
KLLA0D13310g complement(1143027..1144730) gi|131828|sp|P18631|RA...   728   0.0  
CAGL0A01826g complement(179321..180922) highly similar to sp|P38...   726   0.0  
CAGL0A00737g 74767..76416 highly similar to sp|P39003 Saccharomy...   726   0.0  
YHR092C (HXT4) [2382] chr8 complement(287131..288813) Moderate- ...   724   0.0  
YHR096C (HXT5) [2384] chr8 complement(294671..296449) Member of ...   718   0.0  
YJL219W (HXT9) [2711] chr10 (19497..21200) Member of the hexose ...   703   0.0  
YOL156W (HXT11) [4669] chr15 (25272..26975) Low-affinity glucose...   701   0.0  
YJL214W (HXT8) [2715] chr10 (26887..28596) Member of the hexose ...   700   0.0  
AFL207C [2988] [Homologous to ScAFL207C] (44349..45968) [1620 bp...   697   0.0  
Sklu_2304.6 , Contig c2304 11341-13056 reverse complement             698   0.0  
Scas_658.23                                                           696   0.0  
YHR094C (HXT1) [2383] chr8 complement(290915..292627) Low-affini...   694   0.0  
YDR345C (HXT3) [1172] chr4 complement(1162947..1164650) Low-affi...   694   0.0  
AFL205C [2990] [Homologous to ScYHR094C - SH] (49039..50679) [16...   692   0.0  
CAGL0A02321g complement(247500..249170) highly similar to sp|P32...   686   0.0  
Scas_712.1                                                            686   0.0  
Scas_541.7                                                            685   0.0  
Scas_628.7                                                            683   0.0  
CAGL0A01804g complement(175488..177179) highly similar to sp|P32...   674   0.0  
Scas_687.4                                                            674   0.0  
Scas_509.2                                                            667   0.0  
Scas_550.9                                                            665   0.0  
Kwal_26.6686                                                          661   0.0  
Scas_552.2                                                            661   0.0  
Scas_455.2*                                                           648   0.0  
Kwal_55.19582                                                         647   0.0  
Kwal_56.22285                                                         644   0.0  
Scas_657.20                                                           635   0.0  
AFL204C [2991] [Homologous to ScAFL204C] (51587..53194) [1608 bp...   624   0.0  
Scas_685.5                                                            623   0.0  
YEL069C (HXT13) [1361] chr5 complement(21537..23231) Member of t...   605   0.0  
YNR072W (HXT17) [4655] chr14 (772654..774348) Member of the hexo...   602   0.0  
YDL245C (HXT15) [632] chr4 complement(11657..13360) Member of th...   596   0.0  
YJR158W (HXT16) [3048] chr10 (732355..734058) Member of the hexo...   593   0.0  
YIL170W (HXT12) [2508] chr9 (19847..21220) Protein of unknown fu...   574   0.0  
Scas_634.16                                                           537   0.0  
Kwal_26.6680                                                          504   e-176
Scas_600.1                                                            377   e-128
Kwal_55.20068                                                         341   e-114
KLLA0E21021g 1870154..1871740 gi|32400014|emb|CAE00632.1 Kluyver...   345   e-112
AFR602W [3794] [Homologous to ScYNL318C (HXT14 ) - NSH] compleme...   341   e-110
Scas_716.53                                                           319   e-102
Kwal_56.24841                                                         300   3e-95
CAGL0M04103g 452677..454272 similar to sp|P42833 Saccharomyces c...   292   7e-92
YNL318C (HXT14) [4295] chr14 complement(38706..40328) Member of ...   292   8e-92
Kwal_27.9678                                                          285   3e-89
Kwal_55.20064                                                         272   6e-88
Scas_624.5                                                            246   3e-72
CAGL0I03872g 337985..340273 some similarities with sp|Q12300 Sac...   232   3e-67
YDL194W (SNF3) [679] chr4 (111581..114235) High-affinity glucose...   231   3e-66
CAGL0J09020g 887145..889715 highly similar to sp|P10870 Saccharo...   229   1e-65
Kwal_56.24469                                                         226   3e-65
YDL138W (RGT2) [730] chr4 (213352..215643) Low-affinity glucose ...   218   3e-62
ADR091W [1832] [Homologous to ScYDL194W (SNF3) - SH; ScYDL138W (...   210   1e-59
Scas_701.44                                                           209   3e-58
KLLA0F05181g 510384..512747 gi|2440082|emb|CAA75114.1 Kluyveromy...   207   7e-58
Kwal_34.16261                                                         184   5e-53
KLLA0F26246g 2432209..2433960 similar to sp|P39932 Saccharomyces...   167   9e-45
AEL042C [2464] [Homologous to ScYOL156W (HXT11) - SH] (557191..5...   165   2e-44
Kwal_33.14911                                                         164   1e-43
Kwal_34.16190                                                         161   8e-43
KLLA0A11110g 964084..965739 gi|1346290|sp|P49374|HGT1_KLULA Kluy...   160   1e-42
Sklu_2439.20 YDR536W, Contig c2439 31933-33648                        157   3e-41
ADR139C [1880] [Homologous to ScYDR536W (STL1) - NSH] (950171..9...   154   2e-40
YDR536W (STL1) [1346] chr4 (1507992..1509701) Member of the hexo...   154   2e-40
Scas_637.9                                                            152   2e-39
KLLA0E00264g 15302..16837 weakly similar to sp|P54854 Saccharomy...   149   9e-39
Scas_552.0d                                                           138   9e-39
KLLA0C12309g 1046848..1048557 highly similar to sp|P30606 Saccha...   149   2e-38
Kwal_56.22724                                                         145   4e-37
Sklu_2313.3 YDR497C, Contig c2313 3640-5376 reverse complement        139   5e-35
Scas_581.6                                                            136   5e-34
Kwal_27.11638                                                         136   1e-33
AFR343C [3535] [Homologous to ScYOL103W (ITR2) - SH; ScYDR497C (...   135   1e-33
YDR497C (ITR1) [1312] chr4 complement(1443701..1445455) Myo-inos...   134   3e-33
YOL103W (ITR2) [4718] chr15 (124000..125829) Myo-inositol permea...   134   4e-33
Sklu_2427.8 , Contig c2427 19304-21040                                132   8e-33
CAGL0I07447g 716104..717816 highly similar to sp|P30606 Saccharo...   129   1e-31
KLLA0A03223g 290002..292035 some similarities with sp|P39932 Sac...   129   2e-31
KLLA0D00374g 30962..32632 weakly similar to sp|Q9P8X7 Aspergillu...   122   2e-29
KLLA0E25025g complement(2219051..2220721) weakly similar to sp|P...   117   9e-28
Kwal_34.16266                                                         108   1e-27
ABR223C [817] [Homologous to ScYFL040W - SH] (820632..822506) [1...   114   1e-26
KLLA0B00264g 12844..14574 gi|5441459|emb|CAB46745.1 Kluyveromyce...   109   4e-25
KLLA0D00253g <12780..14534 gi|5441459|emb|CAB46745.1 Kluyveromyc...   109   4e-25
CAGL0M01672g 186088..187731 similar to tr|Q04162 Saccharomyces c...   108   6e-25
Kwal_55.21289                                                         105   7e-24
KLLA0E14696g 1309427..1310860 weakly similar to sp|Q9P8X7 Asperg...   104   1e-23
Sklu_2144.6 YFL040W, Contig c2144 7747-9330 reverse complement        104   2e-23
YBR241C (YBR241C) [420] chr2 complement(702546..704012) Member o...   102   6e-23
Kwal_14.1105                                                          102   9e-23
KLLA0E08987g 804915..806615 gi|22293246|emb|CAC79614.1 Kluyverom...   101   2e-22
AFL034W [3159] [Homologous to ScYBR241C - SH; ScYGL104C - SH] co...    99   6e-22
KLLA0F06853g 656373..657959 gi|24943210|gb|AAN65374.1 Kluyveromy...    99   1e-21
Kwal_27.12811                                                          92   1e-21
KLLA0B14861g complement(1305927..1307690) gi|125935|sp|P07921|LA...    99   2e-21
Kwal_27.12815                                                          93   2e-21
Kwal_27.10664                                                          98   3e-21
KLLA0E02970g complement(278965..280587) similar to sgd|S0002795 ...    96   8e-21
YIL171W (HXT12) [2507] chr9 (19515..19844) Member of the hexose ...    86   3e-20
Scas_105.1                                                             84   3e-20
YDR387C (YDR387C) [1215] chr4 complement(1248142..1249809) Membe...    93   8e-20
Kwal_33.12950                                                          93   9e-20
YJR160C (MPH3) [3050] chr10 complement(737923..739731) Protein w...    90   1e-18
YDL247W (MPH2) [630] chr4 (5985..7814) Protein with maltose perm...    89   2e-18
KLLA0D05379g complement(464200..465690) weakly similar to sp|P43...    87   5e-18
CAGL0C01771g 187030..188487 similar to sp|P38142 Saccharomyces c...    87   5e-18
YBR298C (MAL31) [475] chr2 complement(802587..804431) Maltose pe...    88   6e-18
YFL040W (YFL040W) [1643] chr6 (51350..52972) Putative hexose tra...    87   6e-18
YGL104C (VPS73) [1880] chr7 complement(308714..310174) Putative ...    86   2e-17
Sklu_2375.1 YGR289C, Contig c2375 1376-3217 reverse complement         85   6e-17
KLLA0E06743g complement(612941..614944) similar to ca|CA5798|IPF...    84   7e-17
AGL277W [4035] [Homologous to NOHBY] complement(185070..187085) ...    82   4e-16
KLLA0E01782g 171319..173037 weakly similar to ca|CA5798|IPF4181 ...    82   4e-16
Scas_632.14                                                            79   2e-15
Kwal_27.11079                                                          79   3e-15
Kwal_14.1625                                                           78   5e-15
CAGL0K12716g complement(1260169..1261623) similar to sp|P43562 S...    75   4e-14
Sklu_2080.4 YBR241C, Contig c2080 4658-6229                            75   5e-14
Scas_597.5                                                             75   5e-14
KLLA0C19481g 1747623..1748795 similar to ca|CA3241|IPF7493 Candi...    74   8e-14
YGR289C (MAL11) [2234] chr7 complement(1073968..1075818) Maltose...    72   6e-13
Scas_652.12                                                            68   7e-12
Kwal_27.11385                                                          48   7e-06
KLLA0C19459g 1746987..1747436 some similarities with ca|CA3241|I...    40   0.001
CAGL0B02475g 236029..237771 highly similar to sp|P25297 Saccharo...    42   0.002
CAGL0M06281g 651932..653560 similar to sp|P38125 Saccharomyces c...    40   0.004
Scas_626.1                                                             39   0.015
YPR156C (TPO3) [5571] chr16 complement(837903..839771) Polyamine...    38   0.023
Sklu_1959.3 , Contig c1959 3851-5446 reverse complement                38   0.027
YDL199C (YDL199C) [675] chr4 complement(101291..103354) Member o...    37   0.045
Sklu_2304.5 , Contig c2304 8691-10388                                  36   0.070
Scas_660.3                                                             36   0.071
Scas_692.8                                                             36   0.089
KLLA0F13684g complement(1267367..1269082) similar to sp|Q04301 S...    36   0.10 
AFR322C [3514] [Homologous to ScYGR138C (TPO2) - SH; ScYPR156C (...    36   0.10 
KLLA0F10043g complement(928691..930277) weakly similar to sp|P36...    35   0.16 
KLLA0F18106g 1657556..1659325 similar to sgd|S0003951 Saccharomy...    35   0.17 
Sklu_2121.1 YLL028W, Contig c2121 934-2742                             35   0.21 
CAGL0I10384g 1016935..1018827 highly similar to sp|P53283 Saccha...    34   0.29 
Kwal_26.6669                                                           34   0.36 
CAGL0J01375g 127843..129537 similar to sp|Q04301 Saccharomyces c...    34   0.40 
Sklu_2253.3 , Contig c2253 3254-4825 reverse complement                33   0.45 
Sklu_1567.2 YPR198W, Contig c1567 1150-2859                            33   0.47 
YML123C (PHO84) [3849] chr13 complement(24038..25801) High-affin...    33   0.48 
KLLA0E03729g 349784..351613 similar to sgd|S0006360 Saccharomyce...    33   0.48 
CAGL0E03674g complement(343114..344847) highly similar to tr|Q07...    33   0.51 
YLL028W (TPO1) [3391] chr12 (84803..86563) Polyamine transport p...    33   0.60 
YDR119W (YDR119W) [966] chr4 (688221..690527) Member of the 14-s...    33   0.67 
Kwal_47.18919                                                          33   0.97 
Scas_713.30                                                            32   1.2  
YJL163C (YJL163C) [2758] chr10 complement(111661..113328) Protei...    32   1.3  
Sklu_2083.1 YKL217W, Contig c2083 424-2220                             32   2.0  
Kwal_47.18976                                                          31   2.3  
Scas_694.19                                                            31   2.4  
YGR138C (TPO2) [2094] chr7 complement(763765..765609) Polyamine ...    31   2.9  
Sklu_2444.12 , Contig c2444 36594-38267 reverse complement             31   2.9  
KLLA0D10615g 903967..905322 similar to sp|P47159 Saccharomyces c...    31   3.1  
Scas_713.17                                                            31   3.4  
CAGL0G03927g complement(372896..374599) highly similar to tr|Q07...    30   4.4  
CAGL0J00363g 27627..29123 highly similar to sp|P38776 Saccharomy...    30   4.4  
AGR076C [4386] [Homologous to ScYDR119W - SH] (871570..873630) [...    30   5.2  
Kwal_33.14268                                                          30   5.8  
Scas_712.56                                                            30   7.7  
Scas_676.25                                                            30   7.9  
Sklu_2183.3 YCR098C, Contig c2183 6694-8208                            29   9.2  
KLLA0F01727g complement(162226..163440) similar to sp|P38344 Sac...    29   9.3  

>Sklu_2380.2 YMR011W, Contig c2380 4381-6099 reverse complement
          Length = 572

 Score = 1090 bits (2818), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 536/572 (93%), Positives = 536/572 (93%)

Query: 1   MSTSVTPIDNRSVASGKVGASKDSDSALQLNLQTSTPSNKASRDDFDLKPENEHFPEIPQ 60
           MSTSVTPIDNRSVASGKVGASKDSDSALQLNLQTSTPSNKASRDDFDLKPENEHFPEIPQ
Sbjct: 1   MSTSVTPIDNRSVASGKVGASKDSDSALQLNLQTSTPSNKASRDDFDLKPENEHFPEIPQ 60

Query: 61  KKLSEYILVMCLCLMVAFGGFVFGWDTGTISGFVNMTDFKRRFGNYSQSEGTYYLSNVRT 120
           KKLSEYILVMCLCLMVAFGGFVFGWDTGTISGFVNMTDFKRRFGNYSQSEGTYYLSNVRT
Sbjct: 61  KKLSEYILVMCLCLMVAFGGFVFGWDTGTISGFVNMTDFKRRFGNYSQSEGTYYLSNVRT 120

Query: 121 GLIVAIFNIGCAFGGLTLGRLGDIYGRRLGLMCXXXXXXXXXXXXXATGDKWYQYFIGRI 180
           GLIVAIFNIGCAFGGLTLGRLGDIYGRRLGLMC             ATGDKWYQYFIGRI
Sbjct: 121 GLIVAIFNIGCAFGGLTLGRLGDIYGRRLGLMCVVCVYVVGIIIQIATGDKWYQYFIGRI 180

Query: 181 ISGLGVGGIAVLSPTLISETAPKHLRGTCVAFYQLMITLGIFLGYCTNYGTKTYTNSVQW 240
           ISGLGVGGIAVLSPTLISETAPKHLRGTCVAFYQLMITLGIFLGYCTNYGTKTYTNSVQW
Sbjct: 181 ISGLGVGGIAVLSPTLISETAPKHLRGTCVAFYQLMITLGIFLGYCTNYGTKTYTNSVQW 240

Query: 241 RVPLGMCFAWAIFMIAGMLLVPESPRFLIEKGRFEEARRSIAKSNKLTVEDPGVSAEVEL 300
           RVPLGMCFAWAIFMIAGMLLVPESPRFLIEKGRFEEARRSIAKSNKLTVEDPGVSAEVEL
Sbjct: 241 RVPLGMCFAWAIFMIAGMLLVPESPRFLIEKGRFEEARRSIAKSNKLTVEDPGVSAEVEL 300

Query: 301 INAGVEAEKLAGSATWGELFSSKGKILQRVIMGVMIQSLQQLTGNNYFFYYGTTIFQAVG 360
           INAGVEAEKLAGSATWGELFSSKGKILQRVIMGVMIQSLQQLTGNNYFFYYGTTIFQAVG
Sbjct: 301 INAGVEAEKLAGSATWGELFSSKGKILQRVIMGVMIQSLQQLTGNNYFFYYGTTIFQAVG 360

Query: 361 MDDSFQTSIVLGIVNFASTFVGLWTVEKFGRRKCLLWGSASMASCFVVFASVGVTRLWPN 420
           MDDSFQTSIVLGIVNFASTFVGLWTVEKFGRRKCLLWGSASMASCFVVFASVGVTRLWPN
Sbjct: 361 MDDSFQTSIVLGIVNFASTFVGLWTVEKFGRRKCLLWGSASMASCFVVFASVGVTRLWPN 420

Query: 421 GQDQPSSKGAGNCMIVXXXXXXXXXXXXWAPIAYVIVSESYPLRVKNRAMAISVGSNWIW 480
           GQDQPSSKGAGNCMIV            WAPIAYVIVSESYPLRVKNRAMAISVGSNWIW
Sbjct: 421 GQDQPSSKGAGNCMIVFTCFFIFCFATTWAPIAYVIVSESYPLRVKNRAMAISVGSNWIW 480

Query: 481 GFLIGFFTPFITSAINFYYGYVFMGCLXXXXXXXXXXXCETKGLTLEEVNEMYEEGVLPW 540
           GFLIGFFTPFITSAINFYYGYVFMGCL           CETKGLTLEEVNEMYEEGVLPW
Sbjct: 481 GFLIGFFTPFITSAINFYYGYVFMGCLVFSYFYVFFFVCETKGLTLEEVNEMYEEGVLPW 540

Query: 541 KSDSWLPAGRRGTDYNTEEAHTDDKPLYKRFL 572
           KSDSWLPAGRRGTDYNTEEAHTDDKPLYKRFL
Sbjct: 541 KSDSWLPAGRRGTDYNTEEAHTDDKPLYKRFL 572

>Kwal_14.854
          Length = 570

 Score =  865 bits (2235), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 423/573 (73%), Positives = 472/573 (82%), Gaps = 4/573 (0%)

Query: 1   MSTSVTPIDNRSVASGKVGASKDSDSALQLNLQTSTPSNKASRDDFDLKPENE-HFPEIP 59
           MS+S TP+++RS ++ ++ A     S    + Q+ TPSNK S D F  K  +     EIP
Sbjct: 1   MSSSATPMNDRSNSNTELAAV---SSPTDFDSQSRTPSNKLSEDGFATKTTSPLENNEIP 57

Query: 60  QKKLSEYILVMCLCLMVAFGGFVFGWDTGTISGFVNMTDFKRRFGNYSQSEGTYYLSNVR 119
           QK LSEYILVMCLCLMVAFGGFVFGWDTGTISGFVNMTDFKRRFGN+   E  Y LS+VR
Sbjct: 58  QKPLSEYILVMCLCLMVAFGGFVFGWDTGTISGFVNMTDFKRRFGNFDVGEQKYVLSDVR 117

Query: 120 TGLIVAIFNIGCAFGGLTLGRLGDIYGRRLGLMCXXXXXXXXXXXXXATGDKWYQYFIGR 179
           TGLIV+IFNIGCA GGLTLGRLGD+YGRRLGLM              A+ +KWYQYFIGR
Sbjct: 118 TGLIVSIFNIGCAIGGLTLGRLGDMYGRRLGLMAVILVYVVGIIIQIASSNKWYQYFIGR 177

Query: 180 IISGLGVGGIAVLSPTLISETAPKHLRGTCVAFYQLMITLGIFLGYCTNYGTKTYTNSVQ 239
           I+SGLGVGGIAVLSPTLISETAPKHLRGTCV+FYQLMITLGIF+GYCTNYGTKTY+N+VQ
Sbjct: 178 IVSGLGVGGIAVLSPTLISETAPKHLRGTCVSFYQLMITLGIFMGYCTNYGTKTYSNAVQ 237

Query: 240 WRVPLGMCFAWAIFMIAGMLLVPESPRFLIEKGRFEEARRSIAKSNKLTVEDPGVSAEVE 299
           W++PLG+CF WAIFMIAGM+ VPESPR+LIEKG FEEA+RSIAKSNKLTVED GV AEVE
Sbjct: 238 WKLPLGLCFLWAIFMIAGMIFVPESPRYLIEKGNFEEAKRSIAKSNKLTVEDSGVLAEVE 297

Query: 300 LINAGVEAEKLAGSATWGELFSSKGKILQRVIMGVMIQSLQQLTGNNYFFYYGTTIFQAV 359
           LINAGVEAEKLAG+A+WGELFS KGKILQRVIMG +IQSLQQLTGNNYFFYYGTTIF AV
Sbjct: 298 LINAGVEAEKLAGNASWGELFSPKGKILQRVIMGCVIQSLQQLTGNNYFFYYGTTIFDAV 357

Query: 360 GMDDSFQTSIVLGIVNFASTFVGLWTVEKFGRRKCLLWGSASMASCFVVFASVGVTRLWP 419
           GM DSFQTSIVLG+VNFASTFVGL+TVE++GRRKCLLWGSA+M+ CFVVFASVGVT+L+P
Sbjct: 358 GMKDSFQTSIVLGVVNFASTFVGLYTVERYGRRKCLLWGSAAMSVCFVVFASVGVTKLYP 417

Query: 420 NGQDQPSSKGAGNCMIVXXXXXXXXXXXXWAPIAYVIVSESYPLRVKNRAMAISVGSNWI 479
           NG+D PSSK AGN MI             WAPIAYVIVSE+YPLRVKNRAMA++VGSNWI
Sbjct: 418 NGKDMPSSKSAGNAMIFFTCLFIFFFATTWAPIAYVIVSETYPLRVKNRAMAMAVGSNWI 477

Query: 480 WGFLIGFFTPFITSAINFYYGYVFMGCLXXXXXXXXXXXCETKGLTLEEVNEMYEEGVLP 539
           WGF IGF TPFITSAI FYYGYVFMGCL           CETKGLTLEEVNEMY+EGVLP
Sbjct: 478 WGFAIGFGTPFITSAIGFYYGYVFMGCLVFSFFYVFFFVCETKGLTLEEVNEMYQEGVLP 537

Query: 540 WKSDSWLPAGRRGTDYNTEEAHTDDKPLYKRFL 572
           WKS++W+PA RR   Y+  E   D KP YKRF+
Sbjct: 538 WKSETWVPALRRNESYDVNETQEDSKPFYKRFI 570

>CAGL0I00286g complement(20521..22188) highly similar to sp|P23585
           Saccharomyces cerevisiae YMR011w HXT2 or sp|P39003
           Saccharomyces cerevisiae YDR343c HXT6 or sp|P39004
           Saccharomyces cerevisiae YDR342c HXT7, hypothetical
           start
          Length = 555

 Score =  830 bits (2144), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 406/542 (74%), Positives = 450/542 (83%), Gaps = 3/542 (0%)

Query: 33  QTSTPSNKASRDDFDLKPENEHF--PEIPQKKLSEYILVMCLCLMVAFGGFVFGWDTGTI 90
           +  TP  K   +DF LK +       EIP+K L  Y  VMCLCLM+AFGGFVFGWDTGTI
Sbjct: 15  ERQTPETKLEGEDFQLKADEASIQGAEIPRKPLGAYWTVMCLCLMIAFGGFVFGWDTGTI 74

Query: 91  SGFVNMTDFKRRFGNYSQSEGTYYLSNVRTGLIVAIFNIGCAFGGLTLGRLGDIYGRRLG 150
           SGFV  TDFKRRFG    S+GTYYLSNVRTGLIVAIFNIGCAFGGLTLGR GD+YGR+ G
Sbjct: 75  SGFVAQTDFKRRFGQ-RHSDGTYYLSNVRTGLIVAIFNIGCAFGGLTLGRTGDLYGRKKG 133

Query: 151 LMCXXXXXXXXXXXXXATGDKWYQYFIGRIISGLGVGGIAVLSPTLISETAPKHLRGTCV 210
           L+              A+ DKWYQYFIGRIISGLGVGGIAVLSPTLISETAPKHLRGTCV
Sbjct: 134 LVIVVSVYVVGIIIQIASVDKWYQYFIGRIISGLGVGGIAVLSPTLISETAPKHLRGTCV 193

Query: 211 AFYQLMITLGIFLGYCTNYGTKTYTNSVQWRVPLGMCFAWAIFMIAGMLLVPESPRFLIE 270
           +FYQLMITLGIFLGYCTNYGTK Y+NSVQWRVPLG+CFAWA+FMI GM +VPESPRFL+E
Sbjct: 194 SFYQLMITLGIFLGYCTNYGTKNYSNSVQWRVPLGLCFAWALFMIGGMSMVPESPRFLVE 253

Query: 271 KGRFEEARRSIAKSNKLTVEDPGVSAEVELINAGVEAEKLAGSATWGELFSSKGKILQRV 330
           KGR EEARRSIA SNKL+++DPGV+ E++ I+AGVEAE+LAGSA+WGELFS+KGKIL RV
Sbjct: 254 KGRLEEARRSIAISNKLSMDDPGVTFELDTISAGVEAERLAGSASWGELFSNKGKILPRV 313

Query: 331 IMGVMIQSLQQLTGNNYFFYYGTTIFQAVGMDDSFQTSIVLGIVNFASTFVGLWTVEKFG 390
           IMGVMIQSLQQLTGNNYFFYYGTTIF+AVG++DSFQTSIVLGIVNFASTFVGLWTVE+FG
Sbjct: 314 IMGVMIQSLQQLTGNNYFFYYGTTIFKAVGLEDSFQTSIVLGIVNFASTFVGLWTVERFG 373

Query: 391 RRKCLLWGSASMASCFVVFASVGVTRLWPNGQDQPSSKGAGNCMIVXXXXXXXXXXXXWA 450
           RR+CLLWGSA+MA+CFV+FASVGV  L+P+G+D  SSKGAGNCMIV            WA
Sbjct: 374 RRRCLLWGSATMAACFVIFASVGVKSLYPHGRDHASSKGAGNCMIVFTCFFIFCFATTWA 433

Query: 451 PIAYVIVSESYPLRVKNRAMAISVGSNWIWGFLIGFFTPFITSAINFYYGYVFMGCLXXX 510
           PIAYVIVSE+YPLRVKNRAMAI+VGSNWIWGFLIGFFTPFITSAINF YGYVFMGCL   
Sbjct: 434 PIAYVIVSETYPLRVKNRAMAIAVGSNWIWGFLIGFFTPFITSAINFSYGYVFMGCLVFS 493

Query: 511 XXXXXXXXCETKGLTLEEVNEMYEEGVLPWKSDSWLPAGRRGTDYNTEEAHTDDKPLYKR 570
                   CETKGLTLEEVN+MYEEGVLPWKS +W+P  RR   Y+ +    DDKP YKR
Sbjct: 494 YFYVFFFVCETKGLTLEEVNDMYEEGVLPWKSPNWVPPSRRDASYDIDAMMHDDKPWYKR 553

Query: 571 FL 572
           FL
Sbjct: 554 FL 555

>CAGL0D02662g complement(278099..279793) highly similar to sp|P23585
           Saccharomyces cerevisiae YMR011w HXT2 high-affinity
           hexose transporter, start by similarity
          Length = 564

 Score =  803 bits (2073), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 392/570 (68%), Positives = 455/570 (79%), Gaps = 18/570 (3%)

Query: 2   STSVTPIDNRSVASGKVGASKDSDSALQLNLQTSTPSNKASRDDFDLKPENEHFPEIPQK 61
           S   +P+   +VA+    + KD D  L+          K + D   + PE E     P K
Sbjct: 12  SAENSPVREVNVAN----SFKDDDFILE---------QKQTADVSAMSPEAEA----PPK 54

Query: 62  KLSEYILVMCLCLMVAFGGFVFGWDTGTISGFVNMTDFKRRFGNYSQSEGTYYLSNVRTG 121
            +S Y  V+CLCLM+AFGGFVFGWDTGTISGFV  TDFKRRFG  + ++G+YYLS+VRTG
Sbjct: 55  PISAYFTVICLCLMIAFGGFVFGWDTGTISGFVAQTDFKRRFGQQA-ADGSYYLSDVRTG 113

Query: 122 LIVAIFNIGCAFGGLTLGRLGDIYGRRLGLMCXXXXXXXXXXXXXATGDKWYQYFIGRII 181
           LIVAIFNIGCA GGLTLGRLGD+YGRRLGLM              ++   WYQYF+GRI+
Sbjct: 114 LIVAIFNIGCAIGGLTLGRLGDMYGRRLGLMAVITVYVVGIVIQISSTTTWYQYFVGRIV 173

Query: 182 SGLGVGGIAVLSPTLISETAPKHLRGTCVAFYQLMITLGIFLGYCTNYGTKTYTNSVQWR 241
           SGLGVGGIAVLSPTLISETAPKHLRGTCV+FYQLMITLGIFLGYCTNYGTKT+TNS+QWR
Sbjct: 174 SGLGVGGIAVLSPTLISETAPKHLRGTCVSFYQLMITLGIFLGYCTNYGTKTHTNSIQWR 233

Query: 242 VPLGMCFAWAIFMIAGMLLVPESPRFLIEKGRFEEARRSIAKSNKLTVEDPGVSAEVELI 301
           VPLG+CFAWA+FM+ GM +VPESPRFL+EKGRFEEARRS+A+SNK++++DP V+AE+E I
Sbjct: 234 VPLGLCFAWALFMLVGMSMVPESPRFLVEKGRFEEARRSLARSNKVSMDDPIVTAEIENI 293

Query: 302 NAGVEAEKLAGSATWGELFSSKGKILQRVIMGVMIQSLQQLTGNNYFFYYGTTIFQAVGM 361
           +AGVEAEK AG+A+WGELFS+KGKILQRV+MG+MIQSLQQLTG NYFFYYGTTIF+AVG+
Sbjct: 294 SAGVEAEKSAGNASWGELFSTKGKILQRVVMGIMIQSLQQLTGCNYFFYYGTTIFKAVGL 353

Query: 362 DDSFQTSIVLGIVNFASTFVGLWTVEKFGRRKCLLWGSASMASCFVVFASVGVTRLWPNG 421
           +DSFQTSI+LGIVNFASTFV L+ V++FGRRKCLLWGS++MA C V+FASVGV  L+PNG
Sbjct: 354 EDSFQTSIILGIVNFASTFVALYVVDRFGRRKCLLWGSSTMAVCMVIFASVGVKSLYPNG 413

Query: 422 QDQPSSKGAGNCMIVXXXXXXXXXXXXWAPIAYVIVSESYPLRVKNRAMAISVGSNWIWG 481
           +DQPSS  AGN MIV            WAP AYVIV+E+YPLRVKNRAMAI+VG NWIWG
Sbjct: 414 KDQPSSTTAGNVMIVFTCLYIFCFATTWAPTAYVIVAETYPLRVKNRAMAIAVGFNWIWG 473

Query: 482 FLIGFFTPFITSAINFYYGYVFMGCLXXXXXXXXXXXCETKGLTLEEVNEMYEEGVLPWK 541
           FLIGFFTPFIT+AINFYYGYVFMGCL           CETKGLTLEEVNEMYEEGVLPWK
Sbjct: 474 FLIGFFTPFITTAINFYYGYVFMGCLVFSFFYVFFFVCETKGLTLEEVNEMYEEGVLPWK 533

Query: 542 SDSWLPAGRRGTDYNTEEAHTDDKPLYKRF 571
           S  WLP  +R + Y+ + A  DDKP YKRF
Sbjct: 534 SAQWLPTTKRTSGYDVDAALHDDKPWYKRF 563

>CAGL0D02640g 274285..275979 highly similar to sp|P23585
           Saccharomyces cerevisiae YMR011w HXT2 high-affinity
           hexose transporter, start by similarity
          Length = 564

 Score =  803 bits (2073), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 392/570 (68%), Positives = 455/570 (79%), Gaps = 18/570 (3%)

Query: 2   STSVTPIDNRSVASGKVGASKDSDSALQLNLQTSTPSNKASRDDFDLKPENEHFPEIPQK 61
           S   +P+   +VA+    + KD D  L+          K + D   + PE E     P K
Sbjct: 12  SAENSPVREVNVAN----SFKDDDFILE---------QKQTADVSAMSPEAEA----PPK 54

Query: 62  KLSEYILVMCLCLMVAFGGFVFGWDTGTISGFVNMTDFKRRFGNYSQSEGTYYLSNVRTG 121
            +S Y  V+CLCLM+AFGGFVFGWDTGTISGFV  TDFKRRFG  + ++G+YYLS+VRTG
Sbjct: 55  PISAYFTVICLCLMIAFGGFVFGWDTGTISGFVAQTDFKRRFGQQA-ADGSYYLSDVRTG 113

Query: 122 LIVAIFNIGCAFGGLTLGRLGDIYGRRLGLMCXXXXXXXXXXXXXATGDKWYQYFIGRII 181
           LIVAIFNIGCA GGLTLGRLGD+YGRRLGLM              ++   WYQYF+GRI+
Sbjct: 114 LIVAIFNIGCAIGGLTLGRLGDMYGRRLGLMAVITVYVVGIVIQISSTTTWYQYFVGRIV 173

Query: 182 SGLGVGGIAVLSPTLISETAPKHLRGTCVAFYQLMITLGIFLGYCTNYGTKTYTNSVQWR 241
           SGLGVGGIAVLSPTLISETAPKHLRGTCV+FYQLMITLGIFLGYCTNYGTKT+TNS+QWR
Sbjct: 174 SGLGVGGIAVLSPTLISETAPKHLRGTCVSFYQLMITLGIFLGYCTNYGTKTHTNSIQWR 233

Query: 242 VPLGMCFAWAIFMIAGMLLVPESPRFLIEKGRFEEARRSIAKSNKLTVEDPGVSAEVELI 301
           VPLG+CFAWA+FM+ GM +VPESPRFL+EKGRFEEARRS+A+SNK++++DP V+AE+E I
Sbjct: 234 VPLGLCFAWALFMLVGMSMVPESPRFLVEKGRFEEARRSLARSNKVSMDDPIVTAEIENI 293

Query: 302 NAGVEAEKLAGSATWGELFSSKGKILQRVIMGVMIQSLQQLTGNNYFFYYGTTIFQAVGM 361
           +AGVEAEK AG+A+WGELFS+KGKILQRV+MG+MIQSLQQLTG NYFFYYGTTIF+AVG+
Sbjct: 294 SAGVEAEKSAGNASWGELFSTKGKILQRVVMGIMIQSLQQLTGCNYFFYYGTTIFKAVGL 353

Query: 362 DDSFQTSIVLGIVNFASTFVGLWTVEKFGRRKCLLWGSASMASCFVVFASVGVTRLWPNG 421
           +DSFQTSI+LGIVNFASTFV L+ V++FGRRKCLLWGS++MA C V+FASVGV  L+PNG
Sbjct: 354 EDSFQTSIILGIVNFASTFVALYVVDRFGRRKCLLWGSSTMAVCMVIFASVGVKSLYPNG 413

Query: 422 QDQPSSKGAGNCMIVXXXXXXXXXXXXWAPIAYVIVSESYPLRVKNRAMAISVGSNWIWG 481
           +DQPSS  AGN MIV            WAP AYVIV+E+YPLRVKNRAMAI+VG NWIWG
Sbjct: 414 KDQPSSTTAGNVMIVFTCLYIFCFATTWAPTAYVIVAETYPLRVKNRAMAIAVGFNWIWG 473

Query: 482 FLIGFFTPFITSAINFYYGYVFMGCLXXXXXXXXXXXCETKGLTLEEVNEMYEEGVLPWK 541
           FLIGFFTPFIT+AINFYYGYVFMGCL           CETKGLTLEEVNEMYEEGVLPWK
Sbjct: 474 FLIGFFTPFITTAINFYYGYVFMGCLVFSFFYVFFFVCETKGLTLEEVNEMYEEGVLPWK 533

Query: 542 SDSWLPAGRRGTDYNTEEAHTDDKPLYKRF 571
           S  WLP  +R + Y+ + A  DDKP YKRF
Sbjct: 534 SAQWLPTTKRTSGYDVDAALHDDKPWYKRF 563

>Sklu_2376.5 , Contig c2376 9071-10810 reverse complement
          Length = 579

 Score =  798 bits (2061), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 385/572 (67%), Positives = 451/572 (78%), Gaps = 10/572 (1%)

Query: 2   STSVTPIDNRSVASGKVGASKDSDSALQLNLQTSTPSNKASRDDFD-LKPENEHFPEIPQ 60
           S  VTP  + S         ++S ++  +N   +        D+FD L+   E   ++ +
Sbjct: 17  SQEVTPSKSESF-------DQNSHNSRIMNAPEAKGGQMGDEDEFDELQKAAEE--QLAK 67

Query: 61  KKLSEYILVMCLCLMVAFGGFVFGWDTGTISGFVNMTDFKRRFGNYSQSEGTYYLSNVRT 120
           K  SEY+ V   C+MVAFGGFVFGWDTGTISGFVNM+DFKRRFG Y  S GTYYLS+VR 
Sbjct: 68  KGTSEYLFVSICCVMVAFGGFVFGWDTGTISGFVNMSDFKRRFGQYKHSTGTYYLSDVRV 127

Query: 121 GLIVAIFNIGCAFGGLTLGRLGDIYGRRLGLMCXXXXXXXXXXXXXATGDKWYQYFIGRI 180
           GLIVAIFNIGCA GG+ L ++G++YGRR+GLM              A+ DKWYQYFIGRI
Sbjct: 128 GLIVAIFNIGCAIGGVVLSKIGEVYGRRIGLMAVVVIYIIGIIIQIASIDKWYQYFIGRI 187

Query: 181 ISGLGVGGIAVLSPTLISETAPKHLRGTCVAFYQLMITLGIFLGYCTNYGTKTYTNSVQW 240
           ISGLGVGGI VLSP LISETAPKHLRGT +A YQLMIT GIFLGYCTNYGTK Y NSVQW
Sbjct: 188 ISGLGVGGITVLSPMLISETAPKHLRGTLIASYQLMITAGIFLGYCTNYGTKNYENSVQW 247

Query: 241 RVPLGMCFAWAIFMIAGMLLVPESPRFLIEKGRFEEARRSIAKSNKLTVEDPGVSAEVEL 300
           RVPLG+CFAWAIFMI GML VPESPR+L+E G+ EEA+RSIA+SNK+T+EDP V  EV++
Sbjct: 248 RVPLGLCFAWAIFMITGMLFVPESPRYLVEAGKIEEAKRSIARSNKVTIEDPAVQTEVDM 307

Query: 301 INAGVEAEKLAGSATWGELFSSKGKILQRVIMGVMIQSLQQLTGNNYFFYYGTTIFQAVG 360
           I AGVEAEKLAGSA+W ELFS+K K+LQR+IMG+MIQSLQQLTG+NYFFYYGTTIF++VG
Sbjct: 308 ICAGVEAEKLAGSASWSELFSAKTKVLQRLIMGIMIQSLQQLTGDNYFFYYGTTIFKSVG 367

Query: 361 MDDSFQTSIVLGIVNFASTFVGLWTVEKFGRRKCLLWGSASMASCFVVFASVGVTRLWPN 420
           M+DSF+TSIV+GIVNFASTF  L+TV+KFGRRKC+LWG+++M +CFVVFASVGVTRLWPN
Sbjct: 368 MEDSFETSIVIGIVNFASTFFSLYTVDKFGRRKCMLWGASTMVACFVVFASVGVTRLWPN 427

Query: 421 GQDQPSSKGAGNCMIVXXXXXXXXXXXXWAPIAYVIVSESYPLRVKNRAMAISVGSNWIW 480
           GQDQPSSKGAGNCMIV            WAPIAYVIV+ES+PLRVK++ MAI+  SNW+W
Sbjct: 428 GQDQPSSKGAGNCMIVFTCFYIFCFATTWAPIAYVIVAESFPLRVKSKGMAIATASNWLW 487

Query: 481 GFLIGFFTPFITSAINFYYGYVFMGCLXXXXXXXXXXXCETKGLTLEEVNEMYEEGVLPW 540
           GFLIGFFTPFITSAINFYYGYVFMGCL            ETKGLTLEEVNEM+EEGVLPW
Sbjct: 488 GFLIGFFTPFITSAINFYYGYVFMGCLVFAYFYVFFFVPETKGLTLEEVNEMWEEGVLPW 547

Query: 541 KSDSWLPAGRRGTDYNTEEAHTDDKPLYKRFL 572
           KS SW+P+ RRG DYN ++   D+KP +KR +
Sbjct: 548 KSSSWIPSSRRGADYNADDLQHDEKPWFKRMM 579

>Sklu_2362.1 YDR342C, Contig c2362 924-2642
          Length = 572

 Score =  795 bits (2053), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 387/562 (68%), Positives = 443/562 (78%), Gaps = 8/562 (1%)

Query: 19  GASKDSDSALQLNL----QTSTPSNKASRDDF-DLK-PEN--EHFPEIPQKKLSEYILVM 70
            A +D+   L  NL    Q STPSNKASRDD  D++ PE   E   EIP K  S YI V 
Sbjct: 11  AAGQDTPVDLHSNLSEVSQLSTPSNKASRDDLKDVRFPEEATEKVNEIPAKPTSAYITVC 70

Query: 71  CLCLMVAFGGFVFGWDTGTISGFVNMTDFKRRFGNYSQSEGTYYLSNVRTGLIVAIFNIG 130
            LCL VAFGGFVFGWDTGTISGFVN TDFKRRFG ++   G YYLSNVRTGL+V IFNIG
Sbjct: 71  LLCLCVAFGGFVFGWDTGTISGFVNQTDFKRRFGQHNHKTGGYYLSNVRTGLLVGIFNIG 130

Query: 131 CAFGGLTLGRLGDIYGRRLGLMCXXXXXXXXXXXXXATGDKWYQYFIGRIISGLGVGGIA 190
           CA GG+ L ++GD+YGRR+GLM              A  DKWYQYFIGRIISGLGVGGIA
Sbjct: 131 CAIGGIILSKIGDLYGRRIGLMSVILVYVVSVIISIAASDKWYQYFIGRIISGLGVGGIA 190

Query: 191 VLSPTLISETAPKHLRGTCVAFYQLMITLGIFLGYCTNYGTKTYTNSVQWRVPLGMCFAW 250
           VL+P LISETAPKHLRGT V+ YQLMIT GIFLGYCTNYGTK Y NSVQWRVPLG+ FAW
Sbjct: 191 VLAPMLISETAPKHLRGTLVSCYQLMITAGIFLGYCTNYGTKNYDNSVQWRVPLGLGFAW 250

Query: 251 AIFMIAGMLLVPESPRFLIEKGRFEEARRSIAKSNKLTVEDPGVSAEVELINAGVEAEKL 310
           A+F+IAGM+ VPESPR+L+E G+ EEARRS+A+SNK+T+EDPGV AEV+LI AGVEAEKL
Sbjct: 251 ALFVIAGMMFVPESPRYLVEVGKIEEARRSVARSNKVTIEDPGVQAEVDLITAGVEAEKL 310

Query: 311 AGSATWGELFSSKGKILQRVIMGVMIQSLQQLTGNNYFFYYGTTIFQAVGMDDSFQTSIV 370
           +GSA+W ELFS+K K+LQR+IMG M+Q LQQLTGNNYFFYYGTTIF++VG+ DSFQTSIV
Sbjct: 311 SGSASWSELFSTKTKVLQRLIMGAMLQCLQQLTGNNYFFYYGTTIFKSVGLTDSFQTSIV 370

Query: 371 LGIVNFASTFVGLWTVEKFGRRKCLLWGSASMASCFVVFASVGVTRLWPNGQDQPSSKGA 430
           +G+VNFASTFVG++ VEKFGRRKCLLWG+ASM  C VV+ASVGVTRLWPNG+DQPSSKGA
Sbjct: 371 IGVVNFASTFVGIYVVEKFGRRKCLLWGAASMMVCMVVYASVGVTRLWPNGEDQPSSKGA 430

Query: 431 GNCMIVXXXXXXXXXXXXWAPIAYVIVSESYPLRVKNRAMAISVGSNWIWGFLIGFFTPF 490
           GNCMIV            WAPIA+V+ +ES+PLRVK++ MAI+  SNWIWGFLI FFTPF
Sbjct: 431 GNCMIVFTCFYIFCYATTWAPIAWVVTAESFPLRVKSKCMAIASASNWIWGFLIAFFTPF 490

Query: 491 ITSAINFYYGYVFMGCLXXXXXXXXXXXCETKGLTLEEVNEMYEEGVLPWKSDSWLPAGR 550
           ITSAINFYYGYVFMGCL            ETKGLTLEE+ E++EEGVLPWKS SW+P  +
Sbjct: 491 ITSAINFYYGYVFMGCLVFMYFYVFFFVPETKGLTLEEIQELWEEGVLPWKSASWVPPSK 550

Query: 551 RGTDYNTEEAHTDDKPLYKRFL 572
           R   Y+ E    DDKP YKR +
Sbjct: 551 RDKGYDVEALQHDDKPWYKRVM 572

>YMR011W (HXT2) [3975] chr13 (288078..289703) High-affinity hexose
           transporter, member of the hexose transport family of
           the major facilitator superfamily (MFS) [1626 bp, 541
           aa]
          Length = 541

 Score =  786 bits (2029), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 382/535 (71%), Positives = 441/535 (82%), Gaps = 2/535 (0%)

Query: 21  SKDSDSALQLNLQTSTPSNKASRDDFDLKPENEHF-PEIPQKKLSEYILVMCLCLMVAFG 79
           S+    + Q ++ ++    K   D+  ++ ++E+   E+P K ++ Y  V+CLCLM+AFG
Sbjct: 7   SRVESGSQQTSIHSTPIVQKLETDESPIQTKSEYTNAELPAKPIAAYWTVICLCLMIAFG 66

Query: 80  GFVFGWDTGTISGFVNMTDFKRRFGNYSQSEGTYYLSNVRTGLIVAIFNIGCAFGGLTLG 139
           GFVFGWDTGTISGFVN TDFKRRFG   +S+GTYYLS+VRTGLIV IFNIGCAFGGLTLG
Sbjct: 67  GFVFGWDTGTISGFVNQTDFKRRFGQM-KSDGTYYLSDVRTGLIVGIFNIGCAFGGLTLG 125

Query: 140 RLGDIYGRRLGLMCXXXXXXXXXXXXXATGDKWYQYFIGRIISGLGVGGIAVLSPTLISE 199
           RLGD+YGRR+GLMC             A+ DKWYQYFIGRIISG+GVGGIAVLSPTLISE
Sbjct: 126 RLGDMYGRRIGLMCVVLVYIVGIVIQIASSDKWYQYFIGRIISGMGVGGIAVLSPTLISE 185

Query: 200 TAPKHLRGTCVAFYQLMITLGIFLGYCTNYGTKTYTNSVQWRVPLGMCFAWAIFMIAGML 259
           TAPKH+RGTCV+FYQLMITLGIFLGYCTNYGTK Y+NSVQWRVPLG+ FA+AIFMIAGML
Sbjct: 186 TAPKHIRGTCVSFYQLMITLGIFLGYCTNYGTKDYSNSVQWRVPLGLNFAFAIFMIAGML 245

Query: 260 LVPESPRFLIEKGRFEEARRSIAKSNKLTVEDPGVSAEVELINAGVEAEKLAGSATWGEL 319
           +VPESPRFL+EKGR+E+A+RS+AKSNK+T+EDP + AE++ I A VE E+LAG+A+WGEL
Sbjct: 246 MVPESPRFLVEKGRYEDAKRSLAKSNKVTIEDPSIVAEMDTIMANVETERLAGNASWGEL 305

Query: 320 FSSKGKILQRVIMGVMIQSLQQLTGNNYFFYYGTTIFQAVGMDDSFQTSIVLGIVNFAST 379
           FS+KG IL RVIMG+MIQSLQQLTGNNYFFYYGTTIF AVGM DSFQTSIVLGIVNFAST
Sbjct: 306 FSNKGAILPRVIMGIMIQSLQQLTGNNYFFYYGTTIFNAVGMKDSFQTSIVLGIVNFAST 365

Query: 380 FVGLWTVEKFGRRKCLLWGSASMASCFVVFASVGVTRLWPNGQDQPSSKGAGNCMIVXXX 439
           FV L+TV+KFGRRKCLL GSASMA CFV+F++VGVT L+PNG+DQPSSK AGN MIV   
Sbjct: 366 FVALYTVDKFGRRKCLLGGSASMAICFVIFSTVGVTSLYPNGKDQPSSKAAGNVMIVFTC 425

Query: 440 XXXXXXXXXWAPIAYVIVSESYPLRVKNRAMAISVGSNWIWGFLIGFFTPFITSAINFYY 499
                    WAPIAYVIV+ESYPLRVKNRAMAI+VG+NWIWGFLIGFFTPFITSAI F Y
Sbjct: 426 LFIFFFAISWAPIAYVIVAESYPLRVKNRAMAIAVGANWIWGFLIGFFTPFITSAIGFSY 485

Query: 500 GYVFMGCLXXXXXXXXXXXCETKGLTLEEVNEMYEEGVLPWKSDSWLPAGRRGTD 554
           GYVFMGCL           CETKGLTLEEVNEMY EGV PWKS SW+   +R ++
Sbjct: 486 GYVFMGCLVFSFFYVFFFVCETKGLTLEEVNEMYVEGVKPWKSGSWISKEKRVSE 540

>Kwal_55.20075
          Length = 571

 Score =  778 bits (2008), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 376/552 (68%), Positives = 445/552 (80%), Gaps = 6/552 (1%)

Query: 26  SALQLNLQTSTPSNKASRDDF---DLKPENEHFPEIPQKKLSEYILVMCLCLMVAFGGFV 82
           SA+    Q STPSNKASRDD        + E    IP+K  S YI V+ LCL VAFGGFV
Sbjct: 21  SAVSQGSQLSTPSNKASRDDLKDAQFYEDAEKEVIIPKKPASAYITVVILCLCVAFGGFV 80

Query: 83  FGWDTGTISGFVNMTDFKRRFGNYSQSEGTYYLSNVRTGLIVAIFNIGCAFGGLTLGRLG 142
           FGWDTGTISGFV  +DFKRRFG  + S+G +YLSNVRTGLIV+IFNIGCAFGG+ L ++G
Sbjct: 81  FGWDTGTISGFVAQSDFKRRFGQ-TNSKGQHYLSNVRTGLIVSIFNIGCAFGGILLSKIG 139

Query: 143 DIYGRRLGLMCXXXXXXXXXXXXXATGDKWYQYFIGRIISGLGVGGIAVLSPTLISETAP 202
           D++GRR+GLM              A+ DKWYQYFIGRIISGLGVGGIAVLSP LISETAP
Sbjct: 140 DVWGRRIGLMAVVVVYVVGIIIQIASQDKWYQYFIGRIISGLGVGGIAVLSPMLISETAP 199

Query: 203 KHLRGTCVAFYQLMITLGIFLGYCTNYGTKTYTNSVQWRVPLGMCFAWAIFMIAGMLLVP 262
           KHLRGT VA YQLMIT GIFLGYCTNYG K Y+NS+QWRVPLG+CFAWA+FMI GM+ VP
Sbjct: 200 KHLRGTLVACYQLMITCGIFLGYCTNYGVKNYSNSIQWRVPLGLCFAWALFMIGGMMFVP 259

Query: 263 ESPRFLIEKGRFEEARRSIAKSNKLTVEDPGVSAEVELINAGVEAEKLAGSATWGELFSS 322
           ESPR+L+EKGR E+A+ SIA+SNK++VEDP V  EV+LI+AGVEAEKLAGSA++ ELFS+
Sbjct: 260 ESPRYLVEKGRIEDAKVSIARSNKISVEDPSVQVEVDLISAGVEAEKLAGSASFKELFSA 319

Query: 323 KGKILQRVIMGVMIQSLQQLTGNNYFFYYGTTIFQAVGMDDSFQTSIVLGIVNFASTFVG 382
           K K+LQR+IMG+M+QSLQQLTG+NYFFYYGT IF++VG++DSFQTSI++GIVNFASTFVG
Sbjct: 320 KTKVLQRLIMGIMLQSLQQLTGDNYFFYYGTIIFKSVGLNDSFQTSIIIGIVNFASTFVG 379

Query: 383 LWTVEKFGRRKCLLWGSASMASCFVVFASVGVTRLWPNGQDQP--SSKGAGNCMIVXXXX 440
           ++TVEKFGRR+CLLWG+ASM  CFV++ASVGVTRL+P+G + P  S+KGAGNCMIV    
Sbjct: 380 IFTVEKFGRRRCLLWGAASMVVCFVIYASVGVTRLYPDGANHPQNSNKGAGNCMIVFTCF 439

Query: 441 XXXXXXXXWAPIAYVIVSESYPLRVKNRAMAISVGSNWIWGFLIGFFTPFITSAINFYYG 500
                   WAPIAYV+VSES+PLRVK++AMA++  +NW+WGFLI FFTPFITSAI+FYYG
Sbjct: 440 YIFCFATTWAPIAYVVVSESFPLRVKSKAMALATAANWLWGFLIAFFTPFITSAIHFYYG 499

Query: 501 YVFMGCLXXXXXXXXXXXCETKGLTLEEVNEMYEEGVLPWKSDSWLPAGRRGTDYNTEEA 560
           YVFMGCL            ETKGLTLEEV E++EEGVLPWKS SW+P+  RG +YN E+ 
Sbjct: 500 YVFMGCLVFAYFYVFFFVPETKGLTLEEVQELWEEGVLPWKSTSWVPSSSRGVNYNAEDL 559

Query: 561 HTDDKPLYKRFL 572
             DDKP YKR L
Sbjct: 560 KHDDKPWYKRVL 571

>YDR343C (HXT6) [1171] chr4 complement(1159598..1161310)
           High-affinity hexose transporter, member of the hexose
           transporter family of the major facilitator superfamily
           (MFS), nearly identical to Hxt7p [1713 bp, 570 aa]
          Length = 570

 Score =  774 bits (1999), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 375/541 (69%), Positives = 433/541 (80%), Gaps = 4/541 (0%)

Query: 35  STPSNKASRDDFDLKPE-NEHFP--EIPQKKLSEYILVMCLCLMVAFGGFVFGWDTGTIS 91
           STPSNKA RD+     E  EH P  EIP++  S Y+ V  +C+M+AFGGFVFGWDTGTIS
Sbjct: 28  STPSNKAERDEIKAYGEGEEHEPVVEIPKRPASAYVTVSIMCIMIAFGGFVFGWDTGTIS 87

Query: 92  GFVNMTDFKRRFGNYSQSEGTYYLSNVRTGLIVAIFNIGCAFGGLTLGRLGDIYGRRLGL 151
           GF+N TDF RRFG     +GT YLS VRTGLIV+IFNIGCA GG+ L +LGD+YGR++GL
Sbjct: 88  GFINQTDFIRRFG-MKHKDGTNYLSKVRTGLIVSIFNIGCAIGGIILSKLGDMYGRKVGL 146

Query: 152 MCXXXXXXXXXXXXXATGDKWYQYFIGRIISGLGVGGIAVLSPTLISETAPKHLRGTCVA 211
           +              A+ +KWYQYFIGRIISGLGVGGIAVLSP LISE +PKHLRGT V+
Sbjct: 147 IVVVVIYIIGIIIQIASINKWYQYFIGRIISGLGVGGIAVLSPMLISEVSPKHLRGTLVS 206

Query: 212 FYQLMITLGIFLGYCTNYGTKTYTNSVQWRVPLGMCFAWAIFMIAGMLLVPESPRFLIEK 271
            YQLMIT GIFLGYCTN+GTK Y+NSVQWRVPLG+CFAWA+FMI GM  VPESPR+L E 
Sbjct: 207 CYQLMITAGIFLGYCTNFGTKNYSNSVQWRVPLGLCFAWALFMIGGMTFVPESPRYLAEV 266

Query: 272 GRFEEARRSIAKSNKLTVEDPGVSAEVELINAGVEAEKLAGSATWGELFSSKGKILQRVI 331
           G+ EEA+RSIA SNK+ V+DP V AEVE + AGVEAEKLAG+A+WGELFSSK K+LQR+I
Sbjct: 267 GKIEEAKRSIAVSNKVAVDDPSVLAEVEAVLAGVEAEKLAGNASWGELFSSKTKVLQRLI 326

Query: 332 MGVMIQSLQQLTGNNYFFYYGTTIFQAVGMDDSFQTSIVLGIVNFASTFVGLWTVEKFGR 391
           MG MIQSLQQLTG+NYFFYYGTTIF+AVG+ DSF+TSIVLGIVNFASTFVG++ VE++GR
Sbjct: 327 MGAMIQSLQQLTGDNYFFYYGTTIFKAVGLSDSFETSIVLGIVNFASTFVGIYVVERYGR 386

Query: 392 RKCLLWGSASMASCFVVFASVGVTRLWPNGQDQPSSKGAGNCMIVXXXXXXXXXXXXWAP 451
           R CLLWG+ASM +C VV+ASVGVTRLWPNGQDQPSSKGAGNCMIV            WAP
Sbjct: 387 RTCLLWGAASMTACMVVYASVGVTRLWPNGQDQPSSKGAGNCMIVFACFYIFCFATTWAP 446

Query: 452 IAYVIVSESYPLRVKNRAMAISVGSNWIWGFLIGFFTPFITSAINFYYGYVFMGCLXXXX 511
           I YV+VSE++PLRVK++AM+I+  +NW+WGFLIGFFTPFIT AINFYYGYVFMGCL    
Sbjct: 447 IPYVVVSETFPLRVKSKAMSIATAANWLWGFLIGFFTPFITGAINFYYGYVFMGCLVFMF 506

Query: 512 XXXXXXXCETKGLTLEEVNEMYEEGVLPWKSDSWLPAGRRGTDYNTEEAHTDDKPLYKRF 571
                   ETKGLTLEEVN M+EEGVLPWKS SW+P  RRG +Y+ EE   DDKPLYKR 
Sbjct: 507 FYVLLVVPETKGLTLEEVNTMWEEGVLPWKSASWVPPSRRGANYDAEEMAHDDKPLYKRM 566

Query: 572 L 572
            
Sbjct: 567 F 567

>YDR342C (HXT7) [1170] chr4 complement(1154206..1155918)
           High-affinity hexose transporter, member of the hexose
           transporter family of the major facilitator superfamily
           (MFS), nearly identical to Hxt6p [1713 bp, 570 aa]
          Length = 570

 Score =  774 bits (1998), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 375/541 (69%), Positives = 433/541 (80%), Gaps = 4/541 (0%)

Query: 35  STPSNKASRDDFDLKPE-NEHFP--EIPQKKLSEYILVMCLCLMVAFGGFVFGWDTGTIS 91
           STPSNKA RD+     E  EH P  EIP++  S Y+ V  +C+M+AFGGFVFGWDTGTIS
Sbjct: 28  STPSNKAERDEIKAYGEGEEHEPVVEIPKRPASAYVTVSIMCIMIAFGGFVFGWDTGTIS 87

Query: 92  GFVNMTDFKRRFGNYSQSEGTYYLSNVRTGLIVAIFNIGCAFGGLTLGRLGDIYGRRLGL 151
           GF+N TDF RRFG     +GT YLS VRTGLIV+IFNIGCA GG+ L +LGD+YGR++GL
Sbjct: 88  GFINQTDFIRRFG-MKHKDGTNYLSKVRTGLIVSIFNIGCAIGGIILSKLGDMYGRKVGL 146

Query: 152 MCXXXXXXXXXXXXXATGDKWYQYFIGRIISGLGVGGIAVLSPTLISETAPKHLRGTCVA 211
           +              A+ +KWYQYFIGRIISGLGVGGIAVLSP LISE +PKHLRGT V+
Sbjct: 147 IVVVVIYIIGIIIQIASINKWYQYFIGRIISGLGVGGIAVLSPMLISEVSPKHLRGTLVS 206

Query: 212 FYQLMITLGIFLGYCTNYGTKTYTNSVQWRVPLGMCFAWAIFMIAGMLLVPESPRFLIEK 271
            YQLMIT GIFLGYCTN+GTK Y+NSVQWRVPLG+CFAWA+FMI GM  VPESPR+L E 
Sbjct: 207 CYQLMITAGIFLGYCTNFGTKNYSNSVQWRVPLGLCFAWALFMIGGMTFVPESPRYLAEV 266

Query: 272 GRFEEARRSIAKSNKLTVEDPGVSAEVELINAGVEAEKLAGSATWGELFSSKGKILQRVI 331
           G+ EEA+RSIA SNK+ V+DP V AEVE + AGVEAEKLAG+A+WGELFSSK K+LQR+I
Sbjct: 267 GKIEEAKRSIAVSNKVAVDDPSVLAEVEAVLAGVEAEKLAGNASWGELFSSKTKVLQRLI 326

Query: 332 MGVMIQSLQQLTGNNYFFYYGTTIFQAVGMDDSFQTSIVLGIVNFASTFVGLWTVEKFGR 391
           MG MIQSLQQLTG+NYFFYYGTTIF+AVG+ DSF+TSIVLGIVNFASTFVG++ VE++GR
Sbjct: 327 MGAMIQSLQQLTGDNYFFYYGTTIFKAVGLSDSFETSIVLGIVNFASTFVGIYVVERYGR 386

Query: 392 RKCLLWGSASMASCFVVFASVGVTRLWPNGQDQPSSKGAGNCMIVXXXXXXXXXXXXWAP 451
           R CLLWG+ASM +C VV+ASVGVTRLWPNGQDQPSSKGAGNCMIV            WAP
Sbjct: 387 RTCLLWGAASMTACMVVYASVGVTRLWPNGQDQPSSKGAGNCMIVFACFYIFCFATTWAP 446

Query: 452 IAYVIVSESYPLRVKNRAMAISVGSNWIWGFLIGFFTPFITSAINFYYGYVFMGCLXXXX 511
           I YV+VSE++PLRVK++AM+I+  +NW+WGFLIGFFTPFIT AINFYYGYVFMGCL    
Sbjct: 447 IPYVVVSETFPLRVKSKAMSIATAANWLWGFLIGFFTPFITGAINFYYGYVFMGCLVFMF 506

Query: 512 XXXXXXXCETKGLTLEEVNEMYEEGVLPWKSDSWLPAGRRGTDYNTEEAHTDDKPLYKRF 571
                   ETKGLTLEEVN M+EEGVLPWKS SW+P  RRG +Y+ EE   DDKPLYKR 
Sbjct: 507 FYVLLVVPETKGLTLEEVNTMWEEGVLPWKSASWVPPSRRGANYDAEEMTHDDKPLYKRM 566

Query: 572 L 572
            
Sbjct: 567 F 567

>Sklu_2415.2 YJL214W, Contig c2415 2182-3897 reverse complement
          Length = 571

 Score =  757 bits (1955), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 367/575 (63%), Positives = 441/575 (76%), Gaps = 18/575 (3%)

Query: 2   STSVTPIDNRSVASGKVGASKDSDSALQLNLQTSTPSNKASRDDFD-LK---PENEHFPE 57
           S   TP+++ S+AS        +DS L      STPSNKASR D D LK    E E   E
Sbjct: 11  SAQDTPVESYSLAS--------ADSHL------STPSNKASRADLDELKFQAEETEIVAE 56

Query: 58  IPQKKLSEYILVMCLCLMVAFGGFVFGWDTGTISGFVNMTDFKRRFGNYSQSEGTYYLSN 117
           IP+K  S YI V  +CL VAFGGFV GWDTGTISGFVN TDFKRRFG YS S+  YYLSN
Sbjct: 57  IPKKPASAYITVSIMCLCVAFGGFVVGWDTGTISGFVNQTDFKRRFGEYSHSKDEYYLSN 116

Query: 118 VRTGLIVAIFNIGCAFGGLTLGRLGDIYGRRLGLMCXXXXXXXXXXXXXATGDKWYQYFI 177
           VR GLIV+IFN+GCA GGL L +LGDIYGR +GLM              ++ DKWYQYFI
Sbjct: 117 VRVGLIVSIFNVGCAVGGLVLSKLGDIYGRCIGLMAVTIVYVVGIVIQISSVDKWYQYFI 176

Query: 178 GRIISGLGVGGIAVLSPTLISETAPKHLRGTCVAFYQLMITLGIFLGYCTNYGTKTYTNS 237
           GRI+SGLGVGG+ VL+P LISETAPKHLRGT +A +QLM+T  IFLGYC NYGTK+Y NS
Sbjct: 177 GRIVSGLGVGGVCVLAPMLISETAPKHLRGTLLACWQLMVTFAIFLGYCANYGTKSYDNS 236

Query: 238 VQWRVPLGMCFAWAIFMIAGMLLVPESPRFLIEKGRFEEARRSIAKSNKLTVEDPGVSAE 297
           VQWRVPLG+CFAWAI M+ GM  VPESPRFL++ GR E+A+RS+AKSNK++VEDP V AE
Sbjct: 237 VQWRVPLGLCFAWAIIMVVGMCFVPESPRFLVKVGRVEDAKRSVAKSNKISVEDPAVQAE 296

Query: 298 VELINAGVEAEKLAGSATWGELFSSKGKILQRVIMGVMIQSLQQLTGNNYFFYYGTTIFQ 357
           V+LI AGVE EKLAGS++WGELFS K K+ QR++M VMI SLQQL+G+NYFFYYGTTIF+
Sbjct: 297 VDLIAAGVEVEKLAGSSSWGELFSKKTKVFQRLVMSVMINSLQQLSGDNYFFYYGTTIFK 356

Query: 358 AVGMDDSFQTSIVLGIVNFASTFVGLWTVEKFGRRKCLLWGSASMASCFVVFASVGVTRL 417
           +VGM+DSF+TSIV+GI+NFASTF+ L+T++K GRR+ LLWG+A M  C +++ASVGVTRL
Sbjct: 357 SVGMEDSFETSIVIGIINFASTFLSLYTLDKLGRRRSLLWGAAIMTVCMLIYASVGVTRL 416

Query: 418 WPNGQDQPSSKGAGNCMIVXXXXXXXXXXXXWAPIAYVIVSESYPLRVKNRAMAISVGSN 477
           +P+G+DQPSSK AGNCMIV            W P  YVI+SES+PLRVK++ M+++ G+N
Sbjct: 417 YPDGKDQPSSKPAGNCMIVFTCLYIFFFANTWGPTCYVIISESFPLRVKSKCMSVATGAN 476

Query: 478 WIWGFLIGFFTPFITSAINFYYGYVFMGCLXXXXXXXXXXXCETKGLTLEEVNEMYEEGV 537
           ++WGFLIGFFTPFITSAINFYYGYVFMGCL            ETKGLTLEEV EM+ EGV
Sbjct: 477 YLWGFLIGFFTPFITSAINFYYGYVFMGCLVFSYFYVFFFVPETKGLTLEEVEEMWHEGV 536

Query: 538 LPWKSDSWLPAGRRGTDYNTEEAHTDDKPLYKRFL 572
           LPWKS+SW+P+ RR  +Y+ E+   D+KP YKR L
Sbjct: 537 LPWKSESWVPSSRRDVNYDAEKLQHDEKPWYKRML 571

>Scas_715.50
          Length = 559

 Score =  745 bits (1923), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 355/537 (66%), Positives = 423/537 (78%), Gaps = 8/537 (1%)

Query: 37  PSNKASRDDFDLK---PENEHFPEIPQKKLSEYILVMCLCLMVAFGGFVFGWDTGTISGF 93
           P    S +D  LK    ENE  P    K +S Y  V+CLCLM+AFGGF+FGWD GTI GF
Sbjct: 23  PKQIKSVEDVSLKVKTNENEGAP----KPISAYFTVICLCLMIAFGGFIFGWDIGTIGGF 78

Query: 94  VNMTDFKRRFGNYSQSEGTYYLSNVRTGLIVAIFNIGCAFGGLTLGRLGDIYGRRLGLMC 153
           V  TDFKRRFG  +  EG YYLS+VRTGLIV  FN+GCAFGG+ LGRLGD YGR++GL+C
Sbjct: 79  VGQTDFKRRFGELND-EGEYYLSDVRTGLIVVTFNLGCAFGGIILGRLGDFYGRKIGLVC 137

Query: 154 XXXXXXXXXXXXXATGDKWYQYFIGRIISGLGVGGIAVLSPTLISETAPKHLRGTCVAFY 213
                        ++ + W QYFIGRI+SGLGVGGIAVLSPTLISE APKHLRG C++ Y
Sbjct: 138 VVSVYVVGVVIQISSTNNWIQYFIGRIVSGLGVGGIAVLSPTLISEIAPKHLRGMCISLY 197

Query: 214 QLMITLGIFLGYCTNYGTKTYTNSVQWRVPLGMCFAWAIFMIAGMLLVPESPRFLIEKGR 273
           QLMIT GIF+GYCTNYG+K+YTNS+QWR+PLG+ FAWA+ M+ GM++VPESPR+LIEKG+
Sbjct: 198 QLMITGGIFVGYCTNYGSKSYTNSIQWRMPLGLGFAWALIMVLGMMMVPESPRYLIEKGK 257

Query: 274 FEEARRSIAKSNKLTVEDPGVSAEVELINAGVEAEKLAGSATWGELFSSKGKILQRVIMG 333
           FEEA+RS+AKSNK TV+DP V  E ++INAGVEAE+  G+A+W ELFS+KGK+LQRVIMG
Sbjct: 258 FEEAKRSLAKSNKTTVDDPIVLREFDVINAGVEAERAIGNASWAELFSTKGKVLQRVIMG 317

Query: 334 VMIQSLQQLTGNNYFFYYGTTIFQAVGMDDSFQTSIVLGIVNFASTFVGLWTVEKFGRRK 393
           +M+QSLQQLTG NYFFYYGTTIFQAVGMDDS+ TSIVLG+VNF+STF+ LW+VE+FGRRK
Sbjct: 318 IMVQSLQQLTGCNYFFYYGTTIFQAVGMDDSYVTSIVLGVVNFSSTFISLWSVERFGRRK 377

Query: 394 CLLWGSASMASCFVVFASVGVTRLWPNGQDQPSSKGAGNCMIVXXXXXXXXXXXXWAPIA 453
           CLLWGSASMA CFVVFAS+GVT+L+PNG DQP+SK AGN MIV            WAPIA
Sbjct: 378 CLLWGSASMACCFVVFASMGVTKLYPNGMDQPTSKSAGNVMIVFACLFIFCFAVSWAPIA 437

Query: 454 YVIVSESYPLRVKNRAMAISVGSNWIWGFLIGFFTPFITSAINFYYGYVFMGCLXXXXXX 513
           +V+V+ESYP R+K RAMAI+V +NWIW F IGF TPFITSAINFYYG+VF GCL      
Sbjct: 438 FVVVAESYPQRIKQRAMAIAVAANWIWNFAIGFCTPFITSAINFYYGFVFFGCLIFSFFY 497

Query: 514 XXXXXCETKGLTLEEVNEMYEEGVLPWKSDSWLPAGRRGTDYNTEEAHTDDKPLYKR 570
                CETKGL+LEE NEMYEEG LPWKSD+W+P+ RRG DY+      DD+  +++
Sbjct: 498 IFFFVCETKGLSLEEFNEMYEEGTLPWKSDTWIPSSRRGADYDVHATQNDDQTFFQK 554

>CAGL0A02211g complement(224864..226522) highly similar to sp|P39003
           Saccharomyces cerevisiae YDR343c HXT6 or sp|P39004
           Saccharomyces cerevisiae YDR342c HXT7, hypothetical
           start
          Length = 552

 Score =  742 bits (1916), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 362/553 (65%), Positives = 431/553 (77%), Gaps = 6/553 (1%)

Query: 23  DSDSALQLNLQTSTPSNKASRDD-FDLKPENEHFP--EIPQKKLSEYILVMCLCLMVAFG 79
           D +S  Q  L  S  ++KA R+D F    + E  P  EIP+K  S Y+ +   CL +AFG
Sbjct: 3   DQESRSQSVLSAS--NSKADREDEFKAYVDEEGQPMVEIPKKPASAYVSISIFCLFIAFG 60

Query: 80  GFVFGWDTGTISGFVNMTDFKRRFGNYSQSEGTYYLSNVRTGLIVAIFNIGCAFGGLTLG 139
           GFVFGWDTGTISGFV  TDF RR G  +++ GT+YLS VRTGL+V+IFNIGCA GG+ L 
Sbjct: 61  GFVFGWDTGTISGFVAQTDFIRRLGQ-TRANGTHYLSKVRTGLVVSIFNIGCAIGGIVLS 119

Query: 140 RLGDIYGRRLGLMCXXXXXXXXXXXXXATGDKWYQYFIGRIISGLGVGGIAVLSPTLISE 199
           +LGD+YGR++GL+              AT DKWYQYFIGRIISGLGVGGIAVLSP LISE
Sbjct: 120 KLGDMYGRKIGLISVVVIYIVGIVIQIATIDKWYQYFIGRIISGLGVGGIAVLSPMLISE 179

Query: 200 TAPKHLRGTCVAFYQLMITLGIFLGYCTNYGTKTYTNSVQWRVPLGMCFAWAIFMIAGML 259
            +PKH+RG+ V+ YQLMIT GIFLGYCTNYGTK Y+NSVQWRVPLG+CFAWA+FMI GM 
Sbjct: 180 VSPKHMRGSLVSCYQLMITCGIFLGYCTNYGTKNYSNSVQWRVPLGLCFAWALFMIGGMT 239

Query: 260 LVPESPRFLIEKGRFEEARRSIAKSNKLTVEDPGVSAEVELINAGVEAEKLAGSATWGEL 319
            VPESPR+LIE GR EEARRSIA SNK++ +DP V+ EVE + A VEAE+LAGSA+WGEL
Sbjct: 240 FVPESPRYLIEVGRVEEARRSIAISNKVSPDDPAVTFEVENVQAAVEAERLAGSASWGEL 299

Query: 320 FSSKGKILQRVIMGVMIQSLQQLTGNNYFFYYGTTIFQAVGMDDSFQTSIVLGIVNFAST 379
           FS+K K+ QR+IMG+MIQSLQQLTG+NYFFYYGTT+F+AVG++DSF+TSIV+GIVNFAST
Sbjct: 300 FSTKTKVFQRLIMGIMIQSLQQLTGDNYFFYYGTTVFKAVGLEDSFETSIVIGIVNFAST 359

Query: 380 FVGLWTVEKFGRRKCLLWGSASMASCFVVFASVGVTRLWPNGQDQPSSKGAGNCMIVXXX 439
           FV L+ V++FGRR+CLLWG+A+M +C VVFASVGVTRLWPNGQDQPSSKGAGNCMIV   
Sbjct: 360 FVALYVVDRFGRRRCLLWGAAAMTACMVVFASVGVTRLWPNGQDQPSSKGAGNCMIVFTC 419

Query: 440 XXXXXXXXXWAPIAYVIVSESYPLRVKNRAMAISVGSNWIWGFLIGFFTPFITSAINFYY 499
                    WAPI +V+ SE++PLRVK + MAI+  SNWIWGFLI FFTPFIT+AINFYY
Sbjct: 420 FYIFCFATTWAPIPFVVNSETFPLRVKAKCMAIAQASNWIWGFLIAFFTPFITNAINFYY 479

Query: 500 GYVFMGCLXXXXXXXXXXXCETKGLTLEEVNEMYEEGVLPWKSDSWLPAGRRGTDYNTEE 559
           GYVFMGCL            ETKGLTLEEVN ++EEGVLPWKS +W+P  +R   Y+ + 
Sbjct: 480 GYVFMGCLCFSYFYVFFFIPETKGLTLEEVNTLWEEGVLPWKSPNWVPPSKRDASYDADA 539

Query: 560 AHTDDKPLYKRFL 572
              DDKP YKRF+
Sbjct: 540 MMHDDKPWYKRFV 552

>Scas_541.6
          Length = 573

 Score =  738 bits (1906), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 356/544 (65%), Positives = 422/544 (77%), Gaps = 3/544 (0%)

Query: 31  NLQTSTPSNKASRDDFD--LKPENEHFPEIPQKKLSEYILVMCLCLMVAFGGFVFGWDTG 88
           N   STPSNK  RDD    ++ + +   EIP+K  S Y+ V  +C+M+AFGGFVFGWDTG
Sbjct: 28  NSGMSTPSNKDDRDDVKEYVEEDPQIIAEIPKKPASAYVTVSIMCVMIAFGGFVFGWDTG 87

Query: 89  TISGFVNMTDFKRRFGNYSQSEGTYYLSNVRTGLIVAIFNIGCAFGGLTLGRLGDIYGRR 148
           TISGFV  TDF +RFG +  S G +YLS VR GLIV+IFNIGCA GG+ L +LGDIYGR+
Sbjct: 88  TISGFVAQTDFLQRFGQH-HSNGKHYLSKVRMGLIVSIFNIGCAVGGIILSKLGDIYGRK 146

Query: 149 LGLMCXXXXXXXXXXXXXATGDKWYQYFIGRIISGLGVGGIAVLSPTLISETAPKHLRGT 208
           +GL+              A+   WYQYFIGRIISGLGVGGIAVLSP LISE +PKHLRGT
Sbjct: 147 IGLITVVVIYVIGIIIQIASVKAWYQYFIGRIISGLGVGGIAVLSPMLISEVSPKHLRGT 206

Query: 209 CVAFYQLMITLGIFLGYCTNYGTKTYTNSVQWRVPLGMCFAWAIFMIAGMLLVPESPRFL 268
            V+ YQLMIT GIFLGYCTNYGTK Y+NSVQWRVPLG+CFAWA+FMI GM  VPESPRFL
Sbjct: 207 LVSCYQLMITAGIFLGYCTNYGTKNYSNSVQWRVPLGLCFAWALFMIGGMTFVPESPRFL 266

Query: 269 IEKGRFEEARRSIAKSNKLTVEDPGVSAEVELINAGVEAEKLAGSATWGELFSSKGKILQ 328
           +E GR +EA+RS+A SNK++V+DP V  E+E + AGVEAEKLAG+A+WGE+F +K K+LQ
Sbjct: 267 VEVGRIDEAKRSVAMSNKVSVDDPAVLGELETLQAGVEAEKLAGNASWGEIFQTKTKVLQ 326

Query: 329 RVIMGVMIQSLQQLTGNNYFFYYGTTIFQAVGMDDSFQTSIVLGIVNFASTFVGLWTVEK 388
           R+IMG MIQSLQQLTG+NYFFYYGTT+F +VGM DSF+TSIVLGIVNFASTFVG++ VE+
Sbjct: 327 RLIMGSMIQSLQQLTGDNYFFYYGTTVFTSVGMQDSFETSIVLGIVNFASTFVGIFLVER 386

Query: 389 FGRRKCLLWGSASMASCFVVFASVGVTRLWPNGQDQPSSKGAGNCMIVXXXXXXXXXXXX 448
           +GRR CLLWG+A+M SC VVFASVGVTRLWPNG+D  +SKGAGNCMI             
Sbjct: 387 YGRRTCLLWGAATMTSCMVVFASVGVTRLWPNGKDGEASKGAGNCMICFTCFYLFCFATT 446

Query: 449 WAPIAYVIVSESYPLRVKNRAMAISVGSNWIWGFLIGFFTPFITSAINFYYGYVFMGCLX 508
           WAPI +V+ SE++PLRVK++ M+I+ G NW+WGFLIGFFTPFIT AI+FYYGYVFMGCL 
Sbjct: 447 WAPIPFVVNSETFPLRVKSKCMSITQGCNWLWGFLIGFFTPFITGAIDFYYGYVFMGCLC 506

Query: 509 XXXXXXXXXXCETKGLTLEEVNEMYEEGVLPWKSDSWLPAGRRGTDYNTEEAHTDDKPLY 568
                      ETKGLTLEEVN M+EEGVLPWKS  W+P  RRG +Y+  E   DDKPL+
Sbjct: 507 FSYFYVFFFVPETKGLTLEEVNTMWEEGVLPWKSAEWVPPSRRGENYDVAEMAKDDKPLF 566

Query: 569 KRFL 572
           KR  
Sbjct: 567 KRMF 570

>Scas_658.24
          Length = 570

 Score =  736 bits (1900), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 353/544 (64%), Positives = 420/544 (77%), Gaps = 7/544 (1%)

Query: 35  STPSNKASRDDF-----DLKPE-NEHFPEIPQKKLSEYILVMCLCLMVAFGGFVFGWDTG 88
           STPSNKA RDD      D+  E N    EIP++  S Y+ V  +C+M+AFGGFVFGWDTG
Sbjct: 25  STPSNKAERDDEKYGSDDIDAEVNPEVVEIPKRPASAYVTVSIMCIMIAFGGFVFGWDTG 84

Query: 89  TISGFVNMTDFKRRFGNYSQSEGTYYLSNVRTGLIVAIFNIGCAFGGLTLGRLGDIYGRR 148
           TISGFV  TDF RRFG      GT+YLS VR GL+V+IFNIGCAFGG+ L + GDIYGR+
Sbjct: 85  TISGFVAQTDFLRRFGQ-KHHNGTHYLSKVRMGLMVSIFNIGCAFGGIILAKSGDIYGRK 143

Query: 149 LGLMCXXXXXXXXXXXXXATGDKWYQYFIGRIISGLGVGGIAVLSPTLISETAPKHLRGT 208
           +GL+              A+   WYQYFIGRIISGLGVGGIAVLSP LISE +PKH+RGT
Sbjct: 144 MGLIIVVCIYIVGIVIQIASVKAWYQYFIGRIISGLGVGGIAVLSPMLISEVSPKHMRGT 203

Query: 209 CVAFYQLMITLGIFLGYCTNYGTKTYTNSVQWRVPLGMCFAWAIFMIAGMLLVPESPRFL 268
            V+ YQLMIT GIFLGYCTNYGTK Y+NSVQWRVPLG+CFAWA+FMI GM  VPESPR+L
Sbjct: 204 LVSCYQLMITAGIFLGYCTNYGTKNYSNSVQWRVPLGLCFAWALFMIGGMTFVPESPRYL 263

Query: 269 IEKGRFEEARRSIAKSNKLTVEDPGVSAEVELINAGVEAEKLAGSATWGELFSSKGKILQ 328
           +E G+ EEA+RSIA SNK++ +DP V AEV+ + AGVEAEKLAG+A+WGELF +K KI Q
Sbjct: 264 VEVGKIEEAKRSIALSNKISADDPAVLAEVDNVQAGVEAEKLAGNASWGELFQTKNKIFQ 323

Query: 329 RVIMGVMIQSLQQLTGNNYFFYYGTTIFQAVGMDDSFQTSIVLGIVNFASTFVGLWTVEK 388
           R++MG MIQ LQQLTG+NYFFYYGT +F++VG++DSFQTSIV+G+VNF STF  L+TV++
Sbjct: 324 RLVMGCMIQCLQQLTGDNYFFYYGTIVFKSVGLEDSFQTSIVIGVVNFFSTFFALYTVDR 383

Query: 389 FGRRKCLLWGSASMASCFVVFASVGVTRLWPNGQDQPSSKGAGNCMIVXXXXXXXXXXXX 448
           FGRR+CLLWG+A+   CFV++ASVGVTRL+PNG+DQPSSKGAGNCMIV            
Sbjct: 384 FGRRRCLLWGAATTTVCFVIYASVGVTRLYPNGKDQPSSKGAGNCMIVFTCFYIFCFATT 443

Query: 449 WAPIAYVIVSESYPLRVKNRAMAISVGSNWIWGFLIGFFTPFITSAINFYYGYVFMGCLX 508
           WAPI +VI SE++PLRVK++ M+++ G NW+WGFLI FFTPFIT AINFYYGYVFMGCL 
Sbjct: 444 WAPIPFVINSETFPLRVKSKCMSLAQGCNWLWGFLISFFTPFITGAINFYYGYVFMGCLC 503

Query: 509 XXXXXXXXXXCETKGLTLEEVNEMYEEGVLPWKSDSWLPAGRRGTDYNTEEAHTDDKPLY 568
                      ETKGLTLEEVN M+EEGVLPWKS  W+P  RRG DYN +    D+KPLY
Sbjct: 504 FSFFYVFFFVPETKGLTLEEVNTMWEEGVLPWKSTEWVPPSRRGADYNVDGLTKDEKPLY 563

Query: 569 KRFL 572
           KR  
Sbjct: 564 KRMF 567

>YFL011W (HXT10) [1671] chr6 (112339..113979) Member of the hexose
           transporter family of the major facilitator superfamily
           (MFS) [1641 bp, 546 aa]
          Length = 546

 Score =  734 bits (1896), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 364/529 (68%), Positives = 422/529 (79%), Gaps = 2/529 (0%)

Query: 24  SDSALQLNLQTSTPSNKASRDDFDLKPEN-EHFPEIPQKKLSEYILVMCLCLMVAFGGFV 82
           S S   L       ++ + +D+  L PE  E   +IP K +  Y  VM LCLM+AFGGF+
Sbjct: 3   SSSVSILGTSAKASTSLSRKDEIKLTPETREASLDIPYKPIIAYWTVMGLCLMIAFGGFI 62

Query: 83  FGWDTGTISGFVNMTDFKRRFGNYSQSEGTYYLSNVRTGLIVAIFNIGCAFGGLTLGRLG 142
           FGWDTGTISGF+N TDFKRRFG   Q +G++ LS+VRTGLIV IFNIGCA GGLTLGRLG
Sbjct: 63  FGWDTGTISGFINQTDFKRRFGEL-QRDGSFQLSDVRTGLIVGIFNIGCALGGLTLGRLG 121

Query: 143 DIYGRRLGLMCXXXXXXXXXXXXXATGDKWYQYFIGRIISGLGVGGIAVLSPTLISETAP 202
           DIYGR++GLMC             A+ DKWYQYFIGRI+SG+GVGG+AVLSPTLISE +P
Sbjct: 122 DIYGRKIGLMCVILVYVVGIVIQIASSDKWYQYFIGRIVSGMGVGGVAVLSPTLISEISP 181

Query: 203 KHLRGTCVAFYQLMITLGIFLGYCTNYGTKTYTNSVQWRVPLGMCFAWAIFMIAGMLLVP 262
           KHLRGTCV+FYQLMITLGIFLGYCTNYGTK Y+NS+QWRVPLG+CFAWAIFM+ GM++VP
Sbjct: 182 KHLRGTCVSFYQLMITLGIFLGYCTNYGTKKYSNSIQWRVPLGLCFAWAIFMVIGMVMVP 241

Query: 263 ESPRFLIEKGRFEEARRSIAKSNKLTVEDPGVSAEVELINAGVEAEKLAGSATWGELFSS 322
           ESPR+L+EKG++EEARRS+AKSNK+TV DPGV  E + I A +E E+  G+A+W ELFS+
Sbjct: 242 ESPRYLVEKGKYEEARRSLAKSNKVTVTDPGVVFEFDTIVANMELERAVGNASWHELFSN 301

Query: 323 KGKILQRVIMGVMIQSLQQLTGNNYFFYYGTTIFQAVGMDDSFQTSIVLGIVNFASTFVG 382
           KG IL RVIMG++IQSLQQLTG NYFFYYGTTIF AVGM DSF+TSIVLG VNFASTFV 
Sbjct: 302 KGAILPRVIMGIVIQSLQQLTGCNYFFYYGTTIFNAVGMQDSFETSIVLGAVNFASTFVA 361

Query: 383 LWTVEKFGRRKCLLWGSASMASCFVVFASVGVTRLWPNGQDQPSSKGAGNCMIVXXXXXX 442
           L+ V+KFGRRKCLLWGSASMA CFV+FA+VGVTRLWP G+DQPSS+ AGN MIV      
Sbjct: 362 LYIVDKFGRRKCLLWGSASMAICFVIFATVGVTRLWPQGKDQPSSQSAGNVMIVFTCFFI 421

Query: 443 XXXXXXWAPIAYVIVSESYPLRVKNRAMAISVGSNWIWGFLIGFFTPFITSAINFYYGYV 502
                 WAPIAYVIV+E+YPLRVKNRAMAI+VG+NW+WGFLIGFFTPFIT +I F YGYV
Sbjct: 422 FSFAITWAPIAYVIVAETYPLRVKNRAMAIAVGANWMWGFLIGFFTPFITRSIGFSYGYV 481

Query: 503 FMGCLXXXXXXXXXXXCETKGLTLEEVNEMYEEGVLPWKSDSWLPAGRR 551
           FMGCL           CETKGLTLEEVNEMYEE + PWKS  W+P+ RR
Sbjct: 482 FMGCLIFSYFYVFFFVCETKGLTLEEVNEMYEERIKPWKSGGWIPSSRR 530

>YLR081W (GAL2) [3496] chr12 (290213..291937) Galactose and glucose
           permease (facilitated diffusion transporter), member of
           the hexose transporter family of the major facilitator
           superfamily (MFS) [1725 bp, 574 aa]
          Length = 574

 Score =  735 bits (1897), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 356/569 (62%), Positives = 432/569 (75%), Gaps = 6/569 (1%)

Query: 9   DNRSVASGKVGASKDSDSALQLNLQTSTPSNKASRDDFDLKPE----NEHFP-EIPQKKL 63
           +N  V S +  A +D  S+L  +   S  S K S D+          ++  P EIP+K +
Sbjct: 6   NNMPVVSQQPQAGEDVISSLSKDSHLSAQSQKYSNDELKAGESGSEGSQSVPIEIPKKPM 65

Query: 64  SEYILVMCLCLMVAFGGFVFGWDTGTISGFVNMTDFKRRFGNYSQSEGTYYLSNVRTGLI 123
           SEY+ V  LCL VAFGGF+FGWDTGTISGFV  TDF RRFG     +GT+YLSNVRTGLI
Sbjct: 66  SEYVTVSLLCLCVAFGGFMFGWDTGTISGFVVQTDFLRRFG-MKHKDGTHYLSNVRTGLI 124

Query: 124 VAIFNIGCAFGGLTLGRLGDIYGRRLGLMCXXXXXXXXXXXXXATGDKWYQYFIGRIISG 183
           VAIFNIGCAFGG+ L + GD+YGR+ GL               A+ +KWYQYFIGRIISG
Sbjct: 125 VAIFNIGCAFGGIILSKGGDMYGRKKGLSIVVSVYIVGIIIQIASINKWYQYFIGRIISG 184

Query: 184 LGVGGIAVLSPTLISETAPKHLRGTCVAFYQLMITLGIFLGYCTNYGTKTYTNSVQWRVP 243
           LGVGGIAVL P LISE APKHLRGT V+ YQLMIT GIFLGYCTNYGTK+Y+NSVQWRVP
Sbjct: 185 LGVGGIAVLCPMLISEIAPKHLRGTLVSCYQLMITAGIFLGYCTNYGTKSYSNSVQWRVP 244

Query: 244 LGMCFAWAIFMIAGMLLVPESPRFLIEKGRFEEARRSIAKSNKLTVEDPGVSAEVELINA 303
           LG+CFAW++FMI  + LVPESPR+L E  + E+A+RSIAKSNK++ EDP V AE++LI A
Sbjct: 245 LGLCFAWSLFMIGALTLVPESPRYLCEVNKVEDAKRSIAKSNKVSPEDPAVQAELDLIMA 304

Query: 304 GVEAEKLAGSATWGELFSSKGKILQRVIMGVMIQSLQQLTGNNYFFYYGTTIFQAVGMDD 363
           G+EAEKLAG+A+WGELFS+K K+ QR++MGV +Q  QQLTGNNYFFYYGT IF++VG+DD
Sbjct: 305 GIEAEKLAGNASWGELFSTKTKVFQRLLMGVFVQMFQQLTGNNYFFYYGTVIFKSVGLDD 364

Query: 364 SFQTSIVLGIVNFASTFVGLWTVEKFGRRKCLLWGSASMASCFVVFASVGVTRLWPNGQD 423
           SF+TSIV+G+VNFASTF  LWTVE  G RKCLL G+A+M +C V++ASVGVTRL+P+G+ 
Sbjct: 365 SFETSIVIGVVNFASTFFSLWTVENLGHRKCLLLGAATMMACMVIYASVGVTRLYPHGKS 424

Query: 424 QPSSKGAGNCMIVXXXXXXXXXXXXWAPIAYVIVSESYPLRVKNRAMAISVGSNWIWGFL 483
           QPSSKGAGNCMIV            WAP+A+VI +ES+PLRVK++ MA++  SNW+WGFL
Sbjct: 425 QPSSKGAGNCMIVFTCFYIFCYATTWAPVAWVITAESFPLRVKSKCMALASASNWVWGFL 484

Query: 484 IGFFTPFITSAINFYYGYVFMGCLXXXXXXXXXXXCETKGLTLEEVNEMYEEGVLPWKSD 543
           I FFTPFITSAINFYYGYVFMGCL            ETKGL+LEE+ E++EEGVLPWKS+
Sbjct: 485 IAFFTPFITSAINFYYGYVFMGCLVAMFFYVFFFVPETKGLSLEEIQELWEEGVLPWKSE 544

Query: 544 SWLPAGRRGTDYNTEEAHTDDKPLYKRFL 572
            W+P+ RRG +Y+ E+   DDKP YK  L
Sbjct: 545 GWIPSSRRGNNYDLEDLQHDDKPWYKAML 573

>CAGL0A02233g complement(231128..232777) highly similar to sp|P39003
           Saccharomyces cerevisiae YDR343c HXT6 or sp|P39004
           Saccharomyces cerevisiae YDR342c HXT7, hypothetical
           start
          Length = 549

 Score =  733 bits (1893), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 358/553 (64%), Positives = 428/553 (77%), Gaps = 8/553 (1%)

Query: 21  SKDSDSALQLNLQTSTPSNKASRDDFDLKPENEHFP--EIPQKKLSEYILVMCLCLMVAF 78
           S++S SAL     +++ S     D+F    + +  P  EIP+K  S Y+ +   CL +AF
Sbjct: 2   SEESQSAL-----SASNSKVEREDEFKAYTDEDGQPMVEIPKKPASAYVAISIFCLFIAF 56

Query: 79  GGFVFGWDTGTISGFVNMTDFKRRFGNYSQSEGTYYLSNVRTGLIVAIFNIGCAFGGLTL 138
           GGFVFGWDTGTISGFV  TDF RR G  +++ GT+YLS VRTGLIV+IFNIGCA GG+ L
Sbjct: 57  GGFVFGWDTGTISGFVAQTDFIRRMGQ-TRANGTHYLSKVRTGLIVSIFNIGCAIGGVVL 115

Query: 139 GRLGDIYGRRLGLMCXXXXXXXXXXXXXATGDKWYQYFIGRIISGLGVGGIAVLSPTLIS 198
            +LGD+YGR++GL+              AT DKWYQYFIGRIISGLGVGGIAVLSP LIS
Sbjct: 116 SKLGDVYGRKIGLISVVVIYIVGIVIQIATIDKWYQYFIGRIISGLGVGGIAVLSPMLIS 175

Query: 199 ETAPKHLRGTCVAFYQLMITLGIFLGYCTNYGTKTYTNSVQWRVPLGMCFAWAIFMIAGM 258
           E +PKH+RG+ V+ YQLMIT GIFLGYCTNYGTK Y+NSVQWRVPLG+CFAWA+FMI GM
Sbjct: 176 EVSPKHMRGSLVSCYQLMITCGIFLGYCTNYGTKNYSNSVQWRVPLGLCFAWALFMIGGM 235

Query: 259 LLVPESPRFLIEKGRFEEARRSIAKSNKLTVEDPGVSAEVELINAGVEAEKLAGSATWGE 318
             VPESPR+LIE GR EEARRSIA SNK++ +DP V+ EVE + AGVEAE+LAGSA+WGE
Sbjct: 236 TFVPESPRYLIEVGRVEEARRSIAISNKVSPDDPAVTFEVENVQAGVEAERLAGSASWGE 295

Query: 319 LFSSKGKILQRVIMGVMIQSLQQLTGNNYFFYYGTTIFQAVGMDDSFQTSIVLGIVNFAS 378
           LFS+K KI QR+IMG+MIQSLQQLTG+NYFFYYGTT+F+AVG++DSF+TSIV+GIVNFAS
Sbjct: 296 LFSTKTKIFQRLIMGIMIQSLQQLTGDNYFFYYGTTVFKAVGLEDSFETSIVIGIVNFAS 355

Query: 379 TFVGLWTVEKFGRRKCLLWGSASMASCFVVFASVGVTRLWPNGQDQPSSKGAGNCMIVXX 438
           TFV L+ V++FGRR+CLLWG+A+M +C VVFASVGVTRL+P+G  QPSSKGAGNCMIV  
Sbjct: 356 TFVALYVVDRFGRRRCLLWGAAAMTACMVVFASVGVTRLYPHGMKQPSSKGAGNCMIVFT 415

Query: 439 XXXXXXXXXXWAPIAYVIVSESYPLRVKNRAMAISVGSNWIWGFLIGFFTPFITSAINFY 498
                     WAPI +V+ SE++PLRVK + MAI+  SNWIWGFLI FFTPFIT+AINFY
Sbjct: 416 CFYIFCFATTWAPIPFVVNSETFPLRVKAKCMAIAQASNWIWGFLIAFFTPFITNAINFY 475

Query: 499 YGYVFMGCLXXXXXXXXXXXCETKGLTLEEVNEMYEEGVLPWKSDSWLPAGRRGTDYNTE 558
           YGYVFMGCL            ETKGLTLEEVN M+EEGVL WKS +W+P  +R   Y+ +
Sbjct: 476 YGYVFMGCLCFSYFYVFFFIPETKGLTLEEVNTMWEEGVLAWKSPNWVPPSKRDASYDAD 535

Query: 559 EAHTDDKPLYKRF 571
               DDKP YKRF
Sbjct: 536 ALMHDDKPWYKRF 548

>CAGL0A01782g complement(170326..172032) highly similar to sp|P39003
           Saccharomyces cerevisiae YDR343c HXT6 or sp|P39004
           Saccharomyces cerevisiae YDR342c HXT7, hypothetical
           start
          Length = 568

 Score =  734 bits (1894), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 359/555 (64%), Positives = 426/555 (76%), Gaps = 4/555 (0%)

Query: 20  ASKDSDSALQLNLQTSTPSNKASRDDFDLKPENEHFP--EIPQKKLSEYILVMCLCLMVA 77
           AS ++D +  L+ Q S+ S     D   L+ E E  P  +IP+K  S Y+ V   CL +A
Sbjct: 16  ASPENDFSPSLSQQDSSAS-PYENDVKKLEEEAEQTPIVDIPKKPASAYVTVSIFCLFIA 74

Query: 78  FGGFVFGWDTGTISGFVNMTDFKRRFGNYSQSEGTYYLSNVRTGLIVAIFNIGCAFGGLT 137
           FGGFVFGWDTGTISGFV  TDF RR G   ++ GT+YLS VRTGL+V+IFNIGCA GG+ 
Sbjct: 75  FGGFVFGWDTGTISGFVAQTDFIRRLGQ-KRANGTHYLSKVRTGLVVSIFNIGCAIGGVI 133

Query: 138 LGRLGDIYGRRLGLMCXXXXXXXXXXXXXATGDKWYQYFIGRIISGLGVGGIAVLSPTLI 197
           L +LGD+YGR+ GL+              AT DKWYQYFIGRIISGLGVGGIAVLSP LI
Sbjct: 134 LSKLGDVYGRKPGLIIVVVIYVVGIIIQIATIDKWYQYFIGRIISGLGVGGIAVLSPMLI 193

Query: 198 SETAPKHLRGTCVAFYQLMITLGIFLGYCTNYGTKTYTNSVQWRVPLGMCFAWAIFMIAG 257
           SE +PKHLR T VA YQLMITLGIFLGYCTN+GTK Y+NSVQWRVPLG+CFAWAIFMI+G
Sbjct: 194 SEVSPKHLRATLVACYQLMITLGIFLGYCTNFGTKNYSNSVQWRVPLGLCFAWAIFMISG 253

Query: 258 MLLVPESPRFLIEKGRFEEARRSIAKSNKLTVEDPGVSAEVELINAGVEAEKLAGSATWG 317
           M  VPESPRFL+EKGR E+A+RSIA SNK++V+DP V AEV+ + A VEAE+LAGSA+WG
Sbjct: 254 MTFVPESPRFLVEKGRIEDAKRSIASSNKVSVDDPAVVAEVDSVQAAVEAERLAGSASWG 313

Query: 318 ELFSSKGKILQRVIMGVMIQSLQQLTGNNYFFYYGTTIFQAVGMDDSFQTSIVLGIVNFA 377
           ELFS+K KI QR++MG+MIQSLQQLTG+NYFFYYGT +F+AVG++DSF+TSIV+G+VNF 
Sbjct: 314 ELFSTKTKIFQRLVMGIMIQSLQQLTGDNYFFYYGTIVFKAVGLEDSFETSIVIGVVNFF 373

Query: 378 STFVGLWTVEKFGRRKCLLWGSASMASCFVVFASVGVTRLWPNGQDQPSSKGAGNCMIVX 437
           STFVG++ V +FGRR CLLWG+A+M +C VVFASVGVTRLWP+G+   SSKGAGNCMIV 
Sbjct: 374 STFVGIFLVGRFGRRTCLLWGAATMTACMVVFASVGVTRLWPHGKGNGSSKGAGNCMIVF 433

Query: 438 XXXXXXXXXXXWAPIAYVIVSESYPLRVKNRAMAISVGSNWIWGFLIGFFTPFITSAINF 497
                      WAP+A+VI SE++PLRVK + MA++  SNWIWGFLI FFTPFIT AINF
Sbjct: 434 TCFYIFCFATTWAPLAFVICSETFPLRVKAKCMALAQASNWIWGFLISFFTPFITDAINF 493

Query: 498 YYGYVFMGCLXXXXXXXXXXXCETKGLTLEEVNEMYEEGVLPWKSDSWLPAGRRGTDYNT 557
            YGYVFMGCL            ETKGLTLEEVN M+EEGVLPWK+  W+P  RRG DY+ 
Sbjct: 494 NYGYVFMGCLCFSYFYVFFFVPETKGLTLEEVNTMWEEGVLPWKASQWVPPSRRGADYDA 553

Query: 558 EEAHTDDKPLYKRFL 572
           +    DD P YKRFL
Sbjct: 554 DALMHDDTPWYKRFL 568

>KLLA0D13310g complement(1143027..1144730)
           gi|131828|sp|P18631|RAG1_KLULA Kluyveromyces lactis
           Low-affinity glucose transporter, start by similarity
          Length = 567

 Score =  728 bits (1879), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 355/568 (62%), Positives = 424/568 (74%), Gaps = 4/568 (0%)

Query: 8   IDNRSVASGKVGASKDSDSALQLNLQTSTPSNKASRDDFDLKPENEHFPE-IPQKKLSEY 66
           + N+   S   G+  +        L+  +P++     + DL    +   E + QK   EY
Sbjct: 1   MSNQMTDSTSAGSGTEHSVDTNTALKAGSPNDLKVSHEEDLNDLEKTAEETLQQKPAKEY 60

Query: 67  ILVMCLCLMVAFGGFVFGWDTGTISGFVNMTDFKRRFGNYSQSEGTYYLSNVRTGLIVAI 126
           I V   C+MVAFGGFVFGWDTGTISGFVN TDF RRFG   +++G++YLSNVRTGLIV+I
Sbjct: 61  IFVSLCCVMVAFGGFVFGWDTGTISGFVNQTDFLRRFGQ-EKADGSHYLSNVRTGLIVSI 119

Query: 127 FNIGCAFGGLTLGRLGDIYGRRLGLMCXXXXXXXXXXXXXATGDKWYQYFIGRIISGLGV 186
           FNIGCA GG+ L  +GD +GRR+GL+              A+ DKWYQYFIGRIISGLGV
Sbjct: 120 FNIGCAVGGIVLSNIGDRWGRRIGLITVIIIYVIGIIIQIASVDKWYQYFIGRIISGLGV 179

Query: 187 GGIAVLSPTLISETAPKHLRGTCVAFYQLMITLGIFLGYCTNYGTKTYTNSVQWRVPLGM 246
           GGI VLSP LISETAPKHLRGT V+ YQLMIT GIFLGYCTNYGTK Y+NSVQWRVPLG+
Sbjct: 180 GGITVLSPMLISETAPKHLRGTLVSCYQLMITFGIFLGYCTNYGTKNYSNSVQWRVPLGL 239

Query: 247 CFAWAIFMIAGMLLVPESPRFLIEKGRFEEARRSIAKSNKLTVEDPGVSAEVELINAGVE 306
           CFAWAIFM+ GM+ VPES RFL+E  + EEAR+S+AK+NK++++DP V  E+  I + +E
Sbjct: 240 CFAWAIFMVLGMMFVPESARFLVETDQIEEARKSLAKTNKVSIDDPVVKYELLKIQSSIE 299

Query: 307 AEKLAGSATWGELFSSKGKILQRVIMGVMIQSLQQLTGNNYFFYYGTTIFQAVGMDDSFQ 366
            EK AG+A+WGEL + K  + +R +MG+MIQSLQQLTG+NYFFYYGTTIFQ+VGMDDSF+
Sbjct: 300 LEKAAGNASWGELITGKPSMFRRTLMGIMIQSLQQLTGDNYFFYYGTTIFQSVGMDDSFE 359

Query: 367 TSIVLGIVNFASTFVGLWTVEKFGRRKCLLWGSASMASCFVVFASVGVTRLWPNGQDQP- 425
           TSIVLGIVNFASTF  L+TV+ FGRR CLL+G   M +C+VV+ASVGVTRLWP+G D P 
Sbjct: 360 TSIVLGIVNFASTFFALYTVDHFGRRNCLLYGCVGMVACYVVYASVGVTRLWPDGPDHPD 419

Query: 426 -SSKGAGNCMIVXXXXXXXXXXXXWAPIAYVIVSESYPLRVKNRAMAISVGSNWIWGFLI 484
            SSKGAGNCMIV            WAPIAYV++SESYPLRVK +AMAI+  SNWIWGFLI
Sbjct: 420 ISSKGAGNCMIVFACFYIFCFATTWAPIAYVVISESYPLRVKGKAMAIASASNWIWGFLI 479

Query: 485 GFFTPFITSAINFYYGYVFMGCLXXXXXXXXXXXCETKGLTLEEVNEMYEEGVLPWKSDS 544
           GFFTPFITSAI+FYYGYVFMGC+            ETKGLTLEEVNEMY EGVLPWKS S
Sbjct: 480 GFFTPFITSAIHFYYGYVFMGCMVFAFFYVYFFVPETKGLTLEEVNEMYSEGVLPWKSSS 539

Query: 545 WLPAGRRGTDYNTEEAHTDDKPLYKRFL 572
           W+P+ RRG +Y+ +    DDKP YK  L
Sbjct: 540 WVPSSRRGAEYDVDALQHDDKPWYKAML 567

>CAGL0A01826g complement(179321..180922) highly similar to sp|P38695
           Saccharomyces cerevisiae YHR096c HXT5, hypothetical
           start
          Length = 533

 Score =  726 bits (1875), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 350/511 (68%), Positives = 407/511 (79%), Gaps = 1/511 (0%)

Query: 60  QKKLSEYILVMCLCLMVAFGGFVFGWDTGTISGFVNMTDFKRRFGNYSQSEGTYYLSNVR 119
            KK S+ I V   C+MVAFGGFVFGWDTGTISGFVN TDF RRFG   +S+GTYYLSNVR
Sbjct: 19  HKKKSDLIFVSLCCIMVAFGGFVFGWDTGTISGFVNQTDFLRRFGQ-QRSDGTYYLSNVR 77

Query: 120 TGLIVAIFNIGCAFGGLTLGRLGDIYGRRLGLMCXXXXXXXXXXXXXATGDKWYQYFIGR 179
           TGLIVAIFNIGCA GG+TL +LGDI+GRRLGL+              A+ DKWYQYFIGR
Sbjct: 78  TGLIVAIFNIGCAIGGITLSKLGDIWGRRLGLVTVVVVYTIGIVIQIASIDKWYQYFIGR 137

Query: 180 IISGLGVGGIAVLSPTLISETAPKHLRGTCVAFYQLMITLGIFLGYCTNYGTKTYTNSVQ 239
           IISGLGVGGIAVLSP LISE +PK LRGT V+ YQLMIT GIFLGYCTNYGTK Y+NSVQ
Sbjct: 138 IISGLGVGGIAVLSPMLISEVSPKQLRGTLVSCYQLMITCGIFLGYCTNYGTKNYSNSVQ 197

Query: 240 WRVPLGMCFAWAIFMIAGMLLVPESPRFLIEKGRFEEARRSIAKSNKLTVEDPGVSAEVE 299
           WRVPLG+CFAWA+FMI G++ VPESPR+L+E G+ EEA+RS+A++NK TV+ P V  E++
Sbjct: 198 WRVPLGLCFAWALFMIFGVMCVPESPRYLVEVGKLEEAKRSLARANKTTVDSPIVLLELD 257

Query: 300 LINAGVEAEKLAGSATWGELFSSKGKILQRVIMGVMIQSLQQLTGNNYFFYYGTTIFQAV 359
              A VEAE+LAGSA+WGEL + K ++L+R IMG+MIQSLQQLTG NYFFYYGTTIF+AV
Sbjct: 258 KYQASVEAERLAGSASWGELVTGKPQMLRRTIMGMMIQSLQQLTGANYFFYYGTTIFRAV 317

Query: 360 GMDDSFQTSIVLGIVNFASTFVGLWTVEKFGRRKCLLWGSASMASCFVVFASVGVTRLWP 419
           G+DDSFQT+IVLG+VNF STF  L+TV+ +GRR CL+WG   M  C+VV+ASVGVTRLWP
Sbjct: 318 GLDDSFQTAIVLGVVNFVSTFYALYTVDHYGRRNCLMWGCVGMVCCYVVYASVGVTRLWP 377

Query: 420 NGQDQPSSKGAGNCMIVXXXXXXXXXXXXWAPIAYVIVSESYPLRVKNRAMAISVGSNWI 479
           NG+   SSKGAGNCMIV            WAPIAYVIVSESYPLR++ +AM+I++ +NWI
Sbjct: 378 NGEGNGSSKGAGNCMIVFACFFIFCFATTWAPIAYVIVSESYPLRIRGKAMSIAIAANWI 437

Query: 480 WGFLIGFFTPFITSAINFYYGYVFMGCLXXXXXXXXXXXCETKGLTLEEVNEMYEEGVLP 539
           WGFLI FFTPFITSAINFYYGYVFMGC+            ETKGLTLEEVN+MYEEGVLP
Sbjct: 438 WGFLIAFFTPFITSAINFYYGYVFMGCMVFAYFYVFFFVPETKGLTLEEVNQMYEEGVLP 497

Query: 540 WKSDSWLPAGRRGTDYNTEEAHTDDKPLYKR 570
           WKS SW+P  RR  +YN ++   DDKP YKR
Sbjct: 498 WKSSSWVPPDRRTAEYNLDDYSHDDKPWYKR 528

>CAGL0A00737g 74767..76416 highly similar to sp|P39003 Saccharomyces
           cerevisiae YDR343c HXT6 or sp|P39004 Saccharomyces
           cerevisiae YDR342c HXT7, hypothetical start
          Length = 549

 Score =  726 bits (1874), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 358/552 (64%), Positives = 422/552 (76%), Gaps = 8/552 (1%)

Query: 21  SKDSDSALQLNLQTSTPSNKASRDDFDLKPENEHFP--EIPQKKLSEYILVMCLCLMVAF 78
           S++S SA      +++ S     +DF    + +  P  EIP+K  S Y L+  LCL +AF
Sbjct: 2   SEESQSAF-----SASNSKVEREEDFKAYADEDGQPMVEIPKKPASAYTLIFILCLFIAF 56

Query: 79  GGFVFGWDTGTISGFVNMTDFKRRFGNYSQSEGTYYLSNVRTGLIVAIFNIGCAFGGLTL 138
           GGFVFGWDTGTISGFV   DF +R G   ++  TYYLS VRTGLIV+IFNIGCA GG+ L
Sbjct: 57  GGFVFGWDTGTISGFVAEEDFIKRLGQ-RRANNTYYLSKVRTGLIVSIFNIGCAIGGVVL 115

Query: 139 GRLGDIYGRRLGLMCXXXXXXXXXXXXXATGDKWYQYFIGRIISGLGVGGIAVLSPTLIS 198
            + GD+YGR++GL+              AT DKWYQYFIGRI+SGLGVGGIAVLSP LIS
Sbjct: 116 SKFGDMYGRKIGLIIVIVVYIVGIVIQIATIDKWYQYFIGRIVSGLGVGGIAVLSPMLIS 175

Query: 199 ETAPKHLRGTCVAFYQLMITLGIFLGYCTNYGTKTYTNSVQWRVPLGMCFAWAIFMIAGM 258
           E +PKH+RGT V+ YQLM+T GIFLGYCTNYGTK Y NSVQWRVPLG+CFAWA+FMI GM
Sbjct: 176 EVSPKHMRGTLVSCYQLMVTCGIFLGYCTNYGTKNYPNSVQWRVPLGLCFAWALFMIGGM 235

Query: 259 LLVPESPRFLIEKGRFEEARRSIAKSNKLTVEDPGVSAEVELINAGVEAEKLAGSATWGE 318
           L VPESPR+L+E G+FEEARRSIA SNKLT EDP V+ E+E + AGVEAE+LAGSA+WGE
Sbjct: 236 LCVPESPRYLVEVGKFEEARRSIAISNKLTPEDPAVTFELENVQAGVEAERLAGSASWGE 295

Query: 319 LFSSKGKILQRVIMGVMIQSLQQLTGNNYFFYYGTTIFQAVGMDDSFQTSIVLGIVNFAS 378
           LFS+K K+LQR+IMG+M+Q LQQLTG+NYFFYYGTT+F+AVG++DSFQTSIV+GIVNFAS
Sbjct: 296 LFSTKTKVLQRLIMGIMLQCLQQLTGDNYFFYYGTTVFKAVGLEDSFQTSIVIGIVNFAS 355

Query: 379 TFVGLWTVEKFGRRKCLLWGSASMASCFVVFASVGVTRLWPNGQDQPSSKGAGNCMIVXX 438
           TFV L+ V++FGRRKCLLWG+ASM +C VVFASVGVTRL+PNG DQPSSKGAGNCMIV  
Sbjct: 356 TFVALYVVDRFGRRKCLLWGAASMTACMVVFASVGVTRLYPNGMDQPSSKGAGNCMIVFT 415

Query: 439 XXXXXXXXXXWAPIAYVIVSESYPLRVKNRAMAISVGSNWIWGFLIGFFTPFITSAINFY 498
                     WAP  +VI SE++PLRVK + MAI   +NWIWGFLI FFTPFIT AINFY
Sbjct: 416 CFYIFCFATTWAPTPWVINSETFPLRVKAKCMAICQAANWIWGFLIAFFTPFITGAINFY 475

Query: 499 YGYVFMGCLXXXXXXXXXXXCETKGLTLEEVNEMYEEGVLPWKSDSWLPAGRRGTDYNTE 558
           YGYVFMGCL            ETKGLTLEEVN M+EEGVLPWKS  W+P  +R   Y+ +
Sbjct: 476 YGYVFMGCLCFSYFYVFFFIPETKGLTLEEVNTMWEEGVLPWKSPDWIPPSKRDATYDAD 535

Query: 559 EAHTDDKPLYKR 570
               DDKP Y+R
Sbjct: 536 AMMHDDKPWYRR 547

>YHR092C (HXT4) [2382] chr8 complement(287131..288813) Moderate- to
           low-affinity hexose transporter, member of the hexose
           transporter family of the major facilitator superfamily
           (MFS) [1683 bp, 560 aa]
          Length = 560

 Score =  724 bits (1870), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 358/533 (67%), Positives = 417/533 (78%), Gaps = 11/533 (2%)

Query: 23  DSDSALQLNLQTSTPSNKASRDDFDLKPENE----HFPEIPQKKLSEYILVMCLCLMVAF 78
           DS+SAL      STPSNKA RDD     EN     ++ EIP+K  S Y+ V   CLMVAF
Sbjct: 27  DSNSAL------STPSNKAERDDMKDFDENHEESNNYVEIPKKPASAYVTVSICCLMVAF 80

Query: 79  GGFVFGWDTGTISGFVNMTDFKRRFGNYSQSEGTYYLSNVRTGLIVAIFNIGCAFGGLTL 138
           GGFVFGWDTGTISGFV  TDF RRFG     +GTYYLS VRTGLIV+IFNIGCA GG+ L
Sbjct: 81  GGFVFGWDTGTISGFVAQTDFIRRFG-MKHHDGTYYLSKVRTGLIVSIFNIGCAIGGIIL 139

Query: 139 GRLGDIYGRRLGLMCXXXXXXXXXXXXXATGDKWYQYFIGRIISGLGVGGIAVLSPTLIS 198
            +LGD+YGR++GL+              A+ +KWYQYFIGRIISGLGVGGIAVLSP LIS
Sbjct: 140 AKLGDMYGRKMGLIVVVVIYIIGIIIQIASINKWYQYFIGRIISGLGVGGIAVLSPMLIS 199

Query: 199 ETAPKHLRGTCVAFYQLMITLGIFLGYCTNYGTKTYTNSVQWRVPLGMCFAWAIFMIAGM 258
           E +PKH+RGT V+ YQLMITLGIFLGYCTNYGTKTYTNSVQWRVPLG+ FAWA+FMI GM
Sbjct: 200 EVSPKHIRGTLVSCYQLMITLGIFLGYCTNYGTKTYTNSVQWRVPLGLGFAWALFMIGGM 259

Query: 259 LLVPESPRFLIEKGRFEEARRSIAKSNKLTVEDPGVSAEVELINAGVEAEKLAGSATWGE 318
             VPESPR+L+E G+ EEA+RSIA SNK++ +DP V AEVE++ A VEAEKLAG+A+WGE
Sbjct: 260 TFVPESPRYLVEVGKIEEAKRSIALSNKVSADDPAVMAEVEVVQATVEAEKLAGNASWGE 319

Query: 319 LFSSKGKILQRVIMGVMIQSLQQLTGNNYFFYYGTTIFQAVGMDDSFQTSIVLGIVNFAS 378
           +FS+K K+ QR+IMG MIQSLQQLTG+NYFFYYGTT+F AVG++DSF+TSIVLGIVNFAS
Sbjct: 320 IFSTKTKVFQRLIMGAMIQSLQQLTGDNYFFYYGTTVFTAVGLEDSFETSIVLGIVNFAS 379

Query: 379 TFVGLWTVEKFGRRKCLLWGSASMASCFVVFASVGVTRLWPNGQDQPSSKGAGNCMIVXX 438
           TFVG++ VE++GRR+CLLWG+ASM +C VVFASVGVTRLWPNG+   SSKGAGNCMIV  
Sbjct: 380 TFVGIFLVERYGRRRCLLWGAASMTACMVVFASVGVTRLWPNGKKNGSSKGAGNCMIVFT 439

Query: 439 XXXXXXXXXXWAPIAYVIVSESYPLRVKNRAMAISVGSNWIWGFLIGFFTPFITSAINFY 498
                     WAPI +V+ SE++PLRVK++ MAI+   NWIWGFLIGFFTPFI+ AI+FY
Sbjct: 440 CFYLFCFATTWAPIPFVVNSETFPLRVKSKCMAIAQACNWIWGFLIGFFTPFISGAIDFY 499

Query: 499 YGYVFMGCLXXXXXXXXXXXCETKGLTLEEVNEMYEEGVLPWKSDSWLPAGRR 551
           YGYVFMGCL            ETKGLTLEEVN ++EEGVLPWKS SW    R 
Sbjct: 500 YGYVFMGCLVFSYFYVFFFVPETKGLTLEEVNTLWEEGVLPWKSPSWFHQTRE 552

>YHR096C (HXT5) [2384] chr8 complement(294671..296449) Member of the
           hexose transporter family of the major facilitator
           superfamily (MFS) [1779 bp, 592 aa]
          Length = 592

 Score =  718 bits (1853), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 347/572 (60%), Positives = 427/572 (74%), Gaps = 1/572 (0%)

Query: 1   MSTSVTPIDNRSVASGKVGASKDSDSALQLNLQTSTPSNKASRDDFDLKPENEHFPEIPQ 60
           +ST+    + +S  S   G +  +D+  Q    +S  S++    D   + + E   ++ +
Sbjct: 18  VSTNSNSYNEKSGNSTAPGTAGYNDNLAQAKPVSSYISHEGPPKDELEELQKEVDKQLEK 77

Query: 61  KKLSEYILVMCLCLMVAFGGFVFGWDTGTISGFVNMTDFKRRFGNYSQSEGTYYLSNVRT 120
           K  S+ + V   CLMVAFGGFVFGWDTGTISGFV  TDF RRFG+ +++ GT YLS+VRT
Sbjct: 78  KSKSDLLFVSVCCLMVAFGGFVFGWDTGTISGFVRQTDFIRRFGS-TRANGTTYLSDVRT 136

Query: 121 GLIVAIFNIGCAFGGLTLGRLGDIYGRRLGLMCXXXXXXXXXXXXXATGDKWYQYFIGRI 180
           GL+V+IFNIGCA GG+ L +LGD+YGR++GLM              A+ DKWYQYFIGRI
Sbjct: 137 GLMVSIFNIGCAIGGIVLSKLGDMYGRKIGLMTVVVIYSIGIIIQIASIDKWYQYFIGRI 196

Query: 181 ISGLGVGGIAVLSPTLISETAPKHLRGTCVAFYQLMITLGIFLGYCTNYGTKTYTNSVQW 240
           ISGLGVGGI VL+P LISE +PK LRGT V+ YQLMIT GIFLGYCTN+GTK Y+NSVQW
Sbjct: 197 ISGLGVGGITVLAPMLISEVSPKQLRGTLVSCYQLMITFGIFLGYCTNFGTKNYSNSVQW 256

Query: 241 RVPLGMCFAWAIFMIAGMLLVPESPRFLIEKGRFEEARRSIAKSNKLTVEDPGVSAEVEL 300
           RVPLG+CFAW+IFMI GM  VPESPR+L+E G+ EEA+RS+A++NK T + P V+ E+E 
Sbjct: 257 RVPLGLCFAWSIFMIVGMTFVPESPRYLVEVGKIEEAKRSLARANKTTEDSPLVTLEMEN 316

Query: 301 INAGVEAEKLAGSATWGELFSSKGKILQRVIMGVMIQSLQQLTGNNYFFYYGTTIFQAVG 360
             + +EAE+LAGSA+WGEL + K ++ +R +MG+MIQSLQQLTG+NYFFYYGTTIFQAVG
Sbjct: 317 YQSSIEAERLAGSASWGELVTGKPQMFRRTLMGMMIQSLQQLTGDNYFFYYGTTIFQAVG 376

Query: 361 MDDSFQTSIVLGIVNFASTFVGLWTVEKFGRRKCLLWGSASMASCFVVFASVGVTRLWPN 420
           ++DSF+T+IVLG+VNF STF  L+TV++FGRR CLLWG   M  C+VV+ASVGVTRLWPN
Sbjct: 377 LEDSFETAIVLGVVNFVSTFFSLYTVDRFGRRNCLLWGCVGMICCYVVYASVGVTRLWPN 436

Query: 421 GQDQPSSKGAGNCMIVXXXXXXXXXXXXWAPIAYVIVSESYPLRVKNRAMAISVGSNWIW 480
           GQDQPSSKGAGNCMIV            WAP+AYV++SESYPLRV+ +AM+I+   NWIW
Sbjct: 437 GQDQPSSKGAGNCMIVFACFYIFCFATTWAPVAYVLISESYPLRVRGKAMSIASACNWIW 496

Query: 481 GFLIGFFTPFITSAINFYYGYVFMGCLXXXXXXXXXXXCETKGLTLEEVNEMYEEGVLPW 540
           GFLI FFTPFITSAINFYYGYVFMGC+            ETKGLTLEEVNEMYEE VLPW
Sbjct: 497 GFLISFFTPFITSAINFYYGYVFMGCMVFAYFYVFFFVPETKGLTLEEVNEMYEENVLPW 556

Query: 541 KSDSWLPAGRRGTDYNTEEAHTDDKPLYKRFL 572
           KS  W+P  RR TDY+ +    D +P YKR  
Sbjct: 557 KSTKWIPPSRRTTDYDLDATRNDPRPFYKRMF 588

>YJL219W (HXT9) [2711] chr10 (19497..21200) Member of the hexose
           transporter family of the major facilitator superfamily
           (MFS), may play a role in drug uptake [1704 bp, 567 aa]
          Length = 567

 Score =  703 bits (1815), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 341/571 (59%), Positives = 416/571 (72%), Gaps = 20/571 (3%)

Query: 4   SVTPIDNRSVASGKVGASKDSDSALQLNLQTSTPSNKASRDDFDLKPENEHFPEIPQKKL 63
           S T  ++ SVA+     ++ +DS   LNL  + P                   ++PQK L
Sbjct: 13  STTESNSNSVANAPSVKTEHNDSKNSLNLDATEPP-----------------IDLPQKPL 55

Query: 64  SEYILVMCLCLMVAFGGFVFGWDTGTISGFVNMTDFKRRFGNYSQSEGTYYLSNVRTGLI 123
           S Y  V  LCLM+AFGGF+FGWDTGTISGFVN++DF RRFG     +GTYYLS VR GLI
Sbjct: 56  SAYTTVAILCLMIAFGGFIFGWDTGTISGFVNLSDFIRRFGQ-KNDKGTYYLSKVRMGLI 114

Query: 124 VAIFNIGCAFGGLTLGRLGDIYGRRLGLMCXXXXXXXXXXXXXATGDKWYQYFIGRIISG 183
           V+IFNIGCA GG+ L ++GDIYGRR+GL+               + +KWYQYFIGRIISG
Sbjct: 115 VSIFNIGCAIGGIVLSKVGDIYGRRIGLITVTAIYVVGILIQITSINKWYQYFIGRIISG 174

Query: 184 LGVGGIAVLSPTLISETAPKHLRGTCVAFYQLMITLGIFLGYCTNYGTKTYTNSVQWRVP 243
           LGVGGIAVLSP LISE APK +RGT V  YQLM T+GIFLGYCTNYGTK Y N+ QWRV 
Sbjct: 175 LGVGGIAVLSPMLISEVAPKQIRGTLVQLYQLMCTMGIFLGYCTNYGTKNYHNATQWRVG 234

Query: 244 LGMCFAWAIFMIAGMLLVPESPRFLIEKGRFEEARRSIAKSNKLTVEDPGVSAEVELINA 303
           LG+CFAW  FM++GM+ VPESPR+LIE G+ EEA+RS++KSNK++V+DP + AE + I A
Sbjct: 235 LGLCFAWTTFMVSGMMFVPESPRYLIEVGKDEEAKRSLSKSNKVSVDDPALLAEYDTIKA 294

Query: 304 GVEAEKLAGSATWGELFSSKGKILQRVIMGVMIQSLQQLTGNNYFFYYGTTIFQAVGMDD 363
           G+E EKLAG+A+W EL S+K K+ QRV+MGVMIQSLQQLTG+NYFFYYGTTIF++VG+ D
Sbjct: 295 GIELEKLAGNASWSELLSTKTKVFQRVLMGVMIQSLQQLTGDNYFFYYGTTIFKSVGLKD 354

Query: 364 SFQTSIVLGIVNFASTFVGLWTVEKFGRRKCLLWGSASMASCFVVFASVGVTRLWPNGQD 423
           SFQTSI++G+VNF S+F+ ++T+E+FGRR CLLWG+ASM  CF VFASVGVT+LWP G  
Sbjct: 355 SFQTSIIIGVVNFFSSFIAVYTIERFGRRTCLLWGAASMLCCFAVFASVGVTKLWPQGSS 414

Query: 424 QP--SSKGAGNCMIVXXXXXXXXXXXXWAPIAYVIVSESYPLRVKNRAMAISVGSNWIWG 481
               +S+GAGNCMIV            WA   YVIVSE++PLRVK+R MAI+  +NW+WG
Sbjct: 415 HQDITSQGAGNCMIVFTMFFIFSFATTWAGGCYVIVSETFPLRVKSRGMAIATAANWMWG 474

Query: 482 FLIGFFTPFITSAINFYYGYVFMGCLXXXXXXXXXXXCETKGLTLEEVNEMYEEGVLPWK 541
           FLI FFTPFIT AINFYYGYVF+GCL            ETKGLTLEEVN M+ EGV  WK
Sbjct: 475 FLISFFTPFITGAINFYYGYVFLGCLVFAYFYVFFFVPETKGLTLEEVNTMWLEGVPAWK 534

Query: 542 SDSWLPAGRRGTDYNTEEAHTDDKPLYKRFL 572
           S SW+P  RR  DY+ +    DD+P+YKRF 
Sbjct: 535 SASWVPPERRTADYDADAIDHDDRPIYKRFF 565

>YOL156W (HXT11) [4669] chr15 (25272..26975) Low-affinity glucose
           permease, member of the hexose transporter family of the
           major facilitator superfamily (MFS), may be involved in
           uptake of drugs [1704 bp, 567 aa]
          Length = 567

 Score =  701 bits (1808), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 340/559 (60%), Positives = 415/559 (74%), Gaps = 8/559 (1%)

Query: 20  ASKDSDSALQLNLQTSTPSNKA----SRDDFDLKPENEHFPEIPQKKLSEYILVMCLCLM 75
           A++ S +    N     PS K     S++  +L   NE   ++PQK LS Y  V  LCLM
Sbjct: 9   ANELSTTMSNSNSAVGAPSVKTEHGDSKNSLNLD-ANEPPIDLPQKPLSAYTTVAILCLM 67

Query: 76  VAFGGFVFGWDTGTISGFVNMTDFKRRFGNYSQSEGTYYLSNVRTGLIVAIFNIGCAFGG 135
           +AFGGF+FGWDTGTISGFVN++DF RRFG     +GTYYLS VR GLIV+IFNIGCA GG
Sbjct: 68  IAFGGFIFGWDTGTISGFVNLSDFIRRFGQ-KNDKGTYYLSKVRMGLIVSIFNIGCAIGG 126

Query: 136 LTLGRLGDIYGRRLGLMCXXXXXXXXXXXXXATGDKWYQYFIGRIISGLGVGGIAVLSPT 195
           + L ++GDIYGRR+GL+               + +KWYQYFIGRIISGLGVGGIAVLSP 
Sbjct: 127 IVLSKVGDIYGRRIGLITVTAIYVVGILIQITSINKWYQYFIGRIISGLGVGGIAVLSPM 186

Query: 196 LISETAPKHLRGTCVAFYQLMITLGIFLGYCTNYGTKTYTNSVQWRVPLGMCFAWAIFMI 255
           LISE APKH+RGT V  YQLM T+GIFLGYCTNYGTK Y N+ QWRV LG+CFAWA FM+
Sbjct: 187 LISEVAPKHIRGTLVQLYQLMGTMGIFLGYCTNYGTKNYHNATQWRVGLGLCFAWATFMV 246

Query: 256 AGMLLVPESPRFLIEKGRFEEARRSIAKSNKLTVEDPGVSAEVELINAGVEAEKLAGSAT 315
           +GM+ VPESPR+LIE G+ EEA+RS++KSNK++V+DP +  E + I AG+E EKLAG+A+
Sbjct: 247 SGMMFVPESPRYLIEVGKDEEAKRSLSKSNKVSVDDPALLVEYDTIKAGIELEKLAGNAS 306

Query: 316 WGELFSSKGKILQRVIMGVMIQSLQQLTGNNYFFYYGTTIFQAVGMDDSFQTSIVLGIVN 375
           W EL S+K K+ QRV+MGVMIQSLQQLTG+NYFFYYGTTIF++VG+ DSFQTSI++G+VN
Sbjct: 307 WSELLSTKTKVFQRVLMGVMIQSLQQLTGDNYFFYYGTTIFKSVGLKDSFQTSIIIGVVN 366

Query: 376 FASTFVGLWTVEKFGRRKCLLWGSASMASCFVVFASVGVTRLWPNGQDQP--SSKGAGNC 433
           F S+F+ ++T+E+FGRR CLLWG+ASM  CF VFASVGVT+LWP G      +S+GAGNC
Sbjct: 367 FFSSFIAVYTIERFGRRTCLLWGAASMLCCFAVFASVGVTKLWPQGSSHQDITSQGAGNC 426

Query: 434 MIVXXXXXXXXXXXXWAPIAYVIVSESYPLRVKNRAMAISVGSNWIWGFLIGFFTPFITS 493
           MIV            WA   YVIVSE++PLRVK+R MAI+  +NW+WGFLI FFTPFIT 
Sbjct: 427 MIVFTMFFIFSFATTWAGGCYVIVSETFPLRVKSRGMAIATAANWMWGFLISFFTPFITG 486

Query: 494 AINFYYGYVFMGCLXXXXXXXXXXXCETKGLTLEEVNEMYEEGVLPWKSDSWLPAGRRGT 553
           AINFYYGYVF+GCL            ETKGLTLEEVN M+ EGV  WKS SW+P  RR  
Sbjct: 487 AINFYYGYVFLGCLVFAYFYVFFFVPETKGLTLEEVNTMWLEGVPAWKSASWVPPERRTA 546

Query: 554 DYNTEEAHTDDKPLYKRFL 572
           DY+ +    D++P+YKRF 
Sbjct: 547 DYDADAIDHDNRPIYKRFF 565

>YJL214W (HXT8) [2715] chr10 (26887..28596) Member of the hexose
           transporter family of the major facilitator superfamily
           (MFS) [1710 bp, 569 aa]
          Length = 569

 Score =  700 bits (1806), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 336/551 (60%), Positives = 419/551 (76%)

Query: 20  ASKDSDSALQLNLQTSTPSNKASRDDFDLKPENEHFPEIPQKKLSEYILVMCLCLMVAFG 79
           A  D   +++ +   S P+ + ++D  +   E      +P+K  S Y  V  +CL +AFG
Sbjct: 17  AEDDGCPSIENSSHLSVPTVEENKDFSEYNGEEAEEVVVPEKPASAYATVSIMCLCMAFG 76

Query: 80  GFVFGWDTGTISGFVNMTDFKRRFGNYSQSEGTYYLSNVRTGLIVAIFNIGCAFGGLTLG 139
           GF+ GWDTGTISGFVN TDF RRFGNYS S+ TYYLSNVRTGLIV+IFN+G A G L L 
Sbjct: 77  GFMSGWDTGTISGFVNQTDFLRRFGNYSHSKNTYYLSNVRTGLIVSIFNVGSAIGCLFLS 136

Query: 140 RLGDIYGRRLGLMCXXXXXXXXXXXXXATGDKWYQYFIGRIISGLGVGGIAVLSPTLISE 199
           +LGDIYGR +GL+              A+ DKWYQYFIGRII+G+G G I+VL+P LISE
Sbjct: 137 KLGDIYGRCMGLIIVIVVYMVGIVIQIASIDKWYQYFIGRIIAGIGAGSISVLAPMLISE 196

Query: 200 TAPKHLRGTCVAFYQLMITLGIFLGYCTNYGTKTYTNSVQWRVPLGMCFAWAIFMIAGML 259
           TAPKH+RGT +A +QLM+T  IFLGYCTNYGTKTY+NSVQWRVPLG+CFAWAI MI GM 
Sbjct: 197 TAPKHIRGTLLACWQLMVTFAIFLGYCTNYGTKTYSNSVQWRVPLGLCFAWAIIMIGGMT 256

Query: 260 LVPESPRFLIEKGRFEEARRSIAKSNKLTVEDPGVSAEVELINAGVEAEKLAGSATWGEL 319
            VPESPRFL++ G+ E+A+ S AKSNKL+V+DP V AE++L+ AGVEAE+  G+A+W EL
Sbjct: 257 FVPESPRFLVQVGKIEQAKASFAKSNKLSVDDPAVVAEIDLLVAGVEAEEAMGTASWKEL 316

Query: 320 FSSKGKILQRVIMGVMIQSLQQLTGNNYFFYYGTTIFQAVGMDDSFQTSIVLGIVNFAST 379
           FS K K+ QR+ M VMI SLQQLTG+NYFFYYGTTIF++VGM+DSF+TSIVLGIVNFAS 
Sbjct: 317 FSRKTKVFQRLTMTVMINSLQQLTGDNYFFYYGTTIFKSVGMNDSFETSIVLGIVNFASC 376

Query: 380 FVGLWTVEKFGRRKCLLWGSASMASCFVVFASVGVTRLWPNGQDQPSSKGAGNCMIVXXX 439
           F  L++V+K GRR+CLL G+A+M +C V++ASVGVTRL+PNG+ +PSSKGAGNC IV   
Sbjct: 377 FFSLYSVDKLGRRRCLLLGAATMTACMVIYASVGVTRLYPNGKSEPSSKGAGNCTIVFTC 436

Query: 440 XXXXXXXXXWAPIAYVIVSESYPLRVKNRAMAISVGSNWIWGFLIGFFTPFITSAINFYY 499
                    W P+ YVI+SE++PLRV+++ M+++  +N +WGFLIGFFTPFITSAINFYY
Sbjct: 437 FYIFCFSCTWGPVCYVIISETFPLRVRSKCMSVATAANLLWGFLIGFFTPFITSAINFYY 496

Query: 500 GYVFMGCLXXXXXXXXXXXCETKGLTLEEVNEMYEEGVLPWKSDSWLPAGRRGTDYNTEE 559
           GYVFMGCL            ETKGLTLEEV+EM+ +GVLPWKS+SW+PA RR  DY+ E+
Sbjct: 497 GYVFMGCLAFSYFYVFFFVPETKGLTLEEVDEMWMDGVLPWKSESWVPASRRDGDYDNEK 556

Query: 560 AHTDDKPLYKR 570
              D+KP YKR
Sbjct: 557 LQHDEKPFYKR 567

>AFL207C [2988] [Homologous to ScAFL207C] (44349..45968) [1620 bp,
           539 aa]
          Length = 539

 Score =  697 bits (1798), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 334/508 (65%), Positives = 397/508 (78%), Gaps = 2/508 (0%)

Query: 53  EHFPEIPQKKLSEYILVMCLCLMVAFGGFVFGWDTGTISGFVNMTDFKRRFGNYSQSEGT 112
           E   +IP K  + YI V  LC+ VAFGGF+FGWDTGTISGFVN TDF+RRF   +  EG 
Sbjct: 28  EETVDIPTKPATAYITVCLLCVFVAFGGFIFGWDTGTISGFVNQTDFRRRFAQVND-EGG 86

Query: 113 YYLSNVRTGLIVAIFNIGCAFGGLTLGRLGDIYGRRLGLMCXXXXXXXXXXXXXATGDKW 172
           YY SN R GLIVAIFNIGCA GG+ L RLGD+YGRR+GLM              ++  KW
Sbjct: 87  YYWSNARVGLIVAIFNIGCAVGGIILSRLGDMYGRRIGLMIVSLIYVVGIIIQISSNTKW 146

Query: 173 YQYFIGRIISGLGVGGIAVLSPTLISETAPKHLRGTCVAFYQLMITLGIFLGYCTNYGTK 232
           YQY IGR+ISGLGVGGIAVLSP LISET+PKHLRGT V+ YQLMIT GI LGYC NYGTK
Sbjct: 147 YQYCIGRVISGLGVGGIAVLSPMLISETSPKHLRGTLVSCYQLMITAGILLGYCANYGTK 206

Query: 233 T-YTNSVQWRVPLGMCFAWAIFMIAGMLLVPESPRFLIEKGRFEEARRSIAKSNKLTVED 291
           + Y +S QWR+PLG+CF WAIFMI GM  VPESPR+LIEK + EEA+RS+A SNK+ V+D
Sbjct: 207 SRYDDSRQWRIPLGLCFLWAIFMITGMAFVPESPRYLIEKDKIEEAKRSLATSNKVPVDD 266

Query: 292 PGVSAEVELINAGVEAEKLAGSATWGELFSSKGKILQRVIMGVMIQSLQQLTGNNYFFYY 351
           P + AEV  I AGVE E++AGSA+WGELF+ + KILQRVIMG MIQSLQQLTGNNYFFYY
Sbjct: 267 PAILAEVNNIQAGVELERMAGSASWGELFTVRTKILQRVIMGAMIQSLQQLTGNNYFFYY 326

Query: 352 GTTIFQAVGMDDSFQTSIVLGIVNFASTFVGLWTVEKFGRRKCLLWGSASMASCFVVFAS 411
           GTTIF +VG++D+F+TSI+LG VNF STFV ++TV++FGRRKCLL+G+A+MA C V+FAS
Sbjct: 327 GTTIFDSVGLEDAFKTSIILGAVNFGSTFVAMYTVDRFGRRKCLLYGAAAMAVCMVIFAS 386

Query: 412 VGVTRLWPNGQDQPSSKGAGNCMIVXXXXXXXXXXXXWAPIAYVIVSESYPLRVKNRAMA 471
           VGVTRLWPNG DQPSS+ AGN MIV            WAPIAYVIVSE++PLRVK + MA
Sbjct: 387 VGVTRLWPNGPDQPSSRPAGNAMIVFTCLYIFFFATTWAPIAYVIVSETFPLRVKAKGMA 446

Query: 472 ISVGSNWIWGFLIGFFTPFITSAINFYYGYVFMGCLXXXXXXXXXXXCETKGLTLEEVNE 531
           I+  +NWIWGFLI FFTP+IT+AI FYYGYVFMGCL            ETKGLTLEEV E
Sbjct: 447 IATAANWIWGFLIAFFTPYITNAIRFYYGYVFMGCLIFAFFYIFFFVPETKGLTLEEVEE 506

Query: 532 MYEEGVLPWKSDSWLPAGRRGTDYNTEE 559
           M++EGV+PW+S+SW+P+ RR   Y++++
Sbjct: 507 MWQEGVVPWRSESWVPSARRHAPYSSDK 534

>Sklu_2304.6 , Contig c2304 11341-13056 reverse complement
          Length = 571

 Score =  698 bits (1801), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 346/575 (60%), Positives = 424/575 (73%), Gaps = 18/575 (3%)

Query: 2   STSVTPIDNRSVASGKVGASKDSDSALQLNLQTSTPSNKASRDDFD-LKPENEHFP---E 57
           S   TP+D+ S+A+                   STPSNKA+RDD D LK +NE       
Sbjct: 11  SAQDTPVDSHSLATA--------------TSHLSTPSNKAARDDLDDLKFQNEATELTTV 56

Query: 58  IPQKKLSEYILVMCLCLMVAFGGFVFGWDTGTISGFVNMTDFKRRFGNYSQSEGTYYLSN 117
           +PQK  S YI V  LC+ VAFGGFV GWD GTISGFVN TDFKRRFG YS S+  YYLSN
Sbjct: 57  MPQKPASAYITVCILCMCVAFGGFVSGWDVGTISGFVNQTDFKRRFGEYSHSKDEYYLSN 116

Query: 118 VRTGLIVAIFNIGCAFGGLTLGRLGDIYGRRLGLMCXXXXXXXXXXXXXATGDKWYQYFI 177
           VR GLIV+IF+IG A G L L +LGD+YGR +GLM              ++ DKWYQYFI
Sbjct: 117 VRVGLIVSIFSIGNAVGALVLSKLGDVYGRCMGLMAVILVYVVGIVIQISSDDKWYQYFI 176

Query: 178 GRIISGLGVGGIAVLSPTLISETAPKHLRGTCVAFYQLMITLGIFLGYCTNYGTKTYTNS 237
           GRI++GLG GG+ VL+  LISETAPKHLRGT +A +Q+M+   I LGYCTNYGTK Y+NS
Sbjct: 177 GRIVAGLGGGGVGVLAQMLISETAPKHLRGTLLASWQVMVNCAILLGYCTNYGTKNYSNS 236

Query: 238 VQWRVPLGMCFAWAIFMIAGMLLVPESPRFLIEKGRFEEARRSIAKSNKLTVEDPGVSAE 297
           +QWRVPLG+CFAWAI MIAGM  VPESPR+LI+ G+ EEA+RS+A+SNKLTVEDP V  E
Sbjct: 237 IQWRVPLGLCFAWAIIMIAGMCFVPESPRYLIQVGKIEEAKRSLARSNKLTVEDPAVQCE 296

Query: 298 VELINAGVEAEKLAGSATWGELFSSKGKILQRVIMGVMIQSLQQLTGNNYFFYYGTTIFQ 357
           V+LI AG+E EKLAGS++WG+L S K K+ QR++M + I SLQQLTG  YFFYYGTTIF+
Sbjct: 297 VDLIAAGIELEKLAGSSSWGDLLSKKTKVFQRLVMSITINSLQQLTGCGYFFYYGTTIFK 356

Query: 358 AVGMDDSFQTSIVLGIVNFASTFVGLWTVEKFGRRKCLLWGSASMASCFVVFASVGVTRL 417
           +VGM+DSF+TSIV+G+VNF STFV L+ +++ GRRKCLL G+A M  C V++A+VGVT L
Sbjct: 357 SVGMEDSFETSIVIGVVNFVSTFVSLYILDRLGRRKCLLMGAAVMTVCMVIYATVGVTSL 416

Query: 418 WPNGQDQPSSKGAGNCMIVXXXXXXXXXXXXWAPIAYVIVSESYPLRVKNRAMAISVGSN 477
           +P+G+DQPSSK AGNCMIV            W P  +V++SES+PLRVK++ M+++  +N
Sbjct: 417 YPDGEDQPSSKAAGNCMIVFTCFYIFFFANTWGPGCFVVISESFPLRVKSKCMSVATAAN 476

Query: 478 WIWGFLIGFFTPFITSAINFYYGYVFMGCLXXXXXXXXXXXCETKGLTLEEVNEMYEEGV 537
            +WGFL+GFFTPFITSAINFYYGYVFMGCL            ETKGLTLEEV EM+ EGV
Sbjct: 477 GLWGFLVGFFTPFITSAINFYYGYVFMGCLVVSYFYVFFFVPETKGLTLEEVEEMWHEGV 536

Query: 538 LPWKSDSWLPAGRRGTDYNTEEAHTDDKPLYKRFL 572
           LPWKS SW+P+ RRGT+Y+ E+   D+KP YKR L
Sbjct: 537 LPWKSGSWVPSSRRGTNYDAEKLQHDEKPWYKRML 571

>Scas_658.23
          Length = 568

 Score =  696 bits (1797), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 338/554 (61%), Positives = 404/554 (72%), Gaps = 3/554 (0%)

Query: 21  SKDSDSALQLNLQTSTPSNKASRDDFDLKPENEHFPEI--PQKKLSEYILVMCLCLMVAF 78
           S  S+S ++++   S   N  +  + +   + E   E+  P      Y+ V   C+MVAF
Sbjct: 13  STSSNSNIEVDSNNSKVLNDPAGMEKNGSDDYEQVTELVNPNNGKGAYVTVSICCVMVAF 72

Query: 79  GGFVFGWDTGTISGFVNMTDFKRRFGNYSQSEGTYYLSNVRTGLIVAIFNIGCAFGGLTL 138
           GGFVFGWDTGTISGFV  TDF RRFG      GT YLS VR GLIV+IFNIGCA GG+ L
Sbjct: 73  GGFVFGWDTGTISGFVAQTDFLRRFGQ-KHHNGTPYLSKVRMGLIVSIFNIGCAIGGIVL 131

Query: 139 GRLGDIYGRRLGLMCXXXXXXXXXXXXXATGDKWYQYFIGRIISGLGVGGIAVLSPTLIS 198
            RLGD +GR++GL+              A+   WYQYFIGRIISGLGVGGIAVLSP LIS
Sbjct: 132 ARLGDTHGRKMGLIIVVCIYIVGIIIQIASVKAWYQYFIGRIISGLGVGGIAVLSPMLIS 191

Query: 199 ETAPKHLRGTCVAFYQLMITLGIFLGYCTNYGTKTYTNSVQWRVPLGMCFAWAIFMIAGM 258
           E APK +RGT V+ YQLMITLGIFLGYCTNYGTK Y+NSVQWRVPLG+CFAWA+FMI GM
Sbjct: 192 EVAPKEMRGTLVSCYQLMITLGIFLGYCTNYGTKNYSNSVQWRVPLGLCFAWALFMIGGM 251

Query: 259 LLVPESPRFLIEKGRFEEARRSIAKSNKLTVEDPGVSAEVELINAGVEAEKLAGSATWGE 318
             VPESPR+L+E G+ +EAR S++K NK   + P +  E+ELI A VE  + AGSA+WGE
Sbjct: 252 TFVPESPRYLVEAGKIDEARASLSKVNKTPGDHPFIQQELELIEASVEEARAAGSASWGE 311

Query: 319 LFSSKGKILQRVIMGVMIQSLQQLTGNNYFFYYGTTIFQAVGMDDSFQTSIVLGIVNFAS 378
           LF+ K  +LQR ++G+MIQSLQQLTG+NYFFYYGTT+F AVGM DSF+TSIV GIVN AS
Sbjct: 312 LFTGKPAMLQRTMLGIMIQSLQQLTGDNYFFYYGTTVFTAVGMQDSFETSIVFGIVNLAS 371

Query: 379 TFVGLWTVEKFGRRKCLLWGSASMASCFVVFASVGVTRLWPNGQDQPSSKGAGNCMIVXX 438
           T   L+TV+KFGRR CLLWG+  M  C+VV+ASVGVTRLWPNG+   SSKGAGNCMI   
Sbjct: 372 TCCSLYTVDKFGRRNCLLWGAVGMVCCYVVYASVGVTRLWPNGEGNGSSKGAGNCMICFA 431

Query: 439 XXXXXXXXXXWAPIAYVIVSESYPLRVKNRAMAISVGSNWIWGFLIGFFTPFITSAINFY 498
                     WAPIAYV++SE++PLRVK++AM+++  +NW+WGFLIGFFTPFIT AINFY
Sbjct: 432 CFYIFCFATTWAPIAYVVISETFPLRVKSKAMSVATAANWLWGFLIGFFTPFITGAINFY 491

Query: 499 YGYVFMGCLXXXXXXXXXXXCETKGLTLEEVNEMYEEGVLPWKSDSWLPAGRRGTDYNTE 558
           YGYVFMGC+            ETKGLTLEEVN+MY EGV+PWKS SW+P  RRG DYN +
Sbjct: 492 YGYVFMGCMVFAYFYVFFFVPETKGLTLEEVNDMYSEGVVPWKSASWVPPSRRGADYNID 551

Query: 559 EAHTDDKPLYKRFL 572
           E   DD P+YKR  
Sbjct: 552 ELAHDDTPIYKRMF 565

>YHR094C (HXT1) [2383] chr8 complement(290915..292627) Low-affinity
           hexose transporter, member of the hexose transporter
           family of the major facilitator superfamily (MFS),
           induced by glucose only at high concentration [1713 bp,
           570 aa]
          Length = 570

 Score =  694 bits (1792), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 333/554 (60%), Positives = 406/554 (73%), Gaps = 6/554 (1%)

Query: 21  SKDSDSALQLNLQTSTPSNKASRDDFDLKPENEHFPEI--PQKKLSEYILVMCLCLMVAF 78
           S + +S     + T    N++  D+     E++  P +  P      Y+ V   C+MVAF
Sbjct: 18  SYELESGRSKAMNTPEGKNESFHDNLS---ESQVQPAVAPPNTGKGVYVTVSICCVMVAF 74

Query: 79  GGFVFGWDTGTISGFVNMTDFKRRFGNYSQSEGTYYLSNVRTGLIVAIFNIGCAFGGLTL 138
           GGF+FGWDTGTISGFV  TDF RRFG     +G++YLS VRTGLIV+IFNIGCA GG+ L
Sbjct: 75  GGFIFGWDTGTISGFVAQTDFLRRFG-MKHHDGSHYLSKVRTGLIVSIFNIGCAIGGIVL 133

Query: 139 GRLGDIYGRRLGLMCXXXXXXXXXXXXXATGDKWYQYFIGRIISGLGVGGIAVLSPTLIS 198
            +LGD+YGRR+GL+              A+ +KWYQYFIGRIISGLGVGGI VLSP LIS
Sbjct: 134 AKLGDMYGRRIGLIVVVVIYTIGIIIQIASINKWYQYFIGRIISGLGVGGITVLSPMLIS 193

Query: 199 ETAPKHLRGTCVAFYQLMITLGIFLGYCTNYGTKTYTNSVQWRVPLGMCFAWAIFMIAGM 258
           E AP  +RGT V+ YQ+MITLGIFLGYCTN+GTK Y+NSVQWRVPLG+CFAWA+FMI GM
Sbjct: 194 EVAPSEMRGTLVSCYQVMITLGIFLGYCTNFGTKNYSNSVQWRVPLGLCFAWALFMIGGM 253

Query: 259 LLVPESPRFLIEKGRFEEARRSIAKSNKLTVEDPGVSAEVELINAGVEAEKLAGSATWGE 318
           + VPESPR+L+E GR +EAR S+AK NK   + P +  E+E I A VE  + AG+A+WGE
Sbjct: 254 MFVPESPRYLVEAGRIDEARASLAKVNKCPPDHPYIQYELETIEASVEEMRAAGTASWGE 313

Query: 319 LFSSKGKILQRVIMGVMIQSLQQLTGNNYFFYYGTTIFQAVGMDDSFQTSIVLGIVNFAS 378
           LF+ K  + QR +MG+MIQSLQQLTG+NYFFYYGT +FQAVG+ DSF+TSIV G+VNF S
Sbjct: 314 LFTGKPAMFQRTMMGIMIQSLQQLTGDNYFFYYGTIVFQAVGLSDSFETSIVFGVVNFFS 373

Query: 379 TFVGLWTVEKFGRRKCLLWGSASMASCFVVFASVGVTRLWPNGQDQPSSKGAGNCMIVXX 438
           T   L+TV++FGRR CL+WG+  M  C+VV+ASVGVTRLWPNGQDQPSSKGAGNCMIV  
Sbjct: 374 TCCSLYTVDRFGRRNCLMWGAVGMVCCYVVYASVGVTRLWPNGQDQPSSKGAGNCMIVFA 433

Query: 439 XXXXXXXXXXWAPIAYVIVSESYPLRVKNRAMAISVGSNWIWGFLIGFFTPFITSAINFY 498
                     WAPIAYV++SE +PLRVK++ M+I+  +NWIWGFLI FFTPFIT AINFY
Sbjct: 434 CFYIFCFATTWAPIAYVVISECFPLRVKSKCMSIASAANWIWGFLISFFTPFITGAINFY 493

Query: 499 YGYVFMGCLXXXXXXXXXXXCETKGLTLEEVNEMYEEGVLPWKSDSWLPAGRRGTDYNTE 558
           YGYVFMGC+            ETKGL+LEEVN+MY EGVLPWKS SW+P  +RG DYN +
Sbjct: 494 YGYVFMGCMVFAYFYVFFFVPETKGLSLEEVNDMYAEGVLPWKSASWVPVSKRGADYNAD 553

Query: 559 EAHTDDKPLYKRFL 572
           +   DD+P YK   
Sbjct: 554 DLMHDDQPFYKSLF 567

>YDR345C (HXT3) [1172] chr4 complement(1162947..1164650)
           Low-affinity hexose transporter, member of the hexose
           transporter family of the major facilitator superfamily
           (MFS) [1704 bp, 567 aa]
          Length = 567

 Score =  694 bits (1790), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 335/555 (60%), Positives = 412/555 (74%), Gaps = 5/555 (0%)

Query: 20  ASKDSDSALQLNLQT--STPSNKASRDDFDLKPENEHFPEIPQKKLSEYILVMCLCLMVA 77
           +S++S++ L  N     + P  K  +DDF  + E +     P      Y+ V   C+MVA
Sbjct: 13  SSENSNADLPSNSSQVMNMPEEKGVQDDF--QAEADQVLTNPNTGKGAYVTVSICCVMVA 70

Query: 78  FGGFVFGWDTGTISGFVNMTDFKRRFGNYSQSEGTYYLSNVRTGLIVAIFNIGCAFGGLT 137
           FGGFVFGWDTGTISGFV  TDF RRFG     +G+YYLS VRTGLIV+IFNIGCA GG+ 
Sbjct: 71  FGGFVFGWDTGTISGFVAQTDFLRRFG-MKHKDGSYYLSKVRTGLIVSIFNIGCAIGGII 129

Query: 138 LGRLGDIYGRRLGLMCXXXXXXXXXXXXXATGDKWYQYFIGRIISGLGVGGIAVLSPTLI 197
           L +LGD+YGR++GL+              A+ +KWYQYFIGRIISGLGVGGIAVLSP LI
Sbjct: 130 LAKLGDMYGRKMGLIVVVVIYIIGIIIQIASINKWYQYFIGRIISGLGVGGIAVLSPMLI 189

Query: 198 SETAPKHLRGTCVAFYQLMITLGIFLGYCTNYGTKTYTNSVQWRVPLGMCFAWAIFMIAG 257
           SE APK +RGT V+ YQLMITLGIFLGYCTN+GTK Y+NSVQWRVPLG+CFAWA+FMI G
Sbjct: 190 SEVAPKEMRGTLVSCYQLMITLGIFLGYCTNFGTKNYSNSVQWRVPLGLCFAWALFMIGG 249

Query: 258 MLLVPESPRFLIEKGRFEEARRSIAKSNKLTVEDPGVSAEVELINAGVEAEKLAGSATWG 317
           M  VPESPR+L+E G+ +EAR S++K NK+  + P +  E+E+I A VE  + AGSA+WG
Sbjct: 250 MTFVPESPRYLVEAGQIDEARASLSKVNKVAPDHPFIQQELEVIEASVEEARAAGSASWG 309

Query: 318 ELFSSKGKILQRVIMGVMIQSLQQLTGNNYFFYYGTTIFQAVGMDDSFQTSIVLGIVNFA 377
           ELF+ K  + +R +MG+MIQSLQQLTG+NYFFYYGTT+F AVGM DSF+TSIV G+VNF 
Sbjct: 310 ELFTGKPAMFKRTMMGIMIQSLQQLTGDNYFFYYGTTVFNAVGMSDSFETSIVFGVVNFF 369

Query: 378 STFVGLWTVEKFGRRKCLLWGSASMASCFVVFASVGVTRLWPNGQDQPSSKGAGNCMIVX 437
           ST   L+TV++FGRR CLL+G+  M  C+VV+ASVGVTRLWPNG+   SSKGAGNCMIV 
Sbjct: 370 STCCSLYTVDRFGRRNCLLYGAIGMVCCYVVYASVGVTRLWPNGEGNGSSKGAGNCMIVF 429

Query: 438 XXXXXXXXXXXWAPIAYVIVSESYPLRVKNRAMAISVGSNWIWGFLIGFFTPFITSAINF 497
                      WAPIAYV++SE++PLRVK++AM+I+  +NW+WGFLIGFFTPFIT AINF
Sbjct: 430 ACFYIFCFATTWAPIAYVVISETFPLRVKSKAMSIATAANWLWGFLIGFFTPFITGAINF 489

Query: 498 YYGYVFMGCLXXXXXXXXXXXCETKGLTLEEVNEMYEEGVLPWKSDSWLPAGRRGTDYNT 557
           YYGYVFMGC+            ETKGLTLEEVN+MY EGVLPWKS SW+P  +RG +Y+ 
Sbjct: 490 YYGYVFMGCMVFAYFYVFFFVPETKGLTLEEVNDMYAEGVLPWKSASWVPTSQRGANYDA 549

Query: 558 EEAHTDDKPLYKRFL 572
           +    DD+P YK+  
Sbjct: 550 DALMHDDQPFYKKMF 564

>AFL205C [2990] [Homologous to ScYHR094C - SH] (49039..50679) [1641
           bp, 546 aa]
          Length = 546

 Score =  692 bits (1786), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 341/565 (60%), Positives = 418/565 (73%), Gaps = 23/565 (4%)

Query: 1   MSTSVTPIDNRSVASGKVGASKDSDSALQLNLQTSTPSNKASRDDFDLKPENEHFPEIPQ 60
           MS ++   DNRSV                ++  +ST SNK S+++     +     EIP 
Sbjct: 1   MSAAIAQPDNRSV----------------MSTHSSTASNKPSKEE----NKESGLVEIPV 40

Query: 61  KKLSEYILVMCLCLMVAFGGFVFGWDTGTISGFVNMTDFKRRFGNYSQSEGTYYLSNVRT 120
           K  S YI V  LC++VAFGGF+FGWDTGTISGFVN +D+K RFG  ++S G YYLS+ RT
Sbjct: 41  KPASAYITVSLLCILVAFGGFIFGWDTGTISGFVNQSDYKNRFGELNES-GDYYLSDNRT 99

Query: 121 GLIVAIFNIGCAFGGLTLGRLGDIYGRRLGLMCXXXXXXXXXXXXXATGDKWYQYFIGRI 180
           GLIVAIFNIGCA GG+ L +  D+YGRR+GLM              ++ DKWYQY IGR+
Sbjct: 100 GLIVAIFNIGCAVGGIFLSKFADMYGRRIGLMIVTLVYVIGIVVQISSTDKWYQYCIGRV 159

Query: 181 ISGLGVGGIAVLSPTLISETAPKHLRGTCVAFYQLMITLGIFLGYCTNYGTKT-YTNSVQ 239
           ISGLGVGGIAVLSP LISET+PKHLRG  V+ YQLMIT GIF+GYC NYGTK  Y +S Q
Sbjct: 160 ISGLGVGGIAVLSPMLISETSPKHLRGMLVSCYQLMITAGIFVGYCANYGTKAKYEDSKQ 219

Query: 240 WRVPLGMCFAWAIFMIAGMLLVPESPRFLIEKGRFEEARRSIAKSNKLTVEDPGVSAEVE 299
           WR+PLG+ FAWAI MI GM+LVPESPR+L+E  ++E+A+RS+A+SNK+ V+DP + AE +
Sbjct: 220 WRIPLGLSFAWAILMIGGMVLVPESPRYLVEVNKYEDAKRSLARSNKVPVDDPSIQAEFD 279

Query: 300 LINAGVEAEKLAGSATWGELFSSKGKILQRVIMGVMIQSLQQLTGNNYFFYYGTTIFQAV 359
            I+AG+E E++AGSA+WGELFS+K KILQRVIMGVMIQSLQQLTGNNYFFYYGTTIF++V
Sbjct: 280 NIHAGIELERMAGSASWGELFSTKSKILQRVIMGVMIQSLQQLTGNNYFFYYGTTIFKSV 339

Query: 360 GMDDSFQTSIVLGIVNFASTFVGLWTVEKFGRRKCLLWGSASMASCFVVFASVGVTRLWP 419
           G++DSFQTSI+LG VNF STFV +W V KFGRR+ +L G+A+M  C V+FAS+GVT+LWP
Sbjct: 340 GLEDSFQTSIILGAVNFGSTFVAVWAVGKFGRRRLMLAGAAAMTVCMVIFASIGVTKLWP 399

Query: 420 NGQDQPSSKGAGNCMIVXXXXXXXXXXXXWAPIAYVIVSESYPLRVKNRAMAISVGSNWI 479
           NG+DQPSSK AGN MIV            WAPI +VIVSE++PLRVK + MAI+  +NWI
Sbjct: 400 NGEDQPSSKPAGNVMIVFTCIYIFCFATTWAPIPFVIVSETFPLRVKAKGMAIATAANWI 459

Query: 480 WGFLIGFFTPFITSAINFYYGYVFMGCLXXXXXXXXXXXCETKGLTLEEVNEMYEEGVLP 539
           WGFLI FFTP IT+AI F YGYVFMGCL            ETKGLTLEEV EM++EGV+P
Sbjct: 460 WGFLIAFFTPKITNAIKFNYGYVFMGCLIFAFFYMFFFVPETKGLTLEEVEEMWQEGVVP 519

Query: 540 WKSDSWLPAGRRGTDYNTEEAHTDD 564
           WKS+SW P+ +R   Y TEE   + 
Sbjct: 520 WKSESWTPSYKRNA-YETEEVKPEK 543

>CAGL0A02321g complement(247500..249170) highly similar to sp|P32466
           Saccharomyces cerevisiae YDR345c HXT3 or sp|P42833
           Saccharomyces cerevisiae YNL318c HXT14, hypothetical
           start
          Length = 556

 Score =  686 bits (1771), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 337/554 (60%), Positives = 400/554 (72%), Gaps = 3/554 (0%)

Query: 20  ASKDSDSALQLNLQTSTPSNKASRDDFDLKP-ENEHFPEIPQKKLSEYILVMCLCLMVAF 78
           +S + DS    N  +    N   RDD D    E E   E P  K S YI V   C +VAF
Sbjct: 2   SSSNKDSESFENYPSQNSDNSYKRDDLDPDTLEKEAKIENPNGK-SAYIAVSISCALVAF 60

Query: 79  GGFVFGWDTGTISGFVNMTDFKRRFGNYSQSEGTYYLSNVRTGLIVAIFNIGCAFGGLTL 138
           GGF+FGWDTGTISGFVN TDF RR G+   ++GT YLS VRTGL+V IFNIGCA GG+ L
Sbjct: 61  GGFIFGWDTGTISGFVNQTDFIRRIGS-KHADGTSYLSKVRTGLVVGIFNIGCAIGGVVL 119

Query: 139 GRLGDIYGRRLGLMCXXXXXXXXXXXXXATGDKWYQYFIGRIISGLGVGGIAVLSPTLIS 198
            ++GD  GR+ GL+              AT DKWYQYFIGRIISGLGVGGI+VLSPTLIS
Sbjct: 120 SKIGDTKGRKAGLVTVVLIYIVGIVIQIATIDKWYQYFIGRIISGLGVGGISVLSPTLIS 179

Query: 199 ETAPKHLRGTCVAFYQLMITLGIFLGYCTNYGTKTYTNSVQWRVPLGMCFAWAIFMIAGM 258
           E APK LRG+ V+ YQ+MITLGIFLGYCTNYGTK Y+NSVQWRVPLG+CFAWA+ MI GM
Sbjct: 180 EVAPKELRGSLVSLYQIMITLGIFLGYCTNYGTKNYSNSVQWRVPLGLCFAWALLMIGGM 239

Query: 259 LLVPESPRFLIEKGRFEEARRSIAKSNKLTVEDPGVSAEVELINAGVEAEKLAGSATWGE 318
             VPESPR+LIE G  + AR+S+  +NKL  E P +  E  ++ A VE    AG+A+W E
Sbjct: 240 TFVPESPRYLIEAGDDDAARKSLCAANKLPAEHPFIEQEFTILKAKVEEANAAGTASWSE 299

Query: 319 LFSSKGKILQRVIMGVMIQSLQQLTGNNYFFYYGTTIFQAVGMDDSFQTSIVLGIVNFAS 378
           L + K  +L+R IMG+MIQSLQQLTG+NYFFYYGTT+F+AVG++DSFQTSIV G+VNF S
Sbjct: 300 LITGKPAMLRRTIMGIMIQSLQQLTGDNYFFYYGTTVFKAVGLEDSFQTSIVFGVVNFFS 359

Query: 379 TFVGLWTVEKFGRRKCLLWGSASMASCFVVFASVGVTRLWPNGQDQPSSKGAGNCMIVXX 438
           TF+ L+TV++FGRR CLL+G+A M  C+VV+ASVGVTRLWPNGQ   SSKGAGNCMIV  
Sbjct: 360 TFLSLFTVDRFGRRNCLLYGAAGMVCCYVVYASVGVTRLWPNGQGNGSSKGAGNCMIVFS 419

Query: 439 XXXXXXXXXXWAPIAYVIVSESYPLRVKNRAMAISVGSNWIWGFLIGFFTPFITSAINFY 498
                     WAPIAYVI+SES+PLR+K +AM+I+  SNWIWGFLI FFTPFIT+AINFY
Sbjct: 420 CFYIFCFATTWAPIAYVIISESFPLRIKTKAMSIASASNWIWGFLIAFFTPFITNAINFY 479

Query: 499 YGYVFMGCLXXXXXXXXXXXCETKGLTLEEVNEMYEEGVLPWKSDSWLPAGRRGTDYNTE 558
           YGYVFMGC+            ET+GLTLEEV+EMY EGVLPWKS  W+P   R   Y+ +
Sbjct: 480 YGYVFMGCMVFAYFYVFFFVNETRGLTLEEVDEMYAEGVLPWKSSKWVPESERDDSYDAD 539

Query: 559 EAHTDDKPLYKRFL 572
               DD P YKR +
Sbjct: 540 ALLHDDTPWYKRVI 553

>Scas_712.1
          Length = 558

 Score =  686 bits (1771), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 331/546 (60%), Positives = 399/546 (73%), Gaps = 3/546 (0%)

Query: 29  QLNLQTSTPSNK--ASRDDFDLKPENEHFPEIPQKKLSEYILVMCLCLMVAFGGFVFGWD 86
            L+   S  SN+    +D  DL+   +H  +IPQK  S YI V   CLMVAFGGF+ GWD
Sbjct: 11  NLSASVSVHSNQDGLKKDLSDLETNEQHVIDIPQKPASAYIAVCIFCLMVAFGGFISGWD 70

Query: 87  TGTISGFVNMTDFKRRFGNYSQSEGTYYLSNVRTGLIVAIFNIGCAFGGLTLGRLGDIYG 146
           TGTI GF+   DF  RFG+   S+GT Y SNVRTGL+V+IFNIGC  G + LGRLGD+YG
Sbjct: 71  TGTIGGFLAHPDFVGRFGS-KHSDGTPYFSNVRTGLLVSIFNIGCCVGAVFLGRLGDMYG 129

Query: 147 RRLGLMCXXXXXXXXXXXXXATGDKWYQYFIGRIISGLGVGGIAVLSPTLISETAPKHLR 206
           RR+G++              A+ DKWYQYFIGRI++GLG G IAVLSP LISE +PKHLR
Sbjct: 130 RRIGIVLAVIIYIVGIVIQIASVDKWYQYFIGRIVAGLGSGTIAVLSPMLISEVSPKHLR 189

Query: 207 GTCVAFYQLMITLGIFLGYCTNYGTKTYTNSVQWRVPLGMCFAWAIFMIAGMLLVPESPR 266
           GT V+ YQLMIT GIFLGYC NYGTK Y NS+QWRVPLG+CFAWA+F+IA M  VPESPR
Sbjct: 190 GTLVSCYQLMITFGIFLGYCANYGTKKYNNSIQWRVPLGLCFAWALFLIAAMFFVPESPR 249

Query: 267 FLIEKGRFEEARRSIAKSNKLTVEDPGVSAEVELINAGVEAEKLAGSATWGELFSSKGKI 326
           +L+E G+ EEA+RS+A+SNK++++DP   AEVE+I   VE+E+ AGSA+WGELF +K K+
Sbjct: 250 YLVEAGKIEEAKRSVAQSNKVSIDDPATIAEVEIIQVAVESERAAGSASWGELFQTKTKV 309

Query: 327 LQRVIMGVMIQSLQQLTGNNYFFYYGTTIFQAVGMDDSFQTSIVLGIVNFASTFVGLWTV 386
           L R IM VM+ +LQQLTG NYFFYYGT +F AVGM DS++TSIV GIVNFASTFV L+ V
Sbjct: 310 LPRTIMCVMVLALQQLTGCNYFFYYGTIVFNAVGMSDSYETSIVFGIVNFASTFVALYVV 369

Query: 387 EKFGRRKCLLWGSASMASCFVVFASVGVTRLWPNGQDQPSSKGAGNCMIVXXXXXXXXXX 446
           +KFGRR CLLWG+A M  C VVFASVGV  L P+G D PSSKGAGNCMIV          
Sbjct: 370 DKFGRRTCLLWGAAGMVCCMVVFASVGVKSLHPHGDDGPSSKGAGNCMIVFSCFFIFCFA 429

Query: 447 XXWAPIAYVIVSESYPLRVKNRAMAISVGSNWIWGFLIGFFTPFITSAINFYYGYVFMGC 506
             WAPI +VIVSES+P ++K + MAI   SN +W F IGFFTPFIT AI+FYYGYVF+GC
Sbjct: 430 TSWAPIPFVIVSESFPTKIKAKGMAIGTVSNQLWNFCIGFFTPFITGAIDFYYGYVFLGC 489

Query: 507 LXXXXXXXXXXXCETKGLTLEEVNEMYEEGVLPWKSDSWLPAGRRGTDYNTEEAHTDDKP 566
           L            ETKGL LE+VN M+EEGVLPWKS +W+P  +RG DY+ +E   DDKP
Sbjct: 490 LVFAYCYVFMFVPETKGLQLEDVNIMWEEGVLPWKSSAWVPPSQRGADYDAQELANDDKP 549

Query: 567 LYKRFL 572
            +KR +
Sbjct: 550 AWKRMV 555

>Scas_541.7
          Length = 591

 Score =  685 bits (1767), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 330/557 (59%), Positives = 405/557 (72%), Gaps = 7/557 (1%)

Query: 22  KDSDSALQLNLQTSTPSNKASRDDFDLKP------ENEHFPEIPQKKLSEYILVMCLCLM 75
           K     + +   +S P ++ + + F  K       + E   ++  K   +   V   C+M
Sbjct: 33  KTDAQTIPITQGSSVPRSQGTSNSFTTKEDQMSELQKEADSQLESKPRKDLFFVCLCCIM 92

Query: 76  VAFGGFVFGWDTGTISGFVNMTDFKRRFGNYSQSEGTYYLSNVRTGLIVAIFNIGCAFGG 135
           V+FGGF+FGWDTGTISGF+  TDF RRFG  +++ GT+YLS VRTGLIV+IFNIG A GG
Sbjct: 93  VSFGGFIFGWDTGTISGFIRQTDFIRRFGQ-TRANGTHYLSTVRTGLIVSIFNIGAAIGG 151

Query: 136 LTLGRLGDIYGRRLGLMCXXXXXXXXXXXXXATGDKWYQYFIGRIISGLGVGGIAVLSPT 195
           +TL + GD++GRRLGL+               + +KWYQYFIGRIISGLGVGGI VL+P 
Sbjct: 152 ITLSKTGDMWGRRLGLITVIGIYIVGILIQITSFNKWYQYFIGRIISGLGVGGITVLAPM 211

Query: 196 LISETAPKHLRGTCVAFYQLMITLGIFLGYCTNYGTKTYTNSVQWRVPLGMCFAWAIFMI 255
           LISE APK LRGT V+ YQLMITLGIFLGYCTN+GTK Y+NSVQWRVPLG+CFAWA+FMI
Sbjct: 212 LISEVAPKKLRGTMVSCYQLMITLGIFLGYCTNFGTKNYSNSVQWRVPLGLCFAWALFMI 271

Query: 256 AGMLLVPESPRFLIEKGRFEEARRSIAKSNKLTVEDPGVSAEVELINAGVEAEKLAGSAT 315
           +GM LVPESPR+L+E G+  EARR +A+ NK++ + P V  E+E   + VEAE+LAG+A+
Sbjct: 272 SGMTLVPESPRYLVEVGKIAEARRGLARVNKVSEDSPLVQLELEKYESSVEAERLAGNAS 331

Query: 316 WGELFSSKGKILQRVIMGVMIQSLQQLTGNNYFFYYGTTIFQAVGMDDSFQTSIVLGIVN 375
           WGEL + K  +L+R IMG+MIQSLQQLTG NYFFYYGTTIFQAVG+ DSF+T+IVLG+VN
Sbjct: 332 WGELVTGKPAMLRRTIMGMMIQSLQQLTGANYFFYYGTTIFQAVGLSDSFETAIVLGVVN 391

Query: 376 FASTFVGLWTVEKFGRRKCLLWGSASMASCFVVFASVGVTRLWPNGQDQPSSKGAGNCMI 435
           F STF  L+ V+ +GRR CLLWG   M  C+VV+ASVGVTRL PNG + P+SKGAGNCMI
Sbjct: 392 FVSTFFALYFVDHYGRRLCLLWGCVGMVCCYVVYASVGVTRLHPNGMNNPTSKGAGNCMI 451

Query: 436 VXXXXXXXXXXXXWAPIAYVIVSESYPLRVKNRAMAISVGSNWIWGFLIGFFTPFITSAI 495
           V            WAPIAYV+ SE+YPLRV+ +AM+I+   NWIWGFLI FFTPFITSAI
Sbjct: 452 VFACFFIFCFATTWAPIAYVVTSETYPLRVRGKAMSIASACNWIWGFLISFFTPFITSAI 511

Query: 496 NFYYGYVFMGCLXXXXXXXXXXXCETKGLTLEEVNEMYEEGVLPWKSDSWLPAGRRGTDY 555
           NF YGYVFMGC+            ETKGLTLEEVNEMYEEGVLPWKS SW+P  +R  DY
Sbjct: 512 NFSYGYVFMGCMVFAFFFVFFFVPETKGLTLEEVNEMYEEGVLPWKSSSWVPPSKRTADY 571

Query: 556 NTEEAHTDDKPLYKRFL 572
           + +    D +P YK+ L
Sbjct: 572 DIDALQQDTRPFYKKIL 588

>Scas_628.7
          Length = 593

 Score =  683 bits (1762), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 339/529 (64%), Positives = 396/529 (74%), Gaps = 6/529 (1%)

Query: 34  TSTPSNKASRDDFDLKPENEHF----PEIPQKKLSEYILVMCLCLMVAFGGFVFGWDTGT 89
           T T ++  S D   ++P+ E      P I  K  + Y  V+ LCL++AFGGF+FGWDTGT
Sbjct: 5   TETTTSPPSEDSAQIEPKEEFIMDTEPSIA-KPAASYFTVIILCLLIAFGGFIFGWDTGT 63

Query: 90  ISGFVNMTDFKRRFGNYSQSEGTYYLSNVRTGLIVAIFNIGCAFGGLTLGRLGDIYGRRL 149
           ISGFV  TDF +RFG   QS+G++ LS+VR GL+V IFNIGC  GGL L   GD +GR+ 
Sbjct: 64  ISGFVAQTDFIKRFGT-QQSDGSFALSDVRKGLMVGIFNIGCLLGGLFLAGAGDKWGRKP 122

Query: 150 GLMCXXXXXXXXXXXXXATGDKWYQYFIGRIISGLGVGGIAVLSPTLISETAPKHLRGTC 209
           GLM               +  KWYQYF+GRI+SG+GVGGIAVLSPTLISE APK LRGTC
Sbjct: 123 GLMLVAAVYVVGIIIQITSSTKWYQYFVGRIVSGMGVGGIAVLSPTLISEIAPKQLRGTC 182

Query: 210 VAFYQLMITLGIFLGYCTNYGTKTYTNSVQWRVPLGMCFAWAIFMIAGMLLVPESPRFLI 269
           ++ YQLMIT GIFLGYC N+GTK Y N+VQWR+PLG+ FAWA FMI G+L VPESPR+L 
Sbjct: 183 ISLYQLMITGGIFLGYCANFGTKRYNNAVQWRLPLGLGFAWAFFMIIGLLFVPESPRYLF 242

Query: 270 EKGRFEEARRSIAKSNKLTVEDPGVSAEVELINAGVEAEKLAGSATWGELFSSKGKILQR 329
           +KG+   A+ S+AKSNK TV+D  V +E++ I AG+EAE  AG+A+W ELFS K KI QR
Sbjct: 243 KKGKISAAKHSLAKSNKTTVDDILVLSELDNIRAGIEAENNAGNASWKELFSLKNKIFQR 302

Query: 330 VIMGVMIQSLQQLTGNNYFFYYGTTIFQAVGMDDSFQTSIVLGIVNFASTFVGLWTVEKF 389
           V MGVMIQSLQQLTG NYFFYYGTTIFQAVGMDDSF TSIVLG+VNFASTF+ L  VE  
Sbjct: 303 VFMGVMIQSLQQLTGCNYFFYYGTTIFQAVGMDDSFVTSIVLGVVNFASTFIALGIVEWL 362

Query: 390 GRRKCLLWGSASMASCFVVFASVGVTRLWPNGQDQPSSKGAGNCMIVXXXXXXXXXXXXW 449
           GRRKCLL GSASMA CFV+FASVGVTRLWPNG+DQP+SKGAG+CMIV            W
Sbjct: 363 GRRKCLLLGSASMACCFVIFASVGVTRLWPNGKDQPTSKGAGDCMIVFTCIFIFCFATTW 422

Query: 450 APIAYVIVSESYPLRVKNRAMAISVGSNWIWGFLIGFFTPFITSAINFYYGYVFMGCLXX 509
           API +VIV+ESYPLRVK RAMAI++G+NWIWGFLIGFFTPFITSAINFYYG+VFMGCL  
Sbjct: 423 APIGFVIVAESYPLRVKQRAMAIAIGANWIWGFLIGFFTPFITSAINFYYGFVFMGCLIF 482

Query: 510 XXXXXXXXXCETKGLTLEEVNEMYEEGVLPWKSDSWLPAGRRGTDYNTE 558
                     ETKGLTLEEV+EMY E + PWKS SW P  RR   Y+ +
Sbjct: 483 SFFYVFFFVRETKGLTLEEVDEMYLENIKPWKSASWSPRNRRDGAYDND 531

>CAGL0A01804g complement(175488..177179) highly similar to sp|P32466
           Saccharomyces cerevisiae YDR345c HXT3, start by
           similarity
          Length = 563

 Score =  674 bits (1738), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 329/552 (59%), Positives = 403/552 (73%), Gaps = 3/552 (0%)

Query: 20  ASKDSDSALQLNLQTSTPSNKASRDDF-DLKPENEHFPEIPQKKLSEYILVMCLCLMVAF 78
           + + S S+ +++   S   N+  ++D  D   +NE     P      ++ V+  C MVAF
Sbjct: 9   SPQKSSSSNEVDSHESKYLNQVGKNDMADEFVQNEMIAN-PNTGKGAFVGVIISCFMVAF 67

Query: 79  GGFVFGWDTGTISGFVNMTDFKRRFGNYSQSEGTYYLSNVRTGLIVAIFNIGCAFGGLTL 138
           GGFVFGWDTGTISGFV   DF  RFG     +GT YLS VRTGLIV+IFNIGCA GG+ L
Sbjct: 68  GGFVFGWDTGTISGFVAQKDFIHRFG-MKHPDGTEYLSKVRTGLIVSIFNIGCAIGGIIL 126

Query: 139 GRLGDIYGRRLGLMCXXXXXXXXXXXXXATGDKWYQYFIGRIISGLGVGGIAVLSPTLIS 198
            +LGD  GR++GL+              A+ +KWYQYFIGRIISGLGVGGI+VLSP LIS
Sbjct: 127 SKLGDTKGRKMGLVVVVVIYIVGIIIQIASINKWYQYFIGRIISGLGVGGISVLSPMLIS 186

Query: 199 ETAPKHLRGTCVAFYQLMITLGIFLGYCTNYGTKTYTNSVQWRVPLGMCFAWAIFMIAGM 258
           E AP  LRG+ V+ YQLMITLGIFLGYCTN+GTK YTNSVQWRVPLG+CFAWA+FMI GM
Sbjct: 187 EVAPSDLRGSLVSCYQLMITLGIFLGYCTNFGTKNYTNSVQWRVPLGLCFAWALFMIGGM 246

Query: 259 LLVPESPRFLIEKGRFEEARRSIAKSNKLTVEDPGVSAEVELINAGVEAEKLAGSATWGE 318
             VPESPR+L+E G+ EEAR S+A+ NK + + P +  E++LI A V+  + AGSA+WGE
Sbjct: 247 TFVPESPRYLVEAGQIEEARSSLARINKCSPDHPYIQQELDLIQASVDEARSAGSASWGE 306

Query: 319 LFSSKGKILQRVIMGVMIQSLQQLTGNNYFFYYGTTIFQAVGMDDSFQTSIVLGIVNFAS 378
           LF+ K  + +R +MG+MIQSLQQLTG+NYFFYYGT +F+AVG++DSF+TSIV G+VNF S
Sbjct: 307 LFTGKPAMFRRTLMGIMIQSLQQLTGDNYFFYYGTIVFKAVGLEDSFETSIVFGVVNFFS 366

Query: 379 TFVGLWTVEKFGRRKCLLWGSASMASCFVVFASVGVTRLWPNGQDQPSSKGAGNCMIVXX 438
           T   L TV++FGRR CLL+G+  M  C+VV+ASVGVTRLWP+GQ   SSKGAGNCMIV  
Sbjct: 367 TCCSLLTVDRFGRRNCLLYGAIGMVCCYVVYASVGVTRLWPHGQGNGSSKGAGNCMIVFS 426

Query: 439 XXXXXXXXXXWAPIAYVIVSESYPLRVKNRAMAISVGSNWIWGFLIGFFTPFITSAINFY 498
                     WAPIAYVI+SE++PLR+K +AM+I+  +NW+WGFLI FFTPFIT+AINFY
Sbjct: 427 CFYIFCFATTWAPIAYVIISETFPLRIKAKAMSIATAANWMWGFLIAFFTPFITNAINFY 486

Query: 499 YGYVFMGCLXXXXXXXXXXXCETKGLTLEEVNEMYEEGVLPWKSDSWLPAGRRGTDYNTE 558
           YGYVFMGC+            ETKGLTLEEVNEMY EGVLPWKS  W+PA RRG DY+ +
Sbjct: 487 YGYVFMGCMVFAYFYVFFFVSETKGLTLEEVNEMYAEGVLPWKSSKWVPASRRGADYDAD 546

Query: 559 EAHTDDKPLYKR 570
               DD P YKR
Sbjct: 547 ALMHDDTPWYKR 558

>Scas_687.4
          Length = 610

 Score =  674 bits (1739), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 331/567 (58%), Positives = 409/567 (72%), Gaps = 12/567 (2%)

Query: 11  RSVASGKVGASKDSDSALQLNLQTSTPSNKASRDDFDLKPE--NEHFPEIPQKKLSEYIL 68
            ++AS +V  +  S S L  N      S KA  + F    E  NE   EIP+K  S Y+ 
Sbjct: 48  ENIASPEVPQTSGSQSVLSDN------SVKAENESFKENSEDANEVVVEIPKKPASAYVT 101

Query: 69  VMCLCLMVAFGGFVFGWDTGTISGFVNMTDFKRRFGNYSQSEGTYYLSNVRTGLIVAIFN 128
           +   C M+ FGGF+ GWDTGTI GF+   D+ RRFG + ++ GT+Y SNVRTGL+V+IFN
Sbjct: 102 ISIFCCMIGFGGFISGWDTGTIGGFLAHPDYLRRFGQHHKN-GTHYFSNVRTGLVVSIFN 160

Query: 129 IGCAFGGLTLGRLGDIYGRRLGLMCXXXXXXXXXXXXXATGDKWYQYFIGRIISGLGVGG 188
           IG  FG L LG L +  GR++ L+              A+ DKWYQYFIGRIISGLGVG 
Sbjct: 161 IGGLFGCLILGDLANRIGRKMALVAVVVIFMVGIIIQIASIDKWYQYFIGRIISGLGVGA 220

Query: 189 IAVLSPTLISETAPKHLRGTCVAFYQLMITLGIFLGYCTNYGTKTYTNSVQWRVPLGMCF 248
           I++ SP L+SE APKHLRGT  + YQLM+T GIFLG CTNYGTK Y NSVQWRVPLG+ F
Sbjct: 221 ISIFSPMLLSEVAPKHLRGTLGSMYQLMVTAGIFLGDCTNYGTKNYDNSVQWRVPLGLSF 280

Query: 249 AWAIFMIAGMLLVPESPRFLIEKGRFEEARRSIAKSNKLTVEDPGVSAEVELINAGVEAE 308
           AW +FMIA M  VPESPR+L+E G+ EEA+RSIA SNK++++DP V AEV+LI++GVEAE
Sbjct: 281 AWCLFMIAAMFFVPESPRYLVEVGKIEEAKRSIATSNKVSMDDPAVQAEVDLISSGVEAE 340

Query: 309 KLAGSATWGELFSSKGKILQRVIMGVMIQSLQQLTGNNYFFYYGTTIFQAVGMDDSFQTS 368
           +LAG+A+WGELFS+KGK +QR+ M  M+Q LQQLTG NYFFYYGT IFQAVGM DS+QT+
Sbjct: 341 RLAGNASWGELFSTKGKNIQRLFMCCMLQCLQQLTGCNYFFYYGTVIFQAVGMKDSYQTA 400

Query: 369 IVLGIVNFASTFVGLWTVEKFGRRKCLLWGSASMASCFVVFASVGVTRLWPNG---QDQP 425
           IV GIVNFASTFV L+ V++FGRRKCL+WG+A+M  C+VV+ASVGVTRL+P+G   +D  
Sbjct: 401 IVFGIVNFASTFVALYVVDRFGRRKCLMWGAAAMVCCYVVYASVGVTRLYPDGIKHKDTN 460

Query: 426 SSKGAGNCMIVXXXXXXXXXXXXWAPIAYVIVSESYPLRVKNRAMAISVGSNWIWGFLIG 485
           SSKGAGNCMI             WAPI +V+VSES+PLR+K + MA++ G NW W FLI 
Sbjct: 461 SSKGAGNCMICFSCFFIFSFACTWAPICWVVVSESFPLRIKPKGMALANGCNWFWNFLIS 520

Query: 486 FFTPFITSAINFYYGYVFMGCLXXXXXXXXXXXCETKGLTLEEVNEMYEEGVLPWKSDSW 545
           FFTPFIT AINFYYGYVFMGC+            E KGLTLEEVNE++E+GVLPWKS  W
Sbjct: 521 FFTPFITGAINFYYGYVFMGCMVFAYFYVFFFVPEMKGLTLEEVNELWEDGVLPWKSPDW 580

Query: 546 LPAGRRGTDYNTEEAHTDDKPLYKRFL 572
           +P+ RRG D + +    DDKPL+K+  
Sbjct: 581 VPSSRRGADVDMDAFQKDDKPLFKKMF 607

>Scas_509.2
          Length = 568

 Score =  667 bits (1720), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 323/543 (59%), Positives = 398/543 (73%), Gaps = 6/543 (1%)

Query: 35  STPSNKASRDDFDLKPE--NEHFPEIPQKKLSEYILVMCLCLMVAFGGFVFGWDTGTISG 92
           S  S KA  + F    +  NE   EIP+K  S Y+ +   C M+ FGGF+ GWDTGTI G
Sbjct: 24  SENSIKAENESFKENSDEGNEVVVEIPKKPASAYVTISIFCCMIGFGGFISGWDTGTIGG 83

Query: 93  FVNMTDFKRRFGNYSQSEGTYYLSNVRTGLIVAIFNIGCAFGGLTLGRLGDIYGRRLGLM 152
           F+   D+ RRFG + ++ GT+Y SNVRTGL+V+IFNIG  FG L LG L +  GR++ L+
Sbjct: 84  FLAHPDYLRRFGQHHKN-GTHYFSNVRTGLVVSIFNIGGLFGCLILGDLANRIGRKMALV 142

Query: 153 CXXXXXXXXXXXXXATGDKWYQYFIGRIISGLGVGGIAVLSPTLISETAPKHLRGTCVAF 212
                         A+ DKWYQYFIGRIISGLGVG I++ SP L+SE APKHLRGT  + 
Sbjct: 143 AVVVIFMVGIIIQIASIDKWYQYFIGRIISGLGVGAISIFSPMLLSEVAPKHLRGTLGSM 202

Query: 213 YQLMITLGIFLGYCTNYGTKTYTNSVQWRVPLGMCFAWAIFMIAGMLLVPESPRFLIEKG 272
           YQLM+T GIFLG CTNYGTK Y NSVQWRVPLG+ FAW +FMIA M  VPESPR+L+E G
Sbjct: 203 YQLMVTAGIFLGDCTNYGTKNYDNSVQWRVPLGLSFAWCLFMIAAMFFVPESPRYLVEVG 262

Query: 273 RFEEARRSIAKSNKLTVEDPGVSAEVELINAGVEAEKLAGSATWGELFSSKGKILQRVIM 332
           + EEA+RSIA SNK++++DP V AEV+LI++GVEAE+LAG+A+W ELFS+KGK +QR+ M
Sbjct: 263 KIEEAKRSIATSNKVSMDDPAVQAEVDLISSGVEAERLAGNASWAELFSTKGKNIQRLFM 322

Query: 333 GVMIQSLQQLTGNNYFFYYGTTIFQAVGMDDSFQTSIVLGIVNFASTFVGLWTVEKFGRR 392
             M+Q LQQLTG NYFFYYGT IFQAVGM DS+QT+IV GIVNFASTFV L+ V++FGRR
Sbjct: 323 CCMLQCLQQLTGCNYFFYYGTVIFQAVGMKDSYQTAIVFGIVNFASTFVALYVVDRFGRR 382

Query: 393 KCLLWGSASMASCFVVFASVGVTRLWPNG---QDQPSSKGAGNCMIVXXXXXXXXXXXXW 449
           KCL+WG+A+M  C+VV+ASVGVTRL+P+G   +D  SSKGAGNCMI             W
Sbjct: 383 KCLMWGAAAMVCCYVVYASVGVTRLYPDGIKHKDTNSSKGAGNCMICFSCFFIFSFACTW 442

Query: 450 APIAYVIVSESYPLRVKNRAMAISVGSNWIWGFLIGFFTPFITSAINFYYGYVFMGCLXX 509
           API +V+VSES+PLR+K + MA++ G NW W FLI FFTPFIT AINFYYGYVFMGC+  
Sbjct: 443 APICWVVVSESFPLRIKPKGMALANGCNWFWNFLISFFTPFITGAINFYYGYVFMGCMVF 502

Query: 510 XXXXXXXXXCETKGLTLEEVNEMYEEGVLPWKSDSWLPAGRRGTDYNTEEAHTDDKPLYK 569
                     E KGLTLEEVNE++E+GVLPWKS  W+P+ RRG D + +    DDKPL+K
Sbjct: 503 AYFYVFFFVPEMKGLTLEEVNELWEDGVLPWKSPDWVPSSRRGADVDMDAFQKDDKPLFK 562

Query: 570 RFL 572
           +  
Sbjct: 563 KMF 565

>Scas_550.9
          Length = 574

 Score =  665 bits (1717), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 321/551 (58%), Positives = 402/551 (72%), Gaps = 15/551 (2%)

Query: 36  TPSNKASRDDFDLKPENEHFPE-----------IPQKKLSEYILVMCLCLMVAFGGFVFG 84
           T  +++   D  +K ENE F E           IP+K  S Y+ +   C M+AFGGF+ G
Sbjct: 22  TSGSQSVLSDNSIKAENESFKENSEDANDVVVEIPKKPASAYVTISIFCCMIAFGGFLSG 81

Query: 85  WDTGTISGFVNMTDFKRRFGNYSQSEGTYYLSNVRTGLIVAIFNIGCAFGGLTLGRLGDI 144
           WDTGTI GF+   D+ RRFG + + +GT+Y SNVRTGL+V+IFNIG   G L LG L + 
Sbjct: 82  WDTGTIGGFLAHPDYLRRFGQHHK-DGTHYFSNVRTGLVVSIFNIGGLIGCLVLGDLANR 140

Query: 145 YGRRLGLMCXXXXXXXXXXXXXATGDKWYQYFIGRIISGLGVGGIAVLSPTLISETAPKH 204
            GR++ L+              A+ +KWYQYFIGRIISGLGVG I++ SP L+SE APKH
Sbjct: 141 IGRKMALVAVVIIFMVGLIIQIASINKWYQYFIGRIISGLGVGAISIFSPMLLSEVAPKH 200

Query: 205 LRGTCVAFYQLMITLGIFLGYCTNYGTKTYTNSVQWRVPLGMCFAWAIFMIAGMLLVPES 264
           LRGT  + YQLM+T+GIFLG CTNYGTK Y+NSVQWRVPLG+ FAW +FMIA M  VPES
Sbjct: 201 LRGTLGSMYQLMVTMGIFLGDCTNYGTKKYSNSVQWRVPLGLSFAWCLFMIAAMFFVPES 260

Query: 265 PRFLIEKGRFEEARRSIAKSNKLTVEDPGVSAEVELINAGVEAEKLAGSATWGELFSSKG 324
           PR+L+E G+ EEA+RSIA SN+++++DP V AEV+LI++GVEAE+LAG+A+W ELFS+KG
Sbjct: 261 PRYLVEVGKVEEAKRSIATSNQVSIDDPAVQAEVDLISSGVEAERLAGNASWVELFSTKG 320

Query: 325 KILQRVIMGVMIQSLQQLTGNNYFFYYGTTIFQAVGMDDSFQTSIVLGIVNFASTFVGLW 384
           K +QR+ M  M+Q LQQLTG NYFFYYGT IFQAVGM DS+QT+IV GIVNFASTFV L+
Sbjct: 321 KNIQRLFMCCMLQCLQQLTGCNYFFYYGTVIFQAVGMKDSYQTAIVFGIVNFASTFVALY 380

Query: 385 TVEKFGRRKCLLWGSASMASCFVVFASVGVTRLWPNG---QDQPSSKGAGNCMIVXXXXX 441
            V++FGRRKCL+WG+A+M  C+VV+ASVGVTRL+P+G   +D  SSKGAGNCMI      
Sbjct: 381 VVDRFGRRKCLMWGAAAMVCCYVVYASVGVTRLYPDGIKHKDTNSSKGAGNCMICFSCFF 440

Query: 442 XXXXXXXWAPIAYVIVSESYPLRVKNRAMAISVGSNWIWGFLIGFFTPFITSAINFYYGY 501
                  WAPI +V+VSES+PLR+K + MA++ G NW W FLI FFTPFIT AINFYYGY
Sbjct: 441 IFCFACTWAPICWVVVSESFPLRIKPKGMALANGCNWFWNFLISFFTPFITGAINFYYGY 500

Query: 502 VFMGCLXXXXXXXXXXXCETKGLTLEEVNEMYEEGVLPWKSDSWLPAGRRGTDYNTEEAH 561
           VFMGC+            E KGLTLEEVNE++E+GVLPWKS  W+P+ RRG D + +   
Sbjct: 501 VFMGCMVFAYFYVFFFVPEMKGLTLEEVNELWEDGVLPWKSPDWVPSSRRGADVDMDAFQ 560

Query: 562 TDDKPLYKRFL 572
            DDKPL+K+  
Sbjct: 561 KDDKPLFKKMF 571

>Kwal_26.6686
          Length = 569

 Score =  661 bits (1705), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 321/522 (61%), Positives = 392/522 (75%), Gaps = 4/522 (0%)

Query: 51  ENEHFPEIPQKKLSEYILVMCLCLMVAFGGFVFGWDTGTISGFVNMTDFKRRFGNYSQSE 110
           E E  P I +K  S Y+ V  LC++V+FGGF+ GWDTG ++GFVNM DFK+RFG+Y+   
Sbjct: 48  EPEFQPTIEKKPASAYLTVSLLCVLVSFGGFLPGWDTGIMAGFVNMDDFKQRFGSYNHKT 107

Query: 111 GTYYLSNVRTGLIVAIFNIGCAFGGLTLGRLGDIYGRRLGLMCXXXXXXXXXXXXXATGD 170
            TYYLSNVRTGL+VAIF+ GCAFGGLTL +LGDIYGRRLGLM              +  D
Sbjct: 108 ETYYLSNVRTGLLVAIFSAGCAFGGLTLPKLGDIYGRRLGLMIVIVLYVVGTIIQISAQD 167

Query: 171 KWYQYFIGRIISGLGVGGIAVLSPTLISETAPKHLRGTCVAFYQLMITLGIFLGYCTNYG 230
           KWYQYFIG+II G GVGG++VL+P LISETAPKHLRGT ++ YQLM+T GIFLGYC  YG
Sbjct: 168 KWYQYFIGKIIYGWGVGGVSVLAPMLISETAPKHLRGTLISCYQLMVTFGIFLGYCAVYG 227

Query: 231 TKTYTNSVQWRVPLGMCFAWAIFMIAGMLLVPESPRFLIEKGRFEEARRSIAKSNKLTVE 290
           T+ Y +S QWR+P+G+CF WA+ +I GM  VPESPRFL+E GR EEA+RS+A+SNK+  E
Sbjct: 228 TRKYNSSAQWRIPVGLCFLWAMIIIGGMTFVPESPRFLVEVGRMEEAKRSVARSNKVDPE 287

Query: 291 DPGVSAEVELINAGVEAEKLAGSATWGELFSSKGKILQRVIMGVMIQSLQQLTGNNYFFY 350
           + GV  E++LI AGVEAE+  G A+WGELFS+K K+LQR+I G+++QS  QLTG NYFFY
Sbjct: 288 EVGVQIEIDLIAAGVEAERQQGKASWGELFSTKTKVLQRLITGILMQSFLQLTGENYFFY 347

Query: 351 YGTTIFQAVGMDDSFQTSIVLGIVNFASTFVGLWTVEKFGRRKCLLWGSASMASCFVVFA 410
           YGTTIF+++G+ DSF+TSIVLGIVNFASTF+ ++ V+ FGRRKCLLWG+A M +C VVFA
Sbjct: 348 YGTTIFKSIGLTDSFETSIVLGIVNFASTFLSMYVVDAFGRRKCLLWGAAGMTACMVVFA 407

Query: 411 SVGVTRLWPNGQDQ-PSSKGAGNCMIVXXXXXXXXXXXXWAPIAYVIVSESYPLRVKNRA 469
           SVGVT LWPNG++   +SKGAGNCMIV            WAPIAYV+V+ES+PLRVK++ 
Sbjct: 408 SVGVTSLWPNGENVGEASKGAGNCMIVFTCFFIFCFATTWAPIAYVVVAESFPLRVKSKC 467

Query: 470 MAISVGSNWIWGFLIGFFTPFITSAINFYYGYVFMGCLXXXXXXXXXXXCETKGLTLEEV 529
           M+IS   NW+W FLIGFFTPFITSAI FYYGYVFMGCL            ET GLTLEEV
Sbjct: 468 MSISTAFNWLWQFLIGFFTPFITSAIKFYYGYVFMGCLVAMFLYVFFFLPETSGLTLEEV 527

Query: 530 NEMYEEGVLPWKSDSWLPAGRR--GTDYNTEEAHTDDKPLYK 569
             +Y+EG+ PW+S  W+P  RR  G      EA    KP YK
Sbjct: 528 QILYDEGIPPWRSADWVPPSRRFDGPSPVDLEAGA-KKPWYK 568

>Scas_552.2
          Length = 572

 Score =  661 bits (1705), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 322/546 (58%), Positives = 397/546 (72%), Gaps = 9/546 (1%)

Query: 35  STPSNKASRDDFDLKPEN-----EHFPEIPQKKLSEYILVMCLCLMVAFGGFVFGWDTGT 89
           S  S K   D F    EN     E   EIP+K  S Y  +   C M+ FGGF+ GWDTGT
Sbjct: 25  SDHSIKDENDSFKENGENGEDANEAVVEIPKKPASAYATISIFCCMIGFGGFISGWDTGT 84

Query: 90  ISGFVNMTDFKRRFGNYSQSEGTYYLSNVRTGLIVAIFNIGCAFGGLTLGRLGDIYGRRL 149
           I GF+   D+ RRFG +   +GT+Y SNVRTGL+V+IFNIG  FG L LG L +  GR++
Sbjct: 85  IGGFLAHPDYLRRFGQHHH-DGTHYFSNVRTGLVVSIFNIGGLFGCLILGDLANRIGRKM 143

Query: 150 GLMCXXXXXXXXXXXXXATGDKWYQYFIGRIISGLGVGGIAVLSPTLISETAPKHLRGTC 209
            L+              A+ +KWYQYFIGRIISGLGVG I++ SP L+SE +PKHLRGT 
Sbjct: 144 ALVVVVIIFMIGIIIQIASINKWYQYFIGRIISGLGVGAISIFSPMLLSEVSPKHLRGTL 203

Query: 210 VAFYQLMITLGIFLGYCTNYGTKTYTNSVQWRVPLGMCFAWAIFMIAGMLLVPESPRFLI 269
            + YQLM+T GIFLG CTNYGTK Y+NSVQWRVPLG+ FAW +FMIA M  VPESPR+L+
Sbjct: 204 GSMYQLMVTAGIFLGDCTNYGTKKYSNSVQWRVPLGLSFAWCLFMIAAMFFVPESPRYLV 263

Query: 270 EKGRFEEARRSIAKSNKLTVEDPGVSAEVELINAGVEAEKLAGSATWGELFSSKGKILQR 329
           E G+ EEA+RSIA SNK++++DP V  EV+LI AGVEAE+LAG+A+WGELFS+KGK +QR
Sbjct: 264 EVGKMEEAKRSIATSNKVSIDDPAVQGEVDLILAGVEAERLAGNASWGELFSTKGKNIQR 323

Query: 330 VIMGVMIQSLQQLTGNNYFFYYGTTIFQAVGMDDSFQTSIVLGIVNFASTFVGLWTVEKF 389
           + M  M+Q LQQLTG NYFFYYGT IFQAVGM DS+QT+IV G+VNFASTFV L+ V++F
Sbjct: 324 LFMCCMLQCLQQLTGCNYFFYYGTVIFQAVGMKDSYQTAIVFGVVNFASTFVALYVVDRF 383

Query: 390 GRRKCLLWGSASMASCFVVFASVGVTRLWPNG---QDQPSSKGAGNCMIVXXXXXXXXXX 446
           GRRKCL+WG+A+M  C+VV+ASVGVTRL+P+G   +D  SSKGAGNCMI           
Sbjct: 384 GRRKCLMWGAAAMVCCYVVYASVGVTRLYPDGIKHKDTNSSKGAGNCMICFSCFFIFCFA 443

Query: 447 XXWAPIAYVIVSESYPLRVKNRAMAISVGSNWIWGFLIGFFTPFITSAINFYYGYVFMGC 506
             WAPI +++VSE++PLR+K + MA++ G NW W FLI FFTPFIT AINFYYGYVFMGC
Sbjct: 444 CTWAPICWIVVSEAFPLRIKPKGMALANGCNWFWNFLISFFTPFITGAINFYYGYVFMGC 503

Query: 507 LXXXXXXXXXXXCETKGLTLEEVNEMYEEGVLPWKSDSWLPAGRRGTDYNTEEAHTDDKP 566
           +            E KGLTLEEVNE++E+GVLPWKS +W+P+ RRG D N +E   DDKP
Sbjct: 504 MVFGYFYVFFFVPEMKGLTLEEVNELWEDGVLPWKSPNWVPSSRRGADVNMDEFQKDDKP 563

Query: 567 LYKRFL 572
           L+K+  
Sbjct: 564 LFKKMF 569

>Scas_455.2*
          Length = 535

 Score =  648 bits (1671), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 312/529 (58%), Positives = 390/529 (73%), Gaps = 1/529 (0%)

Query: 43  RDDFDLKPENEHFPEIPQKKLSEYILVMCLCLMVAFGGFVFGWDTGTISGFVNMTDFKRR 102
           RD++ L        E+P+K LS+YI+   L L VAFGGF+ GWDTGTISG V   DF +R
Sbjct: 7   RDNYLLDYPLAPPEELPKKPLSDYIVACILSLAVAFGGFITGWDTGTISGIVAQEDFIQR 66

Query: 103 FGNYSQSEGTYYLSNVRTGLIVAIFNIGCAFGGLTLGRLGDIYGRRLGLMCXXXXXXXXX 162
           FG   +S G+++LSN RTG+IV++FNIGCA GG+ L R+GD +GR+ GLM          
Sbjct: 67  FGE-RRSNGSHHLSNARTGIIVSLFNIGCAVGGIVLSRVGDKFGRKKGLMVVIVIYIVGV 125

Query: 163 XXXXATGDKWYQYFIGRIISGLGVGGIAVLSPTLISETAPKHLRGTCVAFYQLMITLGIF 222
               +T   WYQYFIGR++SGLGVGGIAVL P LISE +PKHLRGTC++FYQLMIT GIF
Sbjct: 126 IVQISTQKAWYQYFIGRVVSGLGVGGIAVLCPMLISEISPKHLRGTCISFYQLMITAGIF 185

Query: 223 LGYCTNYGTKTYTNSVQWRVPLGMCFAWAIFMIAGMLLVPESPRFLIEKGRFEEARRSIA 282
           LGYCTNYGTK Y NSVQWRVPLG+ FAWA+ MI  +  VPESPRFL E    E+A+RSIA
Sbjct: 186 LGYCTNYGTKDYNNSVQWRVPLGLSFAWALIMIVILFFVPESPRFLCEINDPEKAKRSIA 245

Query: 283 KSNKLTVEDPGVSAEVELINAGVEAEKLAGSATWGELFSSKGKILQRVIMGVMIQSLQQL 342
           K + ++V+DP V  EV+LI +GVE+EKLAGSA+W EL S++ K+ QRVIMG+MI  LQQL
Sbjct: 246 KIHNVSVKDPSVQTEVDLIMSGVESEKLAGSASWRELLSTRTKVRQRVIMGIMILMLQQL 305

Query: 343 TGNNYFFYYGTTIFQAVGMDDSFQTSIVLGIVNFASTFVGLWTVEKFGRRKCLLWGSASM 402
           TG+NYFFYYGT +F++VG++DSFQTSIV G+VNF STF  L+TV+  GRR  LLW  A+M
Sbjct: 306 TGDNYFFYYGTIVFRSVGLNDSFQTSIVFGVVNFFSTFFALYTVDNVGRRLMLLWAGAAM 365

Query: 403 ASCFVVFASVGVTRLWPNGQDQPSSKGAGNCMIVXXXXXXXXXXXXWAPIAYVIVSESYP 462
            +C ++++SVGVTRLWP+G+   SSKGAGNCMIV            WAPI +V+V+ESYP
Sbjct: 366 TACLIIYSSVGVTRLWPHGEGNGSSKGAGNCMIVFTSFYIFCYAMSWAPIPWVLVAESYP 425

Query: 463 LRVKNRAMAISVGSNWIWGFLIGFFTPFITSAINFYYGYVFMGCLXXXXXXXXXXXCETK 522
           +RVK++ MA+S  SNWIWGFLI FFTPFITS+INFYYGYVF+GCL            ETK
Sbjct: 426 IRVKSKCMAVSAASNWIWGFLISFFTPFITSSINFYYGYVFVGCLVFSWFYVFFFIPETK 485

Query: 523 GLTLEEVNEMYEEGVLPWKSDSWLPAGRRGTDYNTEEAHTDDKPLYKRF 571
           GL+LEE+  +++EGV PWKS  W+   +R  DY+ E+   D+ P YK F
Sbjct: 486 GLSLEEIQTLWDEGVAPWKSAKWVRPSKRTYDYDLEKFQKDENPWYKAF 534

>Kwal_55.19582
          Length = 567

 Score =  647 bits (1670), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 315/547 (57%), Positives = 391/547 (71%), Gaps = 8/547 (1%)

Query: 19  GASKDSDSALQLNLQTSTPSNKASRDDFDLKPENEHFPEIPQKKLSEYILVMCLCLMVAF 78
           GAS   DS       T+T   K   D+ +   +     E+P+K  S Y+ V  LC++V+F
Sbjct: 20  GASSVVDS------HTATVPKKFYMDEGN-DGQMADMAELPKKPASAYVTVSLLCVLVSF 72

Query: 79  GGFVFGWDTGTISGFVNMTDFKRRFGNYSQSEGTYYLSNVRTGLIVAIFNIGCAFGGLTL 138
           GGF+ GWDTG ++GFVNM DFKRRFG Y +S   YYLSNVRTGL+VAIF+ GCA GGLTL
Sbjct: 73  GGFLPGWDTGIMAGFVNMDDFKRRFGTYKESTNEYYLSNVRTGLLVAIFSAGCALGGLTL 132

Query: 139 GRLGDIYGRRLGLMCXXXXXXXXXXXXXATGDKWYQYFIGRIISGLGVGGIAVLSPTLIS 198
            +LGDI+GRRL LM              +  DKWYQYFIG+II G GVGG++VL+P LIS
Sbjct: 133 SKLGDIFGRRLALMFVVGVYVVGTIIQISASDKWYQYFIGKIIYGWGVGGVSVLAPMLIS 192

Query: 199 ETAPKHLRGTCVAFYQLMITLGIFLGYCTNYGTKTYTNSVQWRVPLGMCFAWAIFMIAGM 258
           ETAPKHLRGT ++ YQLM+T GIFLGYC  Y T+ Y  S QWR+PLG+ F WA+ ++AGM
Sbjct: 193 ETAPKHLRGTLISCYQLMVTFGIFLGYCVVYATRKYDGSEQWRIPLGLSFLWALIIVAGM 252

Query: 259 LLVPESPRFLIEKGRFEEARRSIAKSNKLTVEDPGVSAEVELINAGVEAEKLAGSATWGE 318
           + VPESPRFL+E GR EEARRSIA SNK  VEDP + AE++LI A VEAEK  G A W E
Sbjct: 253 VFVPESPRFLVEVGRIEEARRSIASSNKTPVEDPAIQAEIDLIAASVEAEKAQGKARWAE 312

Query: 319 LFSSKGKILQRVIMGVMIQSLQQLTGNNYFFYYGTTIFQAVGMDDSFQTSIVLGIVNFAS 378
           LFS+K K+ QR+I G+++QS  QLTG NYFFYYGTTIF+++G+ DSFQTSIVLG VNF S
Sbjct: 313 LFSTKTKVFQRLITGILMQSFLQLTGENYFFYYGTTIFKSIGLTDSFQTSIVLGTVNFFS 372

Query: 379 TFVGLWTVEKFGRRKCLLWGSASMASCFVVFASVGVTRLWPNGQDQ-PSSKGAGNCMIVX 437
           +F+ ++TV+ FGRRKCLLWG+A+M  C V+FASVGVT LWP+G++   +SK AGN MIV 
Sbjct: 373 SFLSMYTVDAFGRRKCLLWGAAAMTVCMVIFASVGVTSLWPHGENVGEASKPAGNVMIVF 432

Query: 438 XXXXXXXXXXXWAPIAYVIVSESYPLRVKNRAMAISVGSNWIWGFLIGFFTPFITSAINF 497
                      WAPIAYV+V+ES+PLRVK++ M+IS   NW+W FLIGFFTPFIT+AI F
Sbjct: 433 TCLFICFFATTWAPIAYVVVAESFPLRVKSKCMSISTAFNWLWQFLIGFFTPFITNAIKF 492

Query: 498 YYGYVFMGCLXXXXXXXXXXXCETKGLTLEEVNEMYEEGVLPWKSDSWLPAGRRGTDYNT 557
           YYGYVFMGCL            ET GLTLEEV  +YEEG+  W+S +W+P  RR  + ++
Sbjct: 493 YYGYVFMGCLVAMFLYVFFFLPETSGLTLEEVQILYEEGIPAWRSANWVPPTRRFENNSS 552

Query: 558 EEAHTDD 564
            +    D
Sbjct: 553 PDETPQD 559

>Kwal_56.22285
          Length = 567

 Score =  644 bits (1660), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 313/547 (57%), Positives = 390/547 (71%), Gaps = 8/547 (1%)

Query: 19  GASKDSDSALQLNLQTSTPSNKASRDDFDLKPENEHFPEIPQKKLSEYILVMCLCLMVAF 78
           GAS   DS       T+T   K   D+ +   +     E+P+K  S Y+ V  LC++V+F
Sbjct: 20  GASSVVDS------HTATVPKKFYMDEGN-DGQMADMAELPKKPASAYVTVSLLCVLVSF 72

Query: 79  GGFVFGWDTGTISGFVNMTDFKRRFGNYSQSEGTYYLSNVRTGLIVAIFNIGCAFGGLTL 138
           GGF+ GWDTG ++GFVNM DFKRRFG Y +S   YYLSNVRTGL+VAIF+ GCA GGLTL
Sbjct: 73  GGFLPGWDTGIMAGFVNMDDFKRRFGTYKESTNEYYLSNVRTGLLVAIFSAGCALGGLTL 132

Query: 139 GRLGDIYGRRLGLMCXXXXXXXXXXXXXATGDKWYQYFIGRIISGLGVGGIAVLSPTLIS 198
            +LGDI+GRRL LM              +  DKWYQYFIG+II G GVGG++VL+P LIS
Sbjct: 133 SKLGDIFGRRLALMFVVGVYVVGTIIQISASDKWYQYFIGKIIYGWGVGGVSVLAPMLIS 192

Query: 199 ETAPKHLRGTCVAFYQLMITLGIFLGYCTNYGTKTYTNSVQWRVPLGMCFAWAIFMIAGM 258
            TAPKH+RGT ++ YQLM+T GIFLGYC  Y T+ Y  S QWR+PLG+ F WA+ ++AGM
Sbjct: 193 LTAPKHVRGTLISCYQLMVTFGIFLGYCVVYATRKYDGSEQWRIPLGLSFLWALIIVAGM 252

Query: 259 LLVPESPRFLIEKGRFEEARRSIAKSNKLTVEDPGVSAEVELINAGVEAEKLAGSATWGE 318
           + VPESPRFL+E GR EEARRSIA SNK  VEDP + AE++LI A VEAEK  G A W E
Sbjct: 253 VFVPESPRFLVEVGRIEEARRSIASSNKTPVEDPAIQAEIDLIAASVEAEKAQGKARWAE 312

Query: 319 LFSSKGKILQRVIMGVMIQSLQQLTGNNYFFYYGTTIFQAVGMDDSFQTSIVLGIVNFAS 378
           LFS+K K+ QR+I G+++QS  QLTG NYFFYYGTTIF+++G+ DSFQTSIVLG VNF S
Sbjct: 313 LFSTKTKVFQRLITGILMQSFLQLTGENYFFYYGTTIFKSIGLTDSFQTSIVLGTVNFFS 372

Query: 379 TFVGLWTVEKFGRRKCLLWGSASMASCFVVFASVGVTRLWPNGQDQ-PSSKGAGNCMIVX 437
           +F+ ++TV+ FGRRKCLLWG+A+M  C V+FASVGVT LWP+G++   +SK AGN MIV 
Sbjct: 373 SFLSMYTVDAFGRRKCLLWGAAAMTVCMVIFASVGVTSLWPHGENVGEASKPAGNVMIVF 432

Query: 438 XXXXXXXXXXXWAPIAYVIVSESYPLRVKNRAMAISVGSNWIWGFLIGFFTPFITSAINF 497
                      WAPIAYV+V+ES+PLRVK++ M+IS   NW+W FLIGFFTPFIT+AI F
Sbjct: 433 TCLFICFFATTWAPIAYVVVAESFPLRVKSKCMSISTAFNWLWQFLIGFFTPFITNAIKF 492

Query: 498 YYGYVFMGCLXXXXXXXXXXXCETKGLTLEEVNEMYEEGVLPWKSDSWLPAGRRGTDYNT 557
           YYGYVFMGCL            ET GLTLEEV  +YEEG+  W+S +W+P  RR  + ++
Sbjct: 493 YYGYVFMGCLVAMFLYVFFFLPETSGLTLEEVQILYEEGIPAWRSANWVPPTRRFENNSS 552

Query: 558 EEAHTDD 564
            +    D
Sbjct: 553 PDETPQD 559

>Scas_657.20
          Length = 569

 Score =  635 bits (1639), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 322/566 (56%), Positives = 402/566 (71%), Gaps = 11/566 (1%)

Query: 9   DNRSVASGKVGASKDSDSALQLNLQTSTPSNKASRDDFDLKPEN--EHFPEIPQKKLSEY 66
           +N ++ + +V  +  S S +  N      S KA  + F    E+  E   EIP+K  S Y
Sbjct: 6   ENNAIETPEVPQTSGSQSVISDN------SIKAENESFKETSEDAQEVVLEIPKKPASAY 59

Query: 67  ILVMCLCLMVAFGGFVFGWDTGTISGFVNMTDFKRRFGNYSQSEGTYYLSNVRTGLIVAI 126
           + +   C M+AFGGF+ GWDTGTI GF+   D+ RRFG +   +G +Y SNVRTGLIV+I
Sbjct: 60  VTISIFCCMIAFGGFLSGWDTGTIGGFLAHPDYLRRFGQHHH-DGKHYFSNVRTGLIVSI 118

Query: 127 FNIGCAFGGLTLGRLGDIYGRRLGLMCXXXXXXXXXXXXXATGDKWYQYFIGRIISGLGV 186
           FNIG   G L LG L +  GR++ L+              A+ DKWYQYFIGRII G+GV
Sbjct: 119 FNIGGLIGCLVLGDLANRIGRKMALVAVTIIFMIGLIIQIASIDKWYQYFIGRIIGGVGV 178

Query: 187 GGIAVLSPTLISETAPKHLRGTCVAFYQLMITLGIFLGYCTNYGTKTYTNSVQWRVPLGM 246
           G I++ SP L+SE +PKHLRGT  + YQLM+T GIFLG CTNYGTK Y NSVQWRVPLG+
Sbjct: 179 GAISIFSPMLLSEVSPKHLRGTLGSMYQLMVTAGIFLGDCTNYGTKNYDNSVQWRVPLGL 238

Query: 247 CFAWAIFMIAGMLLVPESPRFLIEKGRFEEARRSIAKSNKLTVEDPGVSAEVELINAGVE 306
            FAW +FMIA M  VPESPR+L+E G+ EEA+RSIA SNK++++DP V AEV+LI++GVE
Sbjct: 239 SFAWCLFMIAAMFFVPESPRYLVEVGKIEEAKRSIATSNKVSMDDPAVQAEVDLISSGVE 298

Query: 307 AEKLAGSATWGELFSSKGKILQRVIMGVMIQSLQQLTGNNYFFYYGTTIFQAVGMDDSFQ 366
           AE+LAG+A+W ELFS+KGK +QR+ M  M+Q LQQLTG NYFFYYGT +FQAVGM DS+Q
Sbjct: 299 AERLAGNASWAELFSTKGKNIQRLFMCCMLQCLQQLTGCNYFFYYGTIVFQAVGMSDSYQ 358

Query: 367 TSIVLGIVNFASTFVGLWTVEKFGRRKCLLWGSASMASCFVVFASVGVTRLWPNG--QDQ 424
           T+IV GIVNFASTFV L+ V++FGRRKCL+WG+A+M  C+VV+ASVGV+RL+P G     
Sbjct: 359 TAIVFGIVNFASTFVALYVVDRFGRRKCLMWGAAAMVCCYVVYASVGVSRLYPEGLKHKD 418

Query: 425 PSSKGAGNCMIVXXXXXXXXXXXXWAPIAYVIVSESYPLRVKNRAMAISVGSNWIWGFLI 484
            +SKGAGNCMIV            WAPI +V+VSES+PLRVK + MA++ G NW W FLI
Sbjct: 419 ITSKGAGNCMIVFSCFFIFSFACTWAPICWVVVSESFPLRVKPKGMALANGCNWFWNFLI 478

Query: 485 GFFTPFITSAINFYYGYVFMGCLXXXXXXXXXXXCETKGLTLEEVNEMYEEGVLPWKSDS 544
            FFTPFIT AINF YGYVFMGC+            E KGLTLEEVNE++EEGVLPWKS  
Sbjct: 479 SFFTPFITGAINFCYGYVFMGCMVFAYFYVFFFVPEMKGLTLEEVNELWEEGVLPWKSPE 538

Query: 545 WLPAGRRGTDYNTEEAHTDDKPLYKR 570
           W+P+ RRG D   +    DDKPL+K+
Sbjct: 539 WVPSSRRGADVEMDAFQKDDKPLFKK 564

>AFL204C [2991] [Homologous to ScAFL204C] (51587..53194) [1608 bp,
           535 aa]
          Length = 535

 Score =  624 bits (1610), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 315/497 (63%), Positives = 367/497 (73%), Gaps = 2/497 (0%)

Query: 61  KKLSEYILVMCLCLMVAFGGFVFGWDTGTISGFVNMTDFKRRFGNYSQSEGTYYLSNVRT 120
           K  S YI     C MVAFGGF+FGWDTGTISGFV  TDF  RFG  S S G Y LS+ RT
Sbjct: 39  KPFSAYIFACLCCFMVAFGGFIFGWDTGTISGFVKQTDFIARFGQLSPS-GEYELSDDRT 97

Query: 121 GLIVAIFNIGCAFGGLTLGRLGDIYGRRLGLMCXXXXXXXXXXXXXATGDKWYQYFIGRI 180
           GLIV+IFNIGCA GG+ L ++GD YGR++GL               +  DKWYQYF+GRI
Sbjct: 98  GLIVSIFNIGCAVGGIFLSKIGDAYGRKIGLATVTAVYVIGIVIQISASDKWYQYFVGRI 157

Query: 181 ISGLGVGGIAVLSPTLISETAPKHLRGTCVAFYQLMITLGIFLGYCTNYGTKT-YTNSVQ 239
           ISGLGVGGIAVLSP LISET+PKHLRG+ V+ YQLMIT GIFLGYCTNYGTKT YT+S Q
Sbjct: 158 ISGLGVGGIAVLSPMLISETSPKHLRGSLVSCYQLMITAGIFLGYCTNYGTKTNYTDSRQ 217

Query: 240 WRVPLGMCFAWAIFMIAGMLLVPESPRFLIEKGRFEEARRSIAKSNKLTVEDPGVSAEVE 299
           WR+PLG+ FAWA+ MI GM  VPESPR+L+E     +AR SIA++NK+  + P V  E+ 
Sbjct: 218 WRIPLGLGFAWALLMIGGMAFVPESPRYLVEAENLPKARMSIARANKVAEDHPIVEHELN 277

Query: 300 LINAGVEAEKLAGSATWGELFSSKGKILQRVIMGVMIQSLQQLTGNNYFFYYGTTIFQAV 359
            +   +E EKLAG A   +LF+ K KI QR+I+G+ IQSLQQL GNNYFFYYGTTIF AV
Sbjct: 278 TLQTAIELEKLAGKARIVDLFNVKKKIFQRLIIGIFIQSLQQLIGNNYFFYYGTTIFNAV 337

Query: 360 GMDDSFQTSIVLGIVNFASTFVGLWTVEKFGRRKCLLWGSASMASCFVVFASVGVTRLWP 419
           GMDD F TSIVLGIVNF STF  L+TV+KFGRRKCL+WG+ +MA C  +FASVGVT+LWP
Sbjct: 338 GMDDPFVTSIVLGIVNFGSTFFSLYTVDKFGRRKCLIWGAFAMAICMAIFASVGVTKLWP 397

Query: 420 NGQDQPSSKGAGNCMIVXXXXXXXXXXXXWAPIAYVIVSESYPLRVKNRAMAISVGSNWI 479
           NG+DQPSSK AGN MIV            WAPIAYVI+SE YPLRVK RAMA++  +NWI
Sbjct: 398 NGEDQPSSKPAGNVMIVFTCIYIFFFATTWAPIAYVIISEIYPLRVKARAMALATAANWI 457

Query: 480 WGFLIGFFTPFITSAINFYYGYVFMGCLXXXXXXXXXXXCETKGLTLEEVNEMYEEGVLP 539
           WGFLI FFTP ITSAI F YGYVFMGCL            ETKGLTLE+V+EM++EGV+P
Sbjct: 458 WGFLIAFFTPRITSAIKFCYGYVFMGCLIFAFFYIFFFVPETKGLTLEDVDEMWQEGVVP 517

Query: 540 WKSDSWLPAGRRGTDYN 556
           W S+SWLP   R   ++
Sbjct: 518 WGSESWLPRSDREVAHD 534

>Scas_685.5
          Length = 560

 Score =  623 bits (1607), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 305/554 (55%), Positives = 391/554 (70%), Gaps = 8/554 (1%)

Query: 24  SDSALQLNLQT--STPSNKASRDDFDLKPEN-EH--FPEIPQKKLSEYILVMCLCLMVAF 78
           SD+  +   Q+  S  S KA  D+ + K ++ EH  + E+P+K    Y  +  LC M+ F
Sbjct: 2   SDAEHEQGSQSVLSNASAKAENDNDNFKDDSVEHNGYIEMPKKSAGAYATISILCCMIGF 61

Query: 79  GGFVFGWDTGTISGFVNMTDFKRRFGNYSQSEGTYYLSNVRTGLIVAIFNIGCAFGGLTL 138
           GGF+ GWDTGTI GF+   DF RRFG   + +GT+Y SN RTGLIV+IFN+G   G LTL
Sbjct: 62  GGFIAGWDTGTIGGFMGHPDFMRRFGQ-KRRDGTHYFSNSRTGLIVSIFNLGGCIGCLTL 120

Query: 139 GRLGDIYGRRLGLMCXXXXXXXXXXXXXATGDKWYQYFIGRIISGLGVGGIAVLSPTLIS 198
             L    GR+  L+              A+ +KWYQYFIGRIISG+GVG I++ SP L+S
Sbjct: 121 NNLAGRVGRKKALVIVVIIYMVGIVIEMASINKWYQYFIGRIISGMGVGAISIFSPMLLS 180

Query: 199 ETAPKHLRGTCVAFYQLMITLGIFLGYCTNYGTKTYTNSVQWRVPLGMCFAWAIFMIAGM 258
           E +PKHLRGT  + YQLM+T GIFLG CTNYGT+   NS QWR PLG+ FAWA+FMIAGM
Sbjct: 181 EVSPKHLRGTLGSVYQLMVTFGIFLGDCTNYGTRHKHNSSQWRAPLGLSFAWALFMIAGM 240

Query: 259 LLVPESPRFLIEKGRFEEARRSIAKSNKLTVEDPGVSAEVELINAGVEAEKLAGSATWGE 318
             VPESPR+L+E G+ EEA+RS+  SNKL+ +DP V  EV+LI A +EAE+LAGSA+W E
Sbjct: 241 SFVPESPRYLLEIGKVEEAKRSVGTSNKLSADDPAVQCEVDLILANIEAERLAGSASWPE 300

Query: 319 LFSSKGKILQRVIMGVMIQSLQQLTGNNYFFYYGTTIFQAVGMDDSFQTSIVLGIVNFAS 378
           LFS+KGK +QR++M  ++QSLQQLTG NYFFYYG+T+FQA  + D ++T+IV GIVNFAS
Sbjct: 301 LFSTKGKYVQRLLMCCVLQSLQQLTGINYFFYYGSTVFQAASLKDPYETAIVFGIVNFAS 360

Query: 379 TFVGLWTVEKFGRRKCLLWGSASMASCFVVFASVGVTRLWPNGQDQP--SSKGAGNCMIV 436
           TFV  + V+KFGRRKCL+WG+A+M  CFVV+ASVGV RL+P G+     +SKGAG+CMIV
Sbjct: 361 TFVAFYVVDKFGRRKCLMWGAAAMVCCFVVYASVGVKRLYPEGRKHKEITSKGAGDCMIV 420

Query: 437 XXXXXXXXXXXXWAPIAYVIVSESYPLRVKNRAMAISVGSNWIWGFLIGFFTPFITSAIN 496
                        API +V+VSE++PL +K + MA++ GSNW+W FLI FFTPFIT AI+
Sbjct: 421 FSCFFIFSFACTLAPICWVVVSETFPLEIKPKGMALANGSNWLWNFLISFFTPFITGAID 480

Query: 497 FYYGYVFMGCLXXXXXXXXXXXCETKGLTLEEVNEMYEEGVLPWKSDSWLPAGRRGTDYN 556
           FYYGYVFMGC+            E KGLTLEEVNE++EEGVLPWKS  W+P+ RR  + +
Sbjct: 481 FYYGYVFMGCILFAYFFVFFFVPEMKGLTLEEVNELWEEGVLPWKSPDWVPSTRRDANMD 540

Query: 557 TEEAHTDDKPLYKR 570
                 DD+P+YK+
Sbjct: 541 MNALQHDDQPMYKK 554

>YEL069C (HXT13) [1361] chr5 complement(21537..23231) Member of the
           hexose transporter family of the major facilitator
           superfamily (MFS) [1695 bp, 564 aa]
          Length = 564

 Score =  605 bits (1560), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 298/558 (53%), Positives = 389/558 (69%), Gaps = 11/558 (1%)

Query: 20  ASKDSDSALQ-LNLQTSTPSNKASRDDFDLKPENEHFP----EIPQKKLSEYILVMCLCL 74
           +S DSD  ++  ++  + P  K   D FD   +NE       E P++ L  Y+++  LC 
Sbjct: 6   SSIDSDGDVRDADIHVAPPVEKEWSDGFD---DNEVINGDNVEPPKRGLIGYLVIYLLCY 62

Query: 75  MVAFGGFVFGWDTGTISGFVNMTDFKRRFGNYSQSEGTYYLSNVRTGLIVAIFNIGCAFG 134
            ++FGGF+ GWD+G  +GF+NM +FK  FG+Y  S G YYLSNVR GL+VA+F+IGCA G
Sbjct: 63  PISFGGFLPGWDSGITAGFINMDNFKMNFGSYKHSTGEYYLSNVRMGLLVAMFSIGCAIG 122

Query: 135 GLTLGRLGDIYGRRLGLMCXXXXXXXXXXXXXATGDKWYQYFIGRIISGLGVGGIAVLSP 194
           GL   RL D  GRRL ++              ++  KWYQYF+G+II GLG GG +VL P
Sbjct: 123 GLIFARLADTLGRRLAIVIVVLVYMVGAIIQISSNHKWYQYFVGKIIYGLGAGGCSVLCP 182

Query: 195 TLISETAPKHLRGTCVAFYQLMITLGIFLGYCTNYGTKTYTNSVQWRVPLGMCFAWAIFM 254
            L+SE AP  LRG  V+ YQL +T GIFLGYC+ YGT+ Y N+ QWRVPLG+CF WA+ +
Sbjct: 183 MLLSEIAPTDLRGGLVSLYQLNMTFGIFLGYCSVYGTRKYDNTAQWRVPLGLCFLWALII 242

Query: 255 IAGMLLVPESPRFLIEKGRFEEARRSIAKSNKLTVEDPGVSAEVELINAGVEAEKLAGSA 314
           I GMLLVPESPR+LIE  R EEAR SIAK NK++ EDP V  + + INAGV A++  G A
Sbjct: 243 IIGMLLVPESPRYLIECERHEEARASIAKINKVSPEDPWVLKQADEINAGVLAQRELGEA 302

Query: 315 TWGELFSSKGKILQRVIMGVMIQSLQQLTGNNYFFYYGTTIFQAVGMDDSFQTSIVLGIV 374
           +W ELFS K K+LQR+I G+++Q+  QLTG NYFF+YGTTIF++VG+ D F+TSIVLG V
Sbjct: 303 SWKELFSVKTKVLQRLITGILVQTFLQLTGENYFFFYGTTIFKSVGLTDGFETSIVLGTV 362

Query: 375 NFASTFVGLWTVEKFGRRKCLLWGSASMASCFVVFASVGVTRLWPNGQDQPSSKGAGNCM 434
           NF ST + +  V+K GRRKCLL+G+A M +C V+FAS+GV  L+P+GQD PSSKGAGN M
Sbjct: 363 NFFSTIIAVMVVDKIGRRKCLLFGAAGMMACMVIFASIGVKCLYPHGQDGPSSKGAGNAM 422

Query: 435 IVXXXXXXXXXXXXWAPIAYVIVSESYPLRVKNRAMAISVGSNWIWGFLIGFFTPFITSA 494
           IV            WAP+AY++V+ES+P +VK+RAM+IS   NW+W FLIGFFTPFIT +
Sbjct: 423 IVFTCFYIFCFATTWAPVAYIVVAESFPSKVKSRAMSISTACNWLWQFLIGFFTPFITGS 482

Query: 495 INFYYGYVFMGCLXXXXXXXXXXXCETKGLTLEEVNEMYEEGVLPWKSDSWLPAGRRGTD 554
           I+FYYGYVF+GCL            ET GL+LEE+  +YEEG+ PWKS SW+P  RRG  
Sbjct: 483 IHFYYGYVFVGCLVAMFLYVFFFLPETIGLSLEEIQLLYEEGIKPWKSASWVPPSRRGI- 541

Query: 555 YNTEEAHTDDKPLYKRFL 572
            ++EE+ T+ K  +K+FL
Sbjct: 542 -SSEESKTEKKD-WKKFL 557

>YNR072W (HXT17) [4655] chr14 (772654..774348) Member of the hexose
           transporter family of the major facilitator superfamily
           (MFS) [1695 bp, 564 aa]
          Length = 564

 Score =  602 bits (1553), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 297/561 (52%), Positives = 387/561 (68%), Gaps = 14/561 (2%)

Query: 20  ASKDSDSALQ----LNLQTSTPSNKASRDDFDLKPENEHFP----EIPQKKLSEYILVMC 71
           +S +SD  +Q     ++  + P  K   D FD   +NE       E P++ L  Y+++  
Sbjct: 3   SSTESDRDIQDGPDADIHVAPPVEKEWSDGFD---DNEVINGDNVEPPKRGLIGYLVIYL 59

Query: 72  LCLMVAFGGFVFGWDTGTISGFVNMTDFKRRFGNYSQSEGTYYLSNVRTGLIVAIFNIGC 131
           LC  ++FGGF+ GWD+G  +GF+NM +FK  FG+Y  S G YYLSNVR GL+VA+F+IGC
Sbjct: 60  LCYPISFGGFLPGWDSGITAGFINMDNFKMNFGSYKHSTGEYYLSNVRMGLLVAMFSIGC 119

Query: 132 AFGGLTLGRLGDIYGRRLGLMCXXXXXXXXXXXXXATGDKWYQYFIGRIISGLGVGGIAV 191
           A GGL   RL D  GRRL ++              ++  KWYQYF+G+II GLG GG +V
Sbjct: 120 AIGGLIFARLADTLGRRLAIVIVVLVYMVGAIIQISSNHKWYQYFVGKIIYGLGAGGCSV 179

Query: 192 LSPTLISETAPKHLRGTCVAFYQLMITLGIFLGYCTNYGTKTYTNSVQWRVPLGMCFAWA 251
           L P L+SE AP  LRG  V+ YQL +T GIFLGYC+ YGT+ Y N+ QWRVPLG+CF W 
Sbjct: 180 LCPMLLSEIAPTDLRGGLVSLYQLNMTFGIFLGYCSVYGTRKYDNTAQWRVPLGLCFLWT 239

Query: 252 IFMIAGMLLVPESPRFLIEKGRFEEARRSIAKSNKLTVEDPGVSAEVELINAGVEAEKLA 311
           + +I GMLLVPESPR+LIE  R EEAR SIAK NK++ EDP V  + + INAGV A++  
Sbjct: 240 LIIIIGMLLVPESPRYLIECERHEEARASIAKINKVSPEDPWVLKQADEINAGVLAQREL 299

Query: 312 GSATWGELFSSKGKILQRVIMGVMIQSLQQLTGNNYFFYYGTTIFQAVGMDDSFQTSIVL 371
           G A+W ELFS K K+LQR+I G+++Q+  QLTG NYFF+YGTTIF++VG+ D F+TSIVL
Sbjct: 300 GEASWKELFSVKTKVLQRLITGILVQTFLQLTGENYFFFYGTTIFKSVGLTDGFETSIVL 359

Query: 372 GIVNFASTFVGLWTVEKFGRRKCLLWGSASMASCFVVFASVGVTRLWPNGQDQPSSKGAG 431
           G VNF ST + +  V+K GRRKCLL+G+A M +C V+FAS+GV  L+P+GQD PSSKGAG
Sbjct: 360 GTVNFFSTIIAVMVVDKIGRRKCLLFGAAGMMACMVIFASIGVKCLYPHGQDGPSSKGAG 419

Query: 432 NCMIVXXXXXXXXXXXXWAPIAYVIVSESYPLRVKNRAMAISVGSNWIWGFLIGFFTPFI 491
           N MIV            WAP+AY++V+ES+P +VK+RAM+IS   NW+W FLIGFFTPFI
Sbjct: 420 NAMIVFTCFYIFCFATTWAPVAYIVVAESFPSKVKSRAMSISTACNWLWQFLIGFFTPFI 479

Query: 492 TSAINFYYGYVFMGCLXXXXXXXXXXXCETKGLTLEEVNEMYEEGVLPWKSDSWLPAGRR 551
           T +I+FYYGYVF+GCL            ET GL+LEE+  +YEEG+ PWKS SW+P  RR
Sbjct: 480 TGSIHFYYGYVFVGCLVAMFLYVFFFLPETIGLSLEEIQLLYEEGIKPWKSASWVPPSRR 539

Query: 552 GTDYNTEEAHTDDKPLYKRFL 572
           G    +EE+ T+ K  +K+FL
Sbjct: 540 GIP--SEESKTEKKD-WKKFL 557

>YDL245C (HXT15) [632] chr4 complement(11657..13360) Member of the
           hexose transporter family of the major facilitator
           superfamily (MFS) [1704 bp, 567 aa]
          Length = 567

 Score =  596 bits (1536), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 287/548 (52%), Positives = 381/548 (69%), Gaps = 3/548 (0%)

Query: 14  ASGKVGASKDSDSALQLNLQTSTPSNKASRDDF-DLKPENEHFPEIPQKKLSEYILVMCL 72
           +S ++ A   + SA  +++Q   P  K   D F D +  N + P+ P++    Y+++  L
Sbjct: 6   SSPEINADNLNSSAADVHVQP--PGEKEWSDGFYDKEVINGNTPDAPKRGFLGYLIIYLL 63

Query: 73  CLMVAFGGFVFGWDTGTISGFVNMTDFKRRFGNYSQSEGTYYLSNVRTGLIVAIFNIGCA 132
           C  V+FGGF+ GWD+G  +GF+NM +FK  FG+Y  S G YYLSNVR GL+VA+F++GC+
Sbjct: 64  CYPVSFGGFLPGWDSGITAGFINMDNFKMNFGSYKHSTGEYYLSNVRMGLLVAMFSVGCS 123

Query: 133 FGGLTLGRLGDIYGRRLGLMCXXXXXXXXXXXXXATGDKWYQYFIGRIISGLGVGGIAVL 192
            GG+   RL D  GRRL ++              ++  KWYQYF+G+II GLG GG +VL
Sbjct: 124 IGGVAFARLADTLGRRLAIVIVVLVYMVGAIIQISSNHKWYQYFVGKIIYGLGAGGCSVL 183

Query: 193 SPTLISETAPKHLRGTCVAFYQLMITLGIFLGYCTNYGTKTYTNSVQWRVPLGMCFAWAI 252
            P L+SE AP  LRG  V+ YQL +T GIFLGYC+ YGT+ Y+N+ QWR+P+G+CF WA+
Sbjct: 184 CPMLLSEIAPTDLRGGLVSLYQLNMTFGIFLGYCSVYGTRKYSNTAQWRIPVGLCFLWAL 243

Query: 253 FMIAGMLLVPESPRFLIEKGRFEEARRSIAKSNKLTVEDPGVSAEVELINAGVEAEKLAG 312
            +I GMLLVPESPR+LIE  R EEA  SIAK NK++ EDP V  + + INAGV A++  G
Sbjct: 244 IIIVGMLLVPESPRYLIECERHEEACVSIAKINKVSPEDPWVLKQADEINAGVLAQRELG 303

Query: 313 SATWGELFSSKGKILQRVIMGVMIQSLQQLTGNNYFFYYGTTIFQAVGMDDSFQTSIVLG 372
            A+W ELFS K K+LQR+I G+++Q+  QLTG NYFF+YGTTIF++VG+ D F+TSIVLG
Sbjct: 304 EASWKELFSVKTKVLQRLITGILVQTFLQLTGENYFFFYGTTIFKSVGLTDGFETSIVLG 363

Query: 373 IVNFASTFVGLWTVEKFGRRKCLLWGSASMASCFVVFASVGVTRLWPNGQDQPSSKGAGN 432
            VNF ST + +  V+K GRRKCLL+G+ASM +C V+FAS+GV  L+P+GQD PSSKGAGN
Sbjct: 364 TVNFFSTIIAVMVVDKIGRRKCLLFGAASMMACMVIFASIGVKCLYPHGQDGPSSKGAGN 423

Query: 433 CMIVXXXXXXXXXXXXWAPIAYVIVSESYPLRVKNRAMAISVGSNWIWGFLIGFFTPFIT 492
            MIV            WAP+AY++V+ES+P +VK++AM+IS   NW+W FLIGFFTPFIT
Sbjct: 424 AMIVFTCFYIFCFATTWAPVAYIVVAESFPSKVKSKAMSISTAFNWLWQFLIGFFTPFIT 483

Query: 493 SAINFYYGYVFMGCLXXXXXXXXXXXCETKGLTLEEVNEMYEEGVLPWKSDSWLPAGRRG 552
            +I+FYYGYVF+GCL            ET GL+LEE+  +YEEG+ PWKS SW+P  RRG
Sbjct: 484 GSIHFYYGYVFVGCLVAMFLYVFFFLPETIGLSLEEIQLLYEEGIKPWKSASWVPPSRRG 543

Query: 553 TDYNTEEA 560
                 EA
Sbjct: 544 ASSRETEA 551

>YJR158W (HXT16) [3048] chr10 (732355..734058) Member of the hexose
           transporter family of the major facilitator superfamily
           (MFS) [1704 bp, 567 aa]
          Length = 567

 Score =  593 bits (1529), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 286/548 (52%), Positives = 380/548 (69%), Gaps = 3/548 (0%)

Query: 14  ASGKVGASKDSDSALQLNLQTSTPSNKASRDDF-DLKPENEHFPEIPQKKLSEYILVMCL 72
           +S ++ A   + SA  +++Q   P  K   D F D +  N + P+ P++    Y+++  L
Sbjct: 6   SSPEINADNLNSSAADVHVQP--PGEKEWSDGFYDKEVINGNTPDAPKRGFLGYLIIYLL 63

Query: 73  CLMVAFGGFVFGWDTGTISGFVNMTDFKRRFGNYSQSEGTYYLSNVRTGLIVAIFNIGCA 132
           C  V+FGGF+ GWD+G  +GF+NM +FK  FG+Y  S G YYLSNVR GL+VA+F++GC+
Sbjct: 64  CYPVSFGGFLPGWDSGITAGFINMDNFKMNFGSYKHSTGEYYLSNVRMGLLVAMFSVGCS 123

Query: 133 FGGLTLGRLGDIYGRRLGLMCXXXXXXXXXXXXXATGDKWYQYFIGRIISGLGVGGIAVL 192
            GG+   RL D  GRRL ++              ++  KWYQYF+G+II GLG GG +VL
Sbjct: 124 IGGVAFARLADTLGRRLAIVIVVLVYMVGAIIQISSNHKWYQYFVGKIIYGLGAGGCSVL 183

Query: 193 SPTLISETAPKHLRGTCVAFYQLMITLGIFLGYCTNYGTKTYTNSVQWRVPLGMCFAWAI 252
            P L+SE AP  LRG  V+ YQL +T GIFLGYC+ YGT+ Y+N+ QWR+P+G+CF WA+
Sbjct: 184 CPMLLSEIAPTDLRGGLVSLYQLNMTFGIFLGYCSVYGTRKYSNTAQWRIPVGLCFLWAL 243

Query: 253 FMIAGMLLVPESPRFLIEKGRFEEARRSIAKSNKLTVEDPGVSAEVELINAGVEAEKLAG 312
            +I GMLLVPESPR+LIE  R EEA  SIAK +K++ EDP V  + + INAGV A++  G
Sbjct: 244 IIIVGMLLVPESPRYLIECERHEEACVSIAKIDKVSPEDPWVLKQADEINAGVLAQRELG 303

Query: 313 SATWGELFSSKGKILQRVIMGVMIQSLQQLTGNNYFFYYGTTIFQAVGMDDSFQTSIVLG 372
            A+W ELFS K K+LQR+I G+++Q+  QLTG NYFF+YGTTIF++VG+ D F+TSIVLG
Sbjct: 304 EASWKELFSVKTKVLQRLITGILVQTFLQLTGENYFFFYGTTIFKSVGLTDGFETSIVLG 363

Query: 373 IVNFASTFVGLWTVEKFGRRKCLLWGSASMASCFVVFASVGVTRLWPNGQDQPSSKGAGN 432
            VNF ST + +  V+K GRRKCLL+G+ASM +C V+FAS+GV  L+P+GQD PSSKGAGN
Sbjct: 364 TVNFFSTIIAVMVVDKIGRRKCLLFGAASMMACMVIFASIGVKCLYPHGQDGPSSKGAGN 423

Query: 433 CMIVXXXXXXXXXXXXWAPIAYVIVSESYPLRVKNRAMAISVGSNWIWGFLIGFFTPFIT 492
            MIV            WAP+AY++V+ES+P +VK++AM+IS   NW+W FLIGFFTPFIT
Sbjct: 424 AMIVFTCFYIFCFATTWAPVAYIVVAESFPSKVKSKAMSISTAFNWLWQFLIGFFTPFIT 483

Query: 493 SAINFYYGYVFMGCLXXXXXXXXXXXCETKGLTLEEVNEMYEEGVLPWKSDSWLPAGRRG 552
            +I+FYYGYVF+GCL            ET GL+LEE   +YEEG+ PWKS SW+P  RRG
Sbjct: 484 GSIHFYYGYVFVGCLVAMFLYVFFFLPETIGLSLEETQLLYEEGIKPWKSASWVPPSRRG 543

Query: 553 TDYNTEEA 560
                 EA
Sbjct: 544 ASSRETEA 551

>YIL170W (HXT12) [2508] chr9 (19847..21220) Protein of unknown
           function [1374 bp, 457 aa]
          Length = 457

 Score =  574 bits (1479), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 283/454 (62%), Positives = 348/454 (76%), Gaps = 2/454 (0%)

Query: 121 GLIVAIFNIGCAFGGLTLGRLGDIYGRRLGLMCXXXXXXXXXXXXXATGDKWYQYFIGRI 180
           GLIV+IFNIGCA GG+ L ++GDIYGRR+GL+               + +KWYQYFIGRI
Sbjct: 2   GLIVSIFNIGCAIGGIVLSKVGDIYGRRIGLITVTAIYVVGILIQITSINKWYQYFIGRI 61

Query: 181 ISGLGVGGIAVLSPTLISETAPKHLRGTCVAFYQLMITLGIFLGYCTNYGTKTYTNSVQW 240
           ISG+GVGGIAVLSP LISE APKH+RGT V  YQLM T+GIFLGYCTNYGTK Y N+ QW
Sbjct: 62  ISGIGVGGIAVLSPMLISEVAPKHIRGTLVQLYQLMGTMGIFLGYCTNYGTKNYHNATQW 121

Query: 241 RVPLGMCFAWAIFMIAGMLLVPESPRFLIEKGRFEEARRSIAKSNKLTVEDPGVSAEVEL 300
           RV LG+CFAWA FM++GM+ VPESPR+LIE G+ EEA+ S++KSNK++V+DP + AE + 
Sbjct: 122 RVGLGLCFAWATFMVSGMMFVPESPRYLIEVGKDEEAKHSLSKSNKVSVDDPALLAEYDT 181

Query: 301 INAGVEAEKLAGSATWGELFSSKGKILQRVIMGVMIQSLQQLTGNNYFFYYGTTIFQAVG 360
           I AG+E EKLAG+A+W EL S+K K+ QRV+MGV+IQSLQQLTG+NYFFYYGTTIF++VG
Sbjct: 182 IKAGIEIEKLAGNASWSELLSTKTKVFQRVLMGVIIQSLQQLTGDNYFFYYGTTIFKSVG 241

Query: 361 MDDSFQTSIVLGIVNFASTFVGLWTVEKFGRRKCLLWGSASMASCFVVFASVGVTRLWPN 420
           + DSFQTSI++G+VNF S+F+ ++T+E+FGRR CLLWG+ASM  CF VFASVGVT+LWP 
Sbjct: 242 LKDSFQTSIIIGVVNFFSSFIAVYTIERFGRRTCLLWGAASMLCCFAVFASVGVTKLWPQ 301

Query: 421 GQDQP--SSKGAGNCMIVXXXXXXXXXXXXWAPIAYVIVSESYPLRVKNRAMAISVGSNW 478
           G      +S+GAGNCMIV            WA   +VIVSE++PLR K+R MAI+  +NW
Sbjct: 302 GSSHQDITSQGAGNCMIVFTMFFIFSFATTWAGGCFVIVSETFPLRAKSRGMAIATAANW 361

Query: 479 IWGFLIGFFTPFITSAINFYYGYVFMGCLXXXXXXXXXXXCETKGLTLEEVNEMYEEGVL 538
           +WGFLI FFTPFIT AINFYYGYVF+GCL            ETKGLTLEEVN M+ EGV 
Sbjct: 362 MWGFLISFFTPFITGAINFYYGYVFLGCLVFAYFYVFFFVPETKGLTLEEVNTMWLEGVP 421

Query: 539 PWKSDSWLPAGRRGTDYNTEEAHTDDKPLYKRFL 572
            WKS SW+P  RR  DY+ +    D++P+YKRF 
Sbjct: 422 AWKSASWVPPERRTADYDADAIDHDNRPIYKRFF 455

>Scas_634.16
          Length = 471

 Score =  537 bits (1383), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 273/454 (60%), Positives = 335/454 (73%), Gaps = 8/454 (1%)

Query: 8   IDNRSVASGKVGASKDSDSALQLNLQTSTPSNKASRDDFDLK---PENEHFP-EIPQKKL 63
           + + +VA+  +     +DSA   +      SNK   DD ++K    + E  P E+P+K  
Sbjct: 20  VADPNVATEHINDEPLNDSASGSHSVLEAQSNK--DDDEEIKNYGEDGEIAPAEMPKKPA 77

Query: 64  SEYILVMCLCLMVAFGGFVFGWDTGTISGFVNMTDFKRRFGNYSQSEGTYYLSNVRTGLI 123
           S Y+ V  LCLM+AFGG+V+GWDTGTISGFV  TD+ RR+G   + +GTYYLS VRTGL+
Sbjct: 78  SAYVTVSILCLMIAFGGYVYGWDTGTISGFVAQTDYVRRYGQ-KKKDGTYYLSKVRTGLL 136

Query: 124 VAIFNIGCAFGGLTLGRLGDIYGRRLGLMCXXXXXXXXXXXXXATGDKWYQYFIGRIISG 183
           +AIFNIGCA GGL   RLGD++GRR  L+              A    WYQYFIGRIISG
Sbjct: 137 LAIFNIGCAIGGLLWSRLGDMWGRRKALVFVTTVYMIGLIISIAAVKHWYQYFIGRIISG 196

Query: 184 LGVGGIAVLSPTLISETAPKHLRGTCVAFYQLMITLGIFLGYCTNYGTKTYTNSVQWRVP 243
           LGVGGIAV SP LISE APKH+RGT V+ YQLMITLGIFLGYCTN+GT+ Y+NSVQWRVP
Sbjct: 197 LGVGGIAVYSPLLISEVAPKHVRGTLVSCYQLMITLGIFLGYCTNFGTRNYSNSVQWRVP 256

Query: 244 LGMCFAWAIFMIAGMLLVPESPRFLIEKGRFEEARRSIAKSNKLTVEDPGVSAEVELINA 303
           LG+ FAWA+FMIA M  VPESPR+LIE G+ EEA+RS+A+SN+LTV+DP V AEVE + A
Sbjct: 257 LGLGFAWALFMIAAMFFVPESPRYLIEVGQMEEAKRSVAQSNRLTVDDPSVIAEVEFLTA 316

Query: 304 GVEAEKLAGSATWGELFSSKGKILQRVIMGVMIQSLQQLTGNNYFFYYGTTIFQAVGMDD 363
           GVEAE+ AGSA+W ELF +KGKIL RVIMG+MIQ+LQQLTG NYFF+YGT IF ++GM+D
Sbjct: 317 GVEAEREAGSASWMELFQTKGKILHRVIMGIMIQTLQQLTGANYFFFYGTLIFASIGMND 376

Query: 364 SFQTSIVLGIVNFASTFVGLWTVEKFGRRKCLLWGSASMASCFVVFASVGVTRLWPNG-Q 422
            F+ S+V+GIVNFASTF  ++ V++FGRR CLL+G+A M  C VVFASVGVTRL P+G Q
Sbjct: 377 GFKASVVIGIVNFASTFPAIYIVDRFGRRTCLLFGAAGMICCMVVFASVGVTRLHPDGDQ 436

Query: 423 DQPSSKGAGNCMIVXXXXXXXXXXXXWAPIAYVI 456
           +  +SKGAGNCMI             WAP AYV+
Sbjct: 437 NGVASKGAGNCMICFTCFFIFCFANTWAPCAYVM 470

>Kwal_26.6680
          Length = 416

 Score =  504 bits (1297), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 235/384 (61%), Positives = 292/384 (76%)

Query: 171 KWYQYFIGRIISGLGVGGIAVLSPTLISETAPKHLRGTCVAFYQLMITLGIFLGYCTNYG 230
           KWY YFIG+II G GVGG++VLSP LISE +PKHLRGT V+ +QLM+T GIFLGYC  YG
Sbjct: 20  KWYHYFIGKIIYGWGVGGMSVLSPMLISEISPKHLRGTLVSCFQLMVTFGIFLGYCAVYG 79

Query: 231 TKTYTNSVQWRVPLGMCFAWAIFMIAGMLLVPESPRFLIEKGRFEEARRSIAKSNKLTVE 290
           T+ Y++S QWR+P+G+ F WAI ++ GM  VPESPR+L+E  + EEA+RSIA++ KL+V+
Sbjct: 80  TRQYSDSAQWRIPVGLSFLWAIIIVTGMFFVPESPRYLVEANKVEEAKRSIARAFKLSVD 139

Query: 291 DPGVSAEVELINAGVEAEKLAGSATWGELFSSKGKILQRVIMGVMIQSLQQLTGNNYFFY 350
           DP V  E +LI AGVEA++  G A+WGELFS K K+LQR+I G+++QS  QLTG NYFFY
Sbjct: 140 DPEVQEETDLIVAGVEAQREQGEASWGELFSVKTKVLQRLITGILMQSFLQLTGENYFFY 199

Query: 351 YGTTIFQAVGMDDSFQTSIVLGIVNFASTFVGLWTVEKFGRRKCLLWGSASMASCFVVFA 410
           YGTTIF ++G+ DSFQTSIVLG VN AS+F+ ++TV+  GRRKCLLWG+A MA C V+FA
Sbjct: 200 YGTTIFDSIGLTDSFQTSIVLGTVNLASSFISMYTVDALGRRKCLLWGAAGMAICMVIFA 259

Query: 411 SVGVTRLWPNGQDQPSSKGAGNCMIVXXXXXXXXXXXXWAPIAYVIVSESYPLRVKNRAM 470
           SVGVT L PNG D  +SK AGNCM+V            WAPI+YV+VSES+PLRVK++ M
Sbjct: 260 SVGVTSLRPNGPDGEASKSAGNCMVVFICLFILCFATTWAPISYVVVSESFPLRVKSKCM 319

Query: 471 AISVGSNWIWGFLIGFFTPFITSAINFYYGYVFMGCLXXXXXXXXXXXCETKGLTLEEVN 530
           +IS   NW+W FLI FFTPFIT AINFYYGYVF GCL            ET GLTLEEV 
Sbjct: 320 SISTAFNWLWQFLISFFTPFITGAINFYYGYVFFGCLVAMFLYVFFFVPETGGLTLEEVQ 379

Query: 531 EMYEEGVLPWKSDSWLPAGRRGTD 554
            +Y+EGV  W+S SW+P GRR ++
Sbjct: 380 TLYDEGVPAWRSTSWVPPGRRSSN 403

>Scas_600.1
          Length = 293

 Score =  377 bits (968), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 173/288 (60%), Positives = 221/288 (76%), Gaps = 3/288 (1%)

Query: 286 KLTVEDPGVSAEVELINAGVEAEKLAGSATWGELFSSKGKILQRVIMGVMIQSLQQLTGN 345
           K++V+DP V AE +LI +G+EAE+LAG+A+WGELFS+KGK++QR++M  M+Q LQQLTG 
Sbjct: 1   KVSVDDPAVQAECDLITSGIEAERLAGNASWGELFSTKGKVVQRLLMCCMLQCLQQLTGC 60

Query: 346 NYFFYYGTTIFQAVGMDDSFQTSIVLGIVNFASTFVGLWTVEKFGRRKCLLWGSASMASC 405
           NYFFYYGT IFQAVG+ DS+QT+IV GIVNFASTFV  + V+ +GRRKCL+WG+A+M  C
Sbjct: 61  NYFFYYGTVIFQAVGLKDSYQTAIVFGIVNFASTFVAFYVVDHYGRRKCLMWGAAAMVCC 120

Query: 406 FVVFASVGVTRLWPNG---QDQPSSKGAGNCMIVXXXXXXXXXXXXWAPIAYVIVSESYP 462
           +VV+ASVGVTRL+P+G   +D  SSKGAGNCMIV            WAPI +V+VSES+P
Sbjct: 121 YVVYASVGVTRLYPDGIKHKDTNSSKGAGNCMIVFSCFFIFSFACTWAPICWVVVSESFP 180

Query: 463 LRVKNRAMAISVGSNWIWGFLIGFFTPFITSAINFYYGYVFMGCLXXXXXXXXXXXCETK 522
           L++K + MA++ G NW W FL+ FFTPFIT AINFYYGYVFMGC+            E K
Sbjct: 181 LKIKPKGMALANGCNWFWNFLVSFFTPFITGAINFYYGYVFMGCMVFAYFYVFFFVPEMK 240

Query: 523 GLTLEEVNEMYEEGVLPWKSDSWLPAGRRGTDYNTEEAHTDDKPLYKR 570
           GLTLEEV+E+++EGVLPWKS  W+PA RRG D + +    DDKP +K+
Sbjct: 241 GLTLEEVDELWQEGVLPWKSPDWVPASRRGADVDLDAFQKDDKPFFKK 288

>Kwal_55.20068
          Length = 267

 Score =  341 bits (874), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 162/267 (60%), Positives = 202/267 (75%), Gaps = 4/267 (1%)

Query: 310 LAGSATWGELFSSKGKILQRVIMGVMIQSLQQLTGNNYFFYYGTTIFQAVGMDDSFQTSI 369
           +AG A+W EL + K ++L+R I G+MI SLQQLTG+NYFFYYGTTIF AVG+ DSFQTSI
Sbjct: 1   MAGKASWAELITGKPQMLKRTINGIMIMSLQQLTGDNYFFYYGTTIFNAVGLKDSFQTSI 60

Query: 370 VLGIVNFASTFVGLWTVEKFGRRKCLLWGSASMASCFVVFASVGVTRLWPNGQDQP--SS 427
           +LGIVNF ST + L+TV+KFGRR CL++G+  M +C+ V+ASVGVTRL+P+G +    +S
Sbjct: 61  ILGIVNFVSTSLSLYTVDKFGRRNCLIYGAIGMIACYTVYASVGVTRLYPDGANHKDVTS 120

Query: 428 KGAGNCMIVXXXXXXXXXXXXWAPIAYVIVSESYPLRVKNRAMAISVGSNWIWGFLIGFF 487
           KGAGN +I             WAPIAYV++SE+YPLRVK RAM+++  +NW+WGFLI FF
Sbjct: 121 KGAGNVLICFACFYIFCFATTWAPIAYVLISETYPLRVKGRAMSLASAANWLWGFLISFF 180

Query: 488 TPFITSAINFYYGYVFMGCLXXXXXXXXXXXCETKGLTLEEVNEMYEEGVLPWKSDSWLP 547
           TPFITSAINFYYGYVFMGC+            ETKGLTLEEVNEMY EGVLPWKS +W+P
Sbjct: 181 TPFITSAINFYYGYVFMGCMVFAVFYVFFLIPETKGLTLEEVNEMYAEGVLPWKSANWVP 240

Query: 548 AGRRGTDYNTEEAHTDDK--PLYKRFL 572
           A RRG DY+ +  + +D   P YKR+L
Sbjct: 241 ASRRGADYDADALNHEDMSLPWYKRYL 267

>KLLA0E21021g 1870154..1871740 gi|32400014|emb|CAE00632.1
           Kluyveromyces lactis hexose transporter 3, hypothetical
           start
          Length = 528

 Score =  345 bits (884), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 191/489 (39%), Positives = 274/489 (56%), Gaps = 24/489 (4%)

Query: 58  IPQKKLSEYILVMCLCLMVAFGGFVFGWDTGTISGFVNMTDFKRRFG-NYSQSEGTYYLS 116
           I QKKL   +  + LCL  +F GF+FGWD GTI G  NM  F+  FG N+  S  T+Y  
Sbjct: 48  IEQKKLP--LKPILLCLATSFAGFIFGWDVGTIGGITNMVSFQNFFGTNFDSSSNTHYFP 105

Query: 117 NVRTGLIVAIFNIGCAFGGLTLGRLGDIYGRRLGLMCXXXXXXXXXXXXXATGDKWYQYF 176
            +  GLIV+IFNI CA GGL L ++ DI GR+ G+                 G  W+ +F
Sbjct: 106 KLLIGLIVSIFNISCALGGLFLVKIADINGRKPGIYAAITIYSLGTLIGWTCGSSWWYFF 165

Query: 177 IGRIISGLGVGGIAVLSPTLISETAPKHLRGTCVAFYQLMITLGIFLGYCTNY---GTKT 233
             R ISGLGVG  AV+ P  I+E+AP ++RG  V  YQLMITLGI LG   NY    T  
Sbjct: 166 FARFISGLGVGATAVMIPMFIAESAPINIRGAMVVLYQLMITLGILLGNVINYCCRSTLH 225

Query: 234 YTNSVQWRVPLGMCFAWAIFMIAGMLLVPESPRFLIEK-GRFEEARRSIAKSNKLTVEDP 292
            T++  W++P+G+   WA  +  G+  +PESP FL ++ G   +A+ + A  N L V+DP
Sbjct: 226 ETDNATWKIPVGLGNVWAAIVALGVHFMPESPVFLTKRLGSALKAKAAFAHMNNLDVDDP 285

Query: 293 GVSAEVELINAGVEAEKLAGSATWGELFSSKGKILQ-------RVIMGVMIQSLQQLTGN 345
            V + +  +    +AE     +T  ++ +S+ + +        R+ +G+M+ + QQL+G 
Sbjct: 286 IVDSHIRKMMESADAE----VSTHNDMKNSRFEFILGQPRLGFRLFIGIMVMAFQQLSGA 341

Query: 346 NYFFYYGTTIFQAVGMDDSFQTSIVLGIVNFASTFVGLWTVEKFGRRKCLLWGSASMASC 405
           NYFFYYGTT+F +VG++D + TSI+L  VNF STF G++ VEK GR+ CL+ GSA M +C
Sbjct: 342 NYFFYYGTTLFNSVGIEDPYLTSILLSSVNFISTFFGIYLVEKLGRKACLILGSAGMFTC 401

Query: 406 FVVFASVGVTRLWPNGQDQPSSKGAGNCMIVXXXXXXXXXXXXWAPIAYVIVSESYPLRV 465
             V+ASVG   L        S + +G  M+               P+++V++SE +P R 
Sbjct: 402 MSVYASVGSFAL------NKSPQNSGAIMVTFTCVYIMFFACTSGPVSFVVISELFPSRT 455

Query: 466 KNRAMAISVGSNWIWGFLIGFFTPFITSAINFYYGYVFMGCLXXXXXXXXXXXCETKGLT 525
           K  +MA+    NW+  F I   TP++T  I F +G+VF GCL            ETK  T
Sbjct: 456 KAISMAVCTSINWLCNFFISLCTPYVTDKIGFKFGFVFAGCLFVSFWFFTFLLKETKNKT 515

Query: 526 LEEVNEMYE 534
            E+V+ +Y 
Sbjct: 516 PEQVDALYS 524

>AFR602W [3794] [Homologous to ScYNL318C (HXT14 ) - NSH]
           complement(1523019..1524695) [1677 bp, 558 aa]
          Length = 558

 Score =  341 bits (875), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 182/484 (37%), Positives = 269/484 (55%), Gaps = 13/484 (2%)

Query: 58  IPQKKLSEYILVMCLCLMVAFGGFVFGWDTGTISGFVNMTDFKRRFG-NYSQSEGTYYLS 116
           +P+  L   +L    CL VAF G +FGWD GTI G   M  F+   G  ++   G +   
Sbjct: 79  VPEGSLVRPVL---YCLSVAFCGIIFGWDLGTIGGISTMPSFQNTLGPRFNGDTGLHEFP 135

Query: 117 NVRTGLIVAIFNIGCAFGGLTLGRLGDIYGRRLGLMCXXXXXXXXXXXXXATGDKWYQYF 176
               GL++ IFNIGCA GGLT+ RLGDI GR++ ++               +G  WY+YF
Sbjct: 136 GRLLGLLIGIFNIGCAIGGLTIARLGDIKGRKIAILTSLLVYAVGMFVQLGSGHFWYRYF 195

Query: 177 IGRIISGLGVGGIAVLSPTLISETAPKHLRGTCVAFYQLMITLGIFLGYCTNYGTKTYTN 236
           IGR+I+GL VG   VL P  +SE AP  +RG  +  YQ++I LGI LG   NY  K   +
Sbjct: 196 IGRLIAGLAVGATMVLVPMFLSELAPVRIRGAMIVLYQVVICLGIALGSIVNYACKELVH 255

Query: 237 ----SVQWRVPLGMCFAWAIFMIAGMLLVPESPRFLIEKGRFEEARRSIAKSNKLTVEDP 292
               ++ W+VP+     + + +   +L+ PES  FL  KG  E+A+RS A  N L+ + P
Sbjct: 256 DTLSNMTWKVPIFFQIGFTVLLSLALLITPESAEFLAMKGHLEKAKRSFAVMNGLSKDHP 315

Query: 293 GVSAEV-ELINAGVEAEKLAGSATWGELFSSKGKILQRVIMGVMIQSLQQLTGNNYFFYY 351
            V   V   +   ++++ +  S    E      ++  R+ +GV + +LQ L+G NYFFYY
Sbjct: 316 FVEERVASFVQVSMKSDDIEHSGDRWEFIRGNPRLGLRLFIGVTVMALQMLSGVNYFFYY 375

Query: 352 GTTIFQAVGMDDSFQTSIVLGIVNFASTFVGLWTVEKFGRRKCLLWGSASMASCFVVFAS 411
           GTT+F+ VG++D++ TSI++G V+   TF+G++ VE+ GR+ CLL G+  M  C  V+A 
Sbjct: 376 GTTLFRFVGIEDAYVTSIIIGCVDLLGTFIGVYIVERLGRKICLLSGATGMFICMTVYAC 435

Query: 412 VGVTRLWPNGQDQPSSKGAGNCMIVXXXXXXXXXXXXWAPIAYVIVSESYPLRVKNRAMA 471
           +G   L    +D  ++K  G  MI               P++ V++SE +P+R K  +MA
Sbjct: 436 LGSFAL----KDDSNNKTVGAVMIFFTCVFVMFFAATSGPVSMVVMSEIFPIRTKVMSMA 491

Query: 472 ISVGSNWIWGFLIGFFTPFITSAINFYYGYVFMGCLXXXXXXXXXXXCETKGLTLEEVNE 531
           I    NW+  FLI F TP +T AIN+ +G+VF GCL            ETKGLT E+V+ 
Sbjct: 492 ICTSVNWLVNFLIAFVTPDVTDAINYRFGFVFSGCLLFSIVFFIYLVPETKGLTHEQVDA 551

Query: 532 MYEE 535
           +YE+
Sbjct: 552 IYEK 555

>Scas_716.53
          Length = 523

 Score =  319 bits (817), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 200/528 (37%), Positives = 278/528 (52%), Gaps = 23/528 (4%)

Query: 21  SKDSDSALQLNLQTSTPSNKASRD-DFDLKPE----NEHFPEIPQKKLSEYILVMCLCLM 75
           + D DS       TST S  +S++    L  +    NE       KK    I  M +CL 
Sbjct: 5   AHDLDSNEHTTSITSTMSRSSSQEVPIALTKKRNLGNEETILQENKKNPSLITPMLICLA 64

Query: 76  VAFGGFVFGWDTGTISGFVNMTDFKRRFGN-YSQSEGTYYLSNVRTGLIVAIFNIGCAFG 134
           ++FGGF+FGWD GTI G  NM+ FK RFG    Q +GT +   +  GLI+ IFN+    G
Sbjct: 65  ISFGGFLFGWDIGTIGGIANMSSFKERFGTRQDQGKGTKHFPGLLIGLIIGIFNLSAGVG 124

Query: 135 GLTLGRLGDIYGRRLGLMCXXXXXXXXXXXXXATGDKWYQYFIGRIISGLGVGGIAVLSP 194
           G+ L + GD +GR+                       W+Q FIGR+I GL +GGI V+ P
Sbjct: 125 GVALAKCGDWWGRKRATYFFIFIYSIGLLVQLIHNRAWFQIFIGRLICGLAIGGINVIVP 184

Query: 195 TLISETAPKHLRGTCVAFYQLMITLGIFLG-----YCTNYGTKTYTNSVQWRVPLGMCFA 249
             ISE AP  +RG+ V FYQL IT GI +G      C N  ++++ N   W++PLG+ F 
Sbjct: 185 MFISEIAPLRVRGSMVTFYQLKITFGILVGNITVFLCHNGFSRSHQNEA-WQIPLGLGFV 243

Query: 250 WAIFMIAGMLLVPESPRFL-IEKGRFEEARRSIAKSNKLTVEDPGVSAEVELINAGVEAE 308
           WA  +I G+   PES ++L I+K R++ A  S A+ N L+  D      VE +    E +
Sbjct: 244 WAFIVILGLYNSPESAQYLGIKKERWDAALMSTARMNNLSTGDIRAINIVEEMQRRAEQD 303

Query: 309 KLAGSATWG--ELFSSKGKILQRVIMGVMIQSLQQLTGNNYFFYYGTTIFQAVGMDDSFQ 366
           +L  S+     E    K K+  R+ +G+M+   QQL+G NYFFYYGTTIF  VG++D + 
Sbjct: 304 RLEKSSRRNIFEFIFGKPKLGLRLFIGIMLMIFQQLSGINYFFYYGTTIFAKVGLNDPYT 363

Query: 367 TSIVLGIVNFASTFVGLWTVEKFGRRKCLLWGSASMASCFVVFASVGVTRLWPNGQDQPS 426
           T+I+L  VNF +TF G++ VE   RR  L++GS  M  C ++++S+G   L        +
Sbjct: 364 TAIILSSVNFVATFFGIYFVEALRRRTSLVFGSIGMFCCMMIYSSMGSFAL--------N 415

Query: 427 SKGAGNCMIVXXXXXXXXXXXXWAPIAYVIVSESYPLRVKNRAMAISVGSNWIWGFLIGF 486
           + G G  MIV              P+  V+VSE YP+R K  +MA    +NWI  FLI F
Sbjct: 416 TDGTGITMIVVTCVYIALFAITLGPVTIVLVSELYPMRTKAMSMATCSFANWIMNFLITF 475

Query: 487 FTPFITSAINFYYGYVFMGCLXXXXXXXXXXXCETKGLTLEEVNEMYE 534
            TP IT+ I F YGYVF  CL            ETK  T  E++ M+ 
Sbjct: 476 LTPLITAQIGFKYGYVFAVCLFFSTCFDWTTVPETKNKTPTEIDNMFS 523

>Kwal_56.24841
          Length = 511

 Score =  300 bits (768), Expect = 3e-95,   Method: Compositional matrix adjust.
 Identities = 177/497 (35%), Positives = 256/497 (51%), Gaps = 33/497 (6%)

Query: 74  LMVAFGGFVFGWDTGTISGFVNMTDFKRRF---GNYSQSEGTYYLSNVRTGLIVAIFNIG 130
           L VAFGG +FG+DTGTISG + M   K  F   G+++  E         T LI +I + G
Sbjct: 27  LFVAFGGILFGYDTGTISGILAMDHVKTTFTDRGHFTAGE---------TSLITSILSAG 77

Query: 131 CAFGGLTLGRLGDIYGRRLGLMCXXXXXXXXXXXXXATGDKWYQYFIGRIISGLGVGGIA 190
             FG ++   + D  GRR GL+              A   +     +GR+I+G+GVG ++
Sbjct: 78  TFFGSMSAPLVSDNLGRRYGLIVSTVIFTIGVILQVAATTQEL-LIVGRVIAGVGVGVLS 136

Query: 191 VLSPTLISETAPKHLRGTCVAFYQLMITLGIFLGYCTNYGTKTYTNSVQWRVPLGMCFAW 250
            + P   SE APK +RG  V+ YQ  IT+G+ L  C N GT    +S  +R+PL + F W
Sbjct: 137 AIVPLYQSEAAPKWIRGAVVSAYQWAITIGLLLAACVNQGTHARNDSGSYRIPLAIQFLW 196

Query: 251 AIFMIAGMLLVPESPRFLIEKGRFEEARRSIAKSNKLTVEDPGVSAEVELINAGVEAEKL 310
           AI M  GM  +PESPRF ++KG+  EA  ++++   L  +DP V AE+E I A    EK 
Sbjct: 197 AIIMFIGMCFLPESPRFYVKKGKVPEALSALSRLRGLPKDDPAVEAELEEILANYNYEKS 256

Query: 311 AGSATWGELFSSKGKILQRVIMGVMIQSLQQLTGNNYFFYYGTTIFQAVGMDDSFQTSIV 370
            GS T  + F       +R+ +G+ IQ+LQQLTG N+ FYYGT  FQ  G+ + F   ++
Sbjct: 257 FGSTTVWDCFRPANHQSKRMFIGIAIQALQQLTGINFIFYYGTQFFQHSGIRNPFVIQLI 316

Query: 371 LGIVNFASTFVGLWTVEKFGRRKCLLWGSASMASCFVVFASVGVTRLWPNGQDQPSSKGA 430
           + IVN   T  G+  +E  GRR  LLWG+  M    ++ ASVG           P S  A
Sbjct: 317 MNIVNVIFTIPGIALIELAGRRNLLLWGAIGMCVSEIIVASVGTAL--------PDSTAA 368

Query: 431 GNCMIVXXXXXXXXXXXXWAPIAYVIVSESYPLRVKNRAMAISVGSNWIWGFLIGFFTPF 490
              +I             W P+A+V++ E YPLRV+ +++A    SNW++ F I + TP+
Sbjct: 369 NKTLIAFSCTFIASFAATWGPLAWVVIGEIYPLRVRGKSVAFCTASNWLFNFAIAYATPY 428

Query: 491 IT--------SAINFYYGYVFMGCLXXXXXXXXXXXCETKGLTLEEVNEMYEEGVLPWKS 542
           +         S + F +G    GC             ETKGLTLE+V+E+++ G     S
Sbjct: 429 LVDEDRANLQSKVFFIWG----GCTFLCFIFVYFCVYETKGLTLEQVDELFDSGASARTS 484

Query: 543 DSWLPAGRRGTDYNTEE 559
             ++P+     DY   E
Sbjct: 485 KRFIPSEGYAHDYPDAE 501

>CAGL0M04103g 452677..454272 similar to sp|P42833 Saccharomyces
           cerevisiae YNL318c HXT1 hexose transport protein,
           hypothetical start
          Length = 531

 Score =  292 bits (747), Expect = 7e-92,   Method: Compositional matrix adjust.
 Identities = 169/522 (32%), Positives = 267/522 (51%), Gaps = 26/522 (4%)

Query: 33  QTSTPSNKASRDDFDLKPENE-------HFPEIPQKKLSEYILVMCLCLMVAFGGFVFGW 85
           +  T +   +R  F L  ++E        + E+  K + ++   + LC +++FGG + GW
Sbjct: 17  ENYTLNTAETRQSFQLSGKSEVNTIPGEKYEELKMKYIRQHTKAVVLCCLISFGGMILGW 76

Query: 86  DTGTISGFVNMTDFKRRFGNYSQ-SEGTYYLSNVRTGLIVAIFNIGCAFGGLTLGRLGDI 144
           D GT+ G   M  F   FG+ +        LSN++ GL ++IFNIGCA GG+   RL + 
Sbjct: 77  DIGTVGGVSIMPSFNNAFGDQTTIVSSAKELSNMKRGLYISIFNIGCALGGIMFSRLSNT 136

Query: 145 YGRRLGLMCXXXXXXXXXXXXXATGDKWYQYFIGRIISGLGVGGIAVLSPTLISETAPKH 204
            GRR+G++               +   +      R + G+ VG I+VL P  +SE+AP  
Sbjct: 137 VGRRVGILTAIAKYTLVLTVQLFSNGNFILLLASRFVLGVTVGAISVLVPMFVSESAPIK 196

Query: 205 LRGTCVAFYQLMITLGIFLGYCTNYGTKTY------TNSVQWRVPLGMCFAWAIFMIAGM 258
           +RG  V  YQL ITLGI  G   NY T  +       N++ W++P+   + WA  +  G 
Sbjct: 197 IRGALVVVYQLAITLGILFGNILNYMTNKHLSMVDPMNNMAWKIPMLFGYLWAAIVAVGA 256

Query: 259 LLVPESPRFLIE-KGRFEEARRSIAKSNKLTVEDPGVSAEVE--LINAGVEAEKLAGSAT 315
            + PES  FL + +  +E A+ S +  N ++V D      V   L+   V  E    +  
Sbjct: 257 CITPESVHFLAKIRNDYESAKISYSIMNNISVFDHETIDYVNNLLVKQDVYNENDLRNHK 316

Query: 316 WGELFSSKGKILQRVIMGVMIQSLQQLTGNNYFFYYGTTIFQAVGMDDSFQTSIVLGIVN 375
           + E    K K  +R+++G+M+ + QQL+G NYFFYYGT++F++VG+ D++ T+I+L  VN
Sbjct: 317 F-EFLYGKPKYGKRLLIGIMVMAFQQLSGINYFFYYGTSLFKSVGIKDTYATAIILSSVN 375

Query: 376 FASTFVGLWTVEKFGRRKCLLWGSASMASCFVVFASVGVTRLWPNGQDQPSSKGAGNCMI 435
           F STF G++ VE  GRR  L++GS  M  C + +AS G   L    +D  S       +I
Sbjct: 376 FISTFAGIYLVESLGRRSTLIYGSFGMFICMIFYASFGTLSLR---KDLLSF-----VLI 427

Query: 436 VXXXXXXXXXXXXWAPIAYVIVSESYPLRVKNRAMAISVGSNWIWGFLIGFFTPFITSAI 495
           +              P+++V+V+E +P R ++ +M+I    NW+  F I   TP I + I
Sbjct: 428 IVTCLFISIFAITIGPVSFVVVAELFPTRTRSVSMSICSSFNWLVNFAIALATPVIINRI 487

Query: 496 NFYYGYVFMGCLXXXXXXXXXXXCETKGLTLEEVNEMYEEGV 537
            F YG+ F GCL            ETK  T EE++ M++  +
Sbjct: 488 GFLYGFFFAGCLLLATGFEAFFVPETKNKTEEEIDYMFQNNL 529

>YNL318C (HXT14) [4295] chr14 complement(38706..40328) Member of the
           hexose transporter family of the major facilitator
           superfamily (MFS) [1623 bp, 540 aa]
          Length = 540

 Score =  292 bits (748), Expect = 8e-92,   Method: Compositional matrix adjust.
 Identities = 170/488 (34%), Positives = 267/488 (54%), Gaps = 37/488 (7%)

Query: 72  LCLMVAFGGFVFGWDTGTISGFVNMTDFKRRFG--NYSQSEGTYY-----LSNVRTGLIV 124
           LCL+++ GGF+FGWD GTI G  NM  F+ +FG  N    + T +     L++++ GLI+
Sbjct: 63  LCLVISLGGFIFGWDIGTIGGMTNMVSFQEKFGTTNIIHDDETIFVSTKKLTDLQIGLII 122

Query: 125 AIFNIGCAFGGLTLGRLGDIYGRRLGLMCXXXXXXXXXXXXXATGDKWYQYFIGRIISGL 184
           +IFNI C  G LTL ++GD  GR+ G+                +  +WY   +GR ++G+
Sbjct: 123 SIFNISCGVGALTLSKIGDWIGRKGGIWFALVVYCIGITIQILSYGRWYFLTLGRAVTGI 182

Query: 185 GVGGIAVLSPTLISETAPKHLRGTCVAFYQLMITLGIFLGYCTNY----GTKTYTNSVQW 240
           GVG   VL P  +SE +P  +RG+ V+ YQL++T GI +G   N+      K  T ++ W
Sbjct: 183 GVGVTTVLVPMFLSENSPLKIRGSMVSTYQLIVTFGILMGNILNFICERCYKDPTQNIAW 242

Query: 241 RVPLGMCFAWAIFMIAGMLLVPESPRFLIE-KGRFEEARRSIAKSNKLTVEDPGVSAEVE 299
           ++PL + + WAI +   ++ VPESP++L + K     A+ S A+ N +   D   S  +E
Sbjct: 243 QLPLFLGYIWAIIIGMSLVYVPESPQYLAKIKNDVPSAKYSFARMNGIPATD---SMVIE 299

Query: 300 LINAGV-------------EAEKLAGSATWGELFSSKGKILQRVIMGVMIQSLQQLTGNN 346
            I+  +             + + L    T+ E    K K+  R+I+G+MI + QQL+G N
Sbjct: 300 FIDDLLENNYNNEETNNESKKQSLVKRNTF-EFIMGKPKLWLRLIIGMMIMAFQQLSGIN 358

Query: 347 YFFYYGTTIFQAVGMDDSFQTSIVLGIVNFASTFVGLWTVEKFGRRKCLLWGSASMASCF 406
           YFFYYGT++F+ VG+ D + TSI+L  VNF ST +G++ VEK+G + CLL+GS ++    
Sbjct: 359 YFFYYGTSVFKGVGIKDPYITSIILSSVNFLSTILGIYYVEKWGHKTCLLYGSTNLLFYM 418

Query: 407 VVFASVGVTRLWPNGQDQPSSKGAGNCMIVXXXXXXXXXXXXWAPIAYVIVSESYPLRVK 466
           + +A+VG       G++   S      +I+              P+ +V+VSE +PLR +
Sbjct: 419 MTYATVGTF-----GRETDFSNIV---LIIVTCCFIFWFAITLGPVTFVLVSELFPLRTR 470

Query: 467 NRAMAISVGSNWIWGFLIGFFTPFITSAINFYYGYVFMGCLXXXXXXXXXXXCETKGLTL 526
             +MAI    NW++ FLI   TP I S I+F  GY+F  CL            ET+    
Sbjct: 471 AISMAICTFINWMFNFLISLLTPMIVSKIDFKLGYIFAACLLALIIFSWILVPETRKKNE 530

Query: 527 EEVNEMYE 534
           +E+N+++E
Sbjct: 531 QEINKIFE 538

>Kwal_27.9678
          Length = 513

 Score =  285 bits (728), Expect = 3e-89,   Method: Compositional matrix adjust.
 Identities = 169/485 (34%), Positives = 252/485 (51%), Gaps = 27/485 (5%)

Query: 74  LMVAFGGFVFGWDTGTISGFVNMTDFKRRF---GNYSQSEGTYYLSNVRTGLIVAIFNIG 130
           L VAFGG +FG+DTGTISG + M   K+ F   G+++  E         T LI AI + G
Sbjct: 26  LFVAFGGILFGYDTGTISGVLAMDYVKQHFTSRGHFTADE---------TSLITAILSAG 76

Query: 131 CAFGGLTLGRLGDIYGRRLGLMCXXXXXXX-XXXXXXATGDKWYQYFIGRIISGLGVGGI 189
              G +      D  GRRLGL+               ATG        GR+I+G GVG +
Sbjct: 77  TFCGAILAPLASDTIGRRLGLILSTIIFTVGVVLQVAATGQDLL--IAGRVIAGAGVGVL 134

Query: 190 AVLSPTLISETAPKHLRGTCVAFYQLMITLGIFLGYCTNYGTKTYTNSVQWRVPLGMCFA 249
           + + P   SE +PK +RG  V+ YQ  IT+G+ L  C N GT    +S  +R+PL +   
Sbjct: 135 SAIVPLYQSEASPKWIRGAVVSCYQWAITIGLLLAACVNQGTHARQDSGSYRIPLALQLL 194

Query: 250 WAIFMIAGMLLVPESPRFLIEKGRFEEARRSIAKSNKLTVEDPGVSAEVELINAGVEAEK 309
           WA+ +  GM+++PESPRF I K +  EARR+++K   L  E   V AE+E I A  + E 
Sbjct: 195 WALILFIGMVILPESPRFYIMKEKVPEARRALSKLRGLPEEHCAVEAELEEIVANYKFES 254

Query: 310 LAGSATWGELFSSKGKILQRVIMGVMIQSLQQLTGNNYFFYYGTTIFQAVGMDDSFQTSI 369
             GS +  + F      L+R+++G+ +Q LQQLTG N+ FYYGT  FQ  G+ D F   +
Sbjct: 255 SFGSNSVWDCFKPANHQLKRILIGIAVQGLQQLTGINFIFYYGTQFFQNSGIKDPFIIQL 314

Query: 370 VLGIVNFASTFVGLWTVEKFGRRKCLLWGSASMASCFVVFASVGVTRLWPNGQDQPSSKG 429
           ++ +VN   T  G+  VE  GRR  LLWG+  M    ++ A+VG           P S  
Sbjct: 315 IMNVVNVIMTIPGIALVEIAGRRNLLLWGAVGMCVSELIVAAVGTAL--------PDSFS 366

Query: 430 AGNCMIVXXXXXXXXXXXXWAPIAYVIVSESYPLRVKNRAMAISVGSNWIWGFLIGFFTP 489
           A   +I             W P+A+V+V E +PLRV+ +++A+   SNW++ F I + TP
Sbjct: 367 ANKTLIAFSCTFIASFAATWGPLAWVVVGEIFPLRVRAKSVAVCAASNWLFNFAIAYATP 426

Query: 490 FITSA----INFYYGYVFMGCLXXXXXXXXXXXCETKGLTLEEVNEMYEEGVLPWKSDSW 545
           ++  +    +     +++ GC             ETKGLTLE++++++E      +S  +
Sbjct: 427 YLVDSEHANLQSKVFFIWGGCTFLCFLFVYFFIYETKGLTLEQIDQLFETCPSARQSKGF 486

Query: 546 LPAGR 550
           +P  R
Sbjct: 487 IPTER 491

>Kwal_55.20064
          Length = 238

 Score =  272 bits (695), Expect = 6e-88,   Method: Compositional matrix adjust.
 Identities = 141/240 (58%), Positives = 168/240 (70%), Gaps = 10/240 (4%)

Query: 12  SVASGKVGASKD------SDSALQLNLQTSTPSNKASRDDFD-LKPENEHFPEIPQKKLS 64
           S AS  +G SK       S  +  +N   +    + S D+ D LK + E   ++  KK  
Sbjct: 2   SSASPDIGPSKSLSDDQGSHGSNVMNAPAAKLHREESHDEIDALKKDAEE--QLANKKSG 59

Query: 65  EYILVMCLCLMVAFGGFVFGWDTGTISGFVNMTDFKRRFGNYSQSEGTYYLSNVRTGLIV 124
           +++ V   C+MVAFGGFVFGWDTGTISGFV  TDFKRRFG  + S+G +YLSNVRTGL+V
Sbjct: 60  DFVFVSLCCIMVAFGGFVFGWDTGTISGFVAQTDFKRRFGQ-TNSKGEHYLSNVRTGLMV 118

Query: 125 AIFNIGCAFGGLTLGRLGDIYGRRLGLMCXXXXXXXXXXXXXATGDKWYQYFIGRIISGL 184
           +IFNIGCA GG+ LG+LG++YGRRLGL               A+ DKWYQYFIGRIISGL
Sbjct: 119 SIFNIGCAIGGIVLGKLGEVYGRRLGLTIVVVIYAVGIIIQIASIDKWYQYFIGRIISGL 178

Query: 185 GVGGIAVLSPTLISETAPKHLRGTCVAFYQLMITLGIFLGYCTNYGTKTYTNSVQWRVPL 244
           GVG I VLSP LISE +PKHLRGT V+ YQ M+T GIFLGYC NYGTKTY+NSVQWRVPL
Sbjct: 179 GVGAITVLSPMLISEVSPKHLRGTLVSCYQFMVTGGIFLGYCANYGTKTYSNSVQWRVPL 238

>Scas_624.5
          Length = 798

 Score =  246 bits (629), Expect = 3e-72,   Method: Compositional matrix adjust.
 Identities = 148/480 (30%), Positives = 237/480 (49%), Gaps = 26/480 (5%)

Query: 76  VAFGGFVFGWDTGTISGFVNMTDFKRRFGNYSQSEGTYYLSNVRTGLIVAIFNIGCAFGG 135
           VA GGF+FG+DTG I+   +M   K        +   ++ +N +  ++V+  ++G  FG 
Sbjct: 119 VAVGGFLFGYDTGLINSLTDMAYVKSHL-----APNHHFFTNEQMSIVVSFLSLGTFFGA 173

Query: 136 LTLGRLGDIYGRRLGLMCXXXXXXXXXXXXXATGDKWYQYFIGRIISGLGVGGIAVLSPT 195
           LT   + D YGR+  +M                   W    IGR++SGLG+G I+ + P 
Sbjct: 174 LTAPVIADSYGRKATIMFSTAVIFSIGNSLQVASSGWKLLIIGRVVSGLGIGLISAVVPL 233

Query: 196 LISETAPKHLRGTCVAFYQLMITLGIFLGYCTNYGTKTYTNSVQWRVPLGMCFAWAIFMI 255
             +E A K+LRG  ++ YQ  ITLG+ +    + GT+   N   +R+P+G+ + W+ F+ 
Sbjct: 234 YQAEAAKKNLRGAIISTYQCAITLGLLVSSAVSQGTQHINNPASYRIPIGLQYVWSSFLA 293

Query: 256 AGMLLVPESPRFLIEKGRFEEARRSIAKSNKLTVEDPGVSAEVELINAGVEAEKLAG-SA 314
            GM+ +PESPR+ + K   + A +S++    + ++DP +  E+  I A  + E   G S+
Sbjct: 294 IGMIFLPESPRYYVMKDDIDRAAKSLSFLRGVPIQDPRLLEELVEIKATYDYEASFGPSS 353

Query: 315 TWGELFSSKGKILQ--RVIMGVMIQSLQQLTGNNYFFYYGTTIFQAVGMDDSFQTSIVLG 372
            W    SS+ +  Q  R+  G+ IQ+ QQ +G N+ FYYG T F   G++ S+  S++  
Sbjct: 354 IWDCFKSSENRPKQVLRMFTGIAIQTFQQFSGINFIFYYGVTFFSKTGVNKSYMVSLITY 413

Query: 373 IVNFASTFVGLWTVEKFGRRKCLLWGSASMASCFVVFASVGVTRLWPNGQDQPSSKGAGN 432
            VN A    G++ VE  GRRK LL+G   + +   V A VG          +  S  A  
Sbjct: 414 AVNVAFNIPGMFLVEYLGRRKILLFGGIVVTASNFVIAGVGC---------RMDSVVANK 464

Query: 433 CMIVXXXXXXXXXXXXWAPIAYVIVSESYPLRVKNRAMAISVGSNWIWGFLIGFFTPFI- 491
            MI             W+   +VI +E YPL V+++  AI   +NW+  F+    TP+I 
Sbjct: 465 VMIAFICLFIASFSATWSGAVWVISAELYPLGVRSKCTAICAAANWLVNFICALITPYIV 524

Query: 492 ------TSAINFYYGYVFMGCLXXXXXXXXXXXCETKGLTLEEVNEMYEEGVLPWKSDSW 545
                 T   N ++ +  +  L            ET GLTLEE++E+Y E    + S +W
Sbjct: 525 NSGSESTMGANIFFIWGSLNALGVVCVFFTVY--ETSGLTLEEIDELYRESANCFGSIAW 582

>CAGL0I03872g 337985..340273 some similarities with sp|Q12300
           Saccharomyces cerevisiae YDL138w RGT2 or sp|P10870
           Saccharomyces cerevisiae YDL194w SNF3, hypothetical
           start
          Length = 762

 Score =  232 bits (592), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 148/483 (30%), Positives = 237/483 (49%), Gaps = 26/483 (5%)

Query: 74  LMVAFGGFVFGWDTGTISGFVNMTDFKRRFG-NYSQSEGTYYLSNVRTGLIVAIFNIGCA 132
           L VA GGF++G+DTG I+   +M   K     N+S      + +  +  ++V+  ++G  
Sbjct: 121 LFVAVGGFLYGYDTGLINSITDMKYVKEHIAPNHS------FFTTTQISMLVSFLSLGTF 174

Query: 133 FGGLTLGRLGDIYGRRLGLMCXXXXXXXXXXXXXATGDKWYQYFIGRIISGLGVGGIAVL 192
            G L    + DIYGR+  ++                        +GR+ISG+G+G I+ +
Sbjct: 175 VGALIAPWISDIYGRKSTIIFSTMIIFSIGNSLQVAAGGLALLIVGRVISGIGIGIISAV 234

Query: 193 SPTLISETAPKHLRGTCVAFYQLMITLGIFLGYCTNYGTKTYTNSVQWRVPLGMCFAWAI 252
            P   +E A KH+RG  +  YQL ITLG+ +    + GT++      +RVP+G+ + W++
Sbjct: 235 VPLYQAEAAQKHMRGAIITTYQLAITLGLLVSSAVSQGTESINAPSSYRVPIGLQYVWSV 294

Query: 253 FMIAGMLLVPESPRFLIEKGRFEEARRSIAKSNKLTVEDPGVSAEVELINAGVEAEKLAG 312
            +  GM+ +PESPR+ I K   EEA RS++    +++EDP +  E+  I A  + E   G
Sbjct: 295 VLGVGMVFLPESPRYYIMKDEIEEAARSLSFLRGISLEDPRLLEELVEIKANYDYESSFG 354

Query: 313 SATWGELFSS---KGKILQRVIMGVMIQSLQQLTGNNYFFYYGTTIFQAVGMDDSFQTSI 369
             +  + F S   + K + R+  G+ IQ+ QQ +G N+ FYYG   F   G+  S+  S 
Sbjct: 355 PVSIWDCFRSSEQRPKQVLRMFTGISIQAFQQFSGINFIFYYGVYFFNKTGIKSSYLVSF 414

Query: 370 VLGIVNFASTFVGLWTVEKFGRRKCLLWGSASMASCFVVFASVGVTRLWPNGQDQPSSKG 429
           V   VN A    G++ ++  GRRK L++G  +M +C  + A VGV+           S  
Sbjct: 415 VTYAVNVAFNIPGMFLIDYLGRRKVLIFGGIAMTACNFIIAIVGVS---------AKSIV 465

Query: 430 AGNCMIVXXXXXXXXXXXXWAPIAYVIVSESYPLRVKNRAMAISVGSNWIWGFLIGFFTP 489
           + N MI             W  + +VI +E +PL V+++  AI   +NW+  F+    TP
Sbjct: 466 SNNVMIAFICVFIAAFSSTWGGVVWVISAELFPLGVRSKCTAICAAANWLVNFVCALMTP 525

Query: 490 FITSAINFYYG------YVFMGCLXXXXXXXXXXXC-ETKGLTLEEVNEMYEEGVLPWKS 542
           +I    + Y        Y   G L             ET+GLTLEE+NE+Y     P+ S
Sbjct: 526 YIVDTGSNYTSSMGTKIYFIWGSLNALGTIVAYLTVYETRGLTLEEINELYVNSPTPFAS 585

Query: 543 DSW 545
           + W
Sbjct: 586 NEW 588

>YDL194W (SNF3) [679] chr4 (111581..114235) High-affinity glucose
           sensor responsible for induction of gene expression in
           the presence of low glucose, member of the glucose
           sensor subfamily of the hexose transporter family of the
           major facilitator superfamily (MFS) [2655 bp, 884 aa]
          Length = 884

 Score =  231 bits (589), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 146/488 (29%), Positives = 236/488 (48%), Gaps = 25/488 (5%)

Query: 55  FPEIPQKKLSEYILVMCLCLMVAFGGFVFGWDTGTISGFVNMTDFKRRFGNYSQSEGTYY 114
           F E PQK+    ++ +C+ + VA GGF+FG+DTG I+   +M   K        S     
Sbjct: 85  FSEPPQKQ--SMMMSICVGVFVAVGGFLFGYDTGLINSITSMNYVKSHVAPNHDSFTAQQ 142

Query: 115 LSNVRTGLIVAIFNIGCAFGGLTLGRLGDIYGRRLGLMCXXXXXXXXXXXXXATGDKWYQ 174
           +S     ++V+  ++G  FG LT   + D YGR+  ++                      
Sbjct: 143 MS-----ILVSFLSLGTFFGALTAPFISDSYGRKPTIIFSTIFIFSIGNSLQVGAGGITL 197

Query: 175 YFIGRIISGLGVGGIAVLSPTLISETAPKHLRGTCVAFYQLMITLGIFLGYCTNYGTKTY 234
             +GR+ISG+G+G I+ + P   +E   K LRG  ++ YQ  IT G+ +    + GT   
Sbjct: 198 LIVGRVISGIGIGAISAVVPLYQAEATHKSLRGAIISTYQWAITWGLLVSSAVSQGTHAR 257

Query: 235 TNSVQWRVPLGMCFAWAIFMIAGMLLVPESPRFLIEKGRFEEARRSIAKSNKLTVEDPGV 294
            ++  +R+P+G+ + W+ F+  GM  +PESPR+ + K + +EA +S++    + V D G+
Sbjct: 258 NDASSYRIPIGLQYVWSSFLAIGMFFLPESPRYYVLKDKLDEAAKSLSFLRGVPVHDSGL 317

Query: 295 SAEVELINAGVEAEKLAGSATWGELF-SSKGKILQ--RVIMGVMIQSLQQLTGNNYFFYY 351
             E+  I A  + E   GS+ + + F SSK +  Q  R+  G+ +Q+ QQ +G N+ FYY
Sbjct: 318 LEELVEIKATYDYEASFGSSNFIDCFISSKSRPKQTLRMFTGIALQAFQQFSGINFIFYY 377

Query: 352 GTTIFQAVGMDDSFQTSIVLGIVNFASTFVGLWTVEKFGRRKCLLWGSASMASCFVVFAS 411
           G   F   G+ +S+  S +   VN      GL+ VE FGRRK L+ G   M     + A 
Sbjct: 378 GVNFFNKTGVSNSYLVSFITYAVNVVFNVPGLFFVEFFGRRKVLVVGGVIMTIANFIVAI 437

Query: 412 VGVTRLWPNGQDQPSSKGAGNCMIVXXXXXXXXXXXXWAPIAYVIVSESYPLRVKNRAMA 471
           VG +           +  A   MI             W  + +VI +E YPL V+++  A
Sbjct: 438 VGCSL---------KTVAAAKVMIAFICLFIAAFSATWGGVVWVISAELYPLGVRSKCTA 488

Query: 472 ISVGSNWIWGFLIGFFTPFI------TSAINFYYGYVFMGCLXXXXXXXXXXXCETKGLT 525
           I   +NW+  F+    TP+I      TS++     +++                ETKGLT
Sbjct: 489 ICAAANWLVNFICALITPYIVDTGSHTSSLGAKIFFIWGSLNAMGVIVVYLTVYETKGLT 548

Query: 526 LEEVNEMY 533
           LEE++E+Y
Sbjct: 549 LEEIDELY 556

>CAGL0J09020g 887145..889715 highly similar to sp|P10870
           Saccharomyces cerevisiae YDL194w SNF3 or sp|Q12300
           Saccharomyces cerevisiae YDL138w RGT2, start by
           similarity
          Length = 856

 Score =  229 bits (585), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 154/526 (29%), Positives = 251/526 (47%), Gaps = 36/526 (6%)

Query: 55  FPEIPQKKLSEYILVMCLCLMVAFGGFVFGWDTGTISGFVNMTDFKRRFGNYSQSEGTYY 114
           F E PQK+   +++ + +   VA GGF+FG+DTG I+  V+M     R+   + +     
Sbjct: 107 FAEPPQKQ--SHMMSIVVGAFVAVGGFLFGYDTGLINSIVDM-----RYVRENIAPNHVG 159

Query: 115 LSNVRTGLIVAIFNIGCAFGGLTLGRLGDIYGRRLGLMCXXXXXXXXXXXXXATGDKWYQ 174
            +  +  ++V+  ++G   G L+   + D YGR+  +M                      
Sbjct: 160 FTAQQLAILVSFLSLGTFVGALSAPVISDKYGRKKTIMFSTAVVFSLGNSLQVGAHNIQL 219

Query: 175 YFIGRIISGLGVGGIAVLSPTLISETAPKHLRGTCVAFYQLMITLGIFLGYCTNYGTKTY 234
              GR+ISGLGVG ++ + P   +E A K LRG  ++ YQ  IT G+ +    + GT   
Sbjct: 220 LIAGRVISGLGVGLVSAVVPLYQAEAAHKSLRGAIISTYQWAITWGLLVSSAVSQGTHNR 279

Query: 235 TNSVQWRVPLGMCFAWAIFMIAGMLLVPESPRFLIEKGRFEEARRSIAKSNKLTVEDPGV 294
            ++  +R+P+G+ + WA  + AGML +PESPR+ + + + ++A +S++    + + D G+
Sbjct: 280 NDASSYRIPIGLQYVWAYILAAGMLWLPESPRYYVLRDQLDKAAQSLSFLRGVPIHDSGL 339

Query: 295 SAEVELINAGVEAEKLAGSATWGELF---SSKGKILQRVIMGVMIQSLQQLTGNNYFFYY 351
             E+  I A  + E   G  T+ + F    S+ K   R+  G+ IQ+ QQ +G N+ FYY
Sbjct: 340 LEELVEIKATFDYESSFGKTTFWDCFKSNKSRPKQTLRMFTGIAIQAFQQFSGINFIFYY 399

Query: 352 GTTIFQAVGMDDSFQTSIVLGIVNFASTFVGLWTVEKFGRRKCLLWGSASMASCFVVFAS 411
           G + F   G+++S+  S++   VN   +  G++ VE FGRR  LL+G A M     + A 
Sbjct: 400 GVSFFNRSGVENSYIVSLITYAVNVGFSVPGMFLVEYFGRRSVLLYGGAIMTLSNFIIAI 459

Query: 412 VGVTRLWPNGQDQPSSKGAGNCMIVXXXXXXXXXXXXWAPIAYVIVSESYPLRVKNRAMA 471
           VG +           S  A   MI             W  + +VI +E YPL V+ +  A
Sbjct: 460 VGSS---------TQSVVANKVMIAFICLFIASFAATWGGVVWVISAELYPLGVRAKCTA 510

Query: 472 ISVGSNWIWGFLIGFFTPFITSA----------INFYYGYV-FMGCLXXXXXXXXXXXCE 520
           I   +NW+  F+  F TP+I             I F +G +  +G L            E
Sbjct: 511 ICAAANWLINFVCAFITPYIVDTGERRALIGPKIYFIWGSLNALGILVVYFTVY-----E 565

Query: 521 TKGLTLEEVNEMYEEGVLPWKSDSWLPAGR-RGTDYNTEEAHTDDK 565
           T+GLTLEE++E+Y +      S  W    R R   Y  +E    D+
Sbjct: 566 TRGLTLEEIDELYTKSPNGIVSAKWNRRIRHREKTYGHKEQQNRDR 611

>Kwal_56.24469
          Length = 709

 Score =  226 bits (576), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 157/522 (30%), Positives = 241/522 (46%), Gaps = 32/522 (6%)

Query: 38  SNKASRDDFDLKPENEHF-----PEIPQKKLSEYILVMCLCLMVAFGGFVFGWDTGTISG 92
           SN  S DD  +   N        P  PQ  L    + + + + VA GGF++G+DTG I+ 
Sbjct: 58  SNVESEDDRHIGLSNLESTLFLRPSRPQSSL----MSILVGVFVAVGGFLYGYDTGLINN 113

Query: 93  FVNMTDFKRRFGNYSQSEGTYYLSNVRTGLIVAIFNIGCAFGGLTLGRLGDIYGRRLGLM 152
              M   K  F    Q      +S     ++V+  ++G  FG L    + D +GR+  ++
Sbjct: 114 ITEMKYVKTHFAENKQQFTAKEMS-----ILVSFLSLGTFFGALVAPFMSDTWGRKTTII 168

Query: 153 CXXXXXXXXXXXXXATGDKWYQYFIGRIISGLGVGGIAVLSPTLISETAPKHLRGTCVAF 212
                            +      IGR+ SG+GVG I+ + P   SE A K +RG  ++ 
Sbjct: 169 FSTFFVFMVGNSLQVAANGTTLLVIGRVFSGVGVGFISAVVPLYQSEAAQKRVRGAIIST 228

Query: 213 YQLMITLGIFLGYCTNYGTKTYTNSVQWRVPLGMCFAWAIFMIAGMLLVPESPRFLIEKG 272
           YQ  IT G+ +    + GT    +   +R+P+G+ F W+  +  GM+ +PESPR+ + K 
Sbjct: 229 YQWAITWGLLVSSAVSQGTHNRMDPSSYRIPIGLQFVWSCILGFGMIFLPESPRYYVLKD 288

Query: 273 RFEEARRSIAKSNKLTVEDPGVSAEVELINAGVEAEKLAGSATWGELF-SSKGKILQRVI 331
           + + A +S+A    +  +D G+  E+  I A  + E   GS ++ + F SSK +  QR+ 
Sbjct: 289 QLDRAAKSLAFLRGVPEDDSGLLEELVEIKANYDYEMSFGSFSYLDCFRSSKSRTKQRLR 348

Query: 332 M--GVMIQSLQQLTGNNYFFYYGTTIFQAVGMDDSFQTSIVLGIVNFASTFVGLWTVEKF 389
           M  G+ IQ+ QQL+G N+ FYYG   F   G+ DS+  S V   VN      GL+ VE  
Sbjct: 349 MLTGIAIQAFQQLSGINFIFYYGVNFFSKSGVGDSYLVSFVTYAVNVGFNIPGLFLVEYM 408

Query: 390 GRRKCLLWGSASMASCFVVFASVGVTRLWPNGQDQPSSKGAGNCMIVXXXXXXXXXXXXW 449
           GRRK L++G   M +   V A VG             S  A   MI             W
Sbjct: 409 GRRKVLIFGGVLMTAANFVIAIVGCVE---------RSVIADKIMIAFVCVFIASFSATW 459

Query: 450 APIAYVIVSESYPLRVKNRAMAISVGSNWIWGFLIGFFTPFI------TSAINFYYGYVF 503
               + I +E YPL V+++  AI   SNW+  F+    TP+       TS++     +++
Sbjct: 460 GGCVWAISAELYPLGVRSKCTAICAASNWLVNFICAMITPYFIHTGAHTSSLGTKVFFIW 519

Query: 504 MGCLXXXXXXXXXXXCETKGLTLEEVNEMYEEGVLPWKSDSW 545
            G              ET+GLTLEE++ +Y      + SDSW
Sbjct: 520 GGLNAIGVVVVYLTVYETRGLTLEEIDLLYRLSPNCFTSDSW 561

>YDL138W (RGT2) [730] chr4 (213352..215643) Low-affinity glucose
           sensor responsible for induction of gene expression in
           the presence of high glucose, member of the glucose
           sensor subfamily of the hexose transporter family of the
           major facilitator superfamily (MFS) [2292 bp, 763 aa]
          Length = 763

 Score =  218 bits (556), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 145/499 (29%), Positives = 244/499 (48%), Gaps = 24/499 (4%)

Query: 63  LSEYILVMCLCLMVAFGGFVFGWDTGTISGFVNMTDFKRRFG-NYSQSEGTYYLSNVRTG 121
           L   ++ + + + VA GGF+FG+DTG I+   +M   K     N+S      Y +  +  
Sbjct: 93  LRSNVMSVLVGIFVAVGGFLFGYDTGLINSITDMPYVKTYIAPNHS------YFTTSQIA 146

Query: 122 LIVAIFNIGCAFGGLTLGRLGDIYGRRLGLMCXXXXXXXXXXXXXATGDKWYQYFIGRII 181
           ++V+  ++G  FG L    + D YGR+  +M                        +GR+I
Sbjct: 147 ILVSFLSLGTFFGALIAPYISDSYGRKPTIMFSTAVIFSIGNSLQVASGGLVLLIVGRVI 206

Query: 182 SGLGVGGIAVLSPTLISETAPKHLRGTCVAFYQLMITLGIFLGYCTNYGTKTYTNSVQWR 241
           SG+G+G I+ + P   +E A K+LRG  ++ YQ  IT+G+ +    + GT +      +R
Sbjct: 207 SGIGIGIISAVVPLYQAEAAQKNLRGAIISSYQWAITIGLLVSSAVSQGTHSKNGPSSYR 266

Query: 242 VPLGMCFAWAIFMIAGMLLVPESPRFLIEKGRFEEARRSIAKSNKLTVEDPGVSAEVELI 301
           +P+G+ + W+  +  GM+ +PESPR+ + K    +A +S++    L +EDP +  E+  I
Sbjct: 267 IPIGLQYVWSSILAVGMIFLPESPRYYVLKDELNKAAKSLSFLRGLPIEDPRLLEELVEI 326

Query: 302 NAGVEAEKLAGSATWGELFSS---KGKILQRVIMGVMIQSLQQLTGNNYFFYYGTTIFQA 358
            A  + E   G +T  + F +   + K + R+  G+ IQ+ QQ +G N+ FYYG   F  
Sbjct: 327 KATYDYEASFGPSTLLDCFKTSENRPKQILRIFTGIAIQAFQQASGINFIFYYGVNFFNN 386

Query: 359 VGMDDSFQTSIVLGIVNFASTFVGLWTVEKFGRRKCLLWGSASMASCFVVFASVGVTRLW 418
            G+D+S+  S +   VN A +  G++ V++ GRR  LL G   MA   +V A VGV+   
Sbjct: 387 TGVDNSYLVSFISYAVNVAFSIPGMYLVDRIGRRPVLLAGGVIMAIANLVIAIVGVSE-- 444

Query: 419 PNGQDQPSSKGAGNCMIVXXXXXXXXXXXXWAPIAYVIVSESYPLRVKNRAMAISVGSNW 478
             G+   +SK     MI             W  + +V+ +E YPL V+++  AI   +NW
Sbjct: 445 --GKTVVASK----IMIAFICLFIAAFSATWGGVVWVVSAELYPLGVRSKCTAICAAANW 498

Query: 479 IWGFLIGFFTPFI------TSAINFYYGYVFMGCLXXXXXXXXXXXCETKGLTLEEVNEM 532
           +  F     TP+I      TS++     +++ G              ET+GLTLEE++E+
Sbjct: 499 LVNFTCALITPYIVDVGSHTSSMGPKIFFIWGGLNVVAVIVVYFAVYETRGLTLEEIDEL 558

Query: 533 YEEGVLPWKSDSWLPAGRR 551
           + +      S  W    R+
Sbjct: 559 FRKAPNSVISSKWNKKIRK 577

>ADR091W [1832] [Homologous to ScYDL194W (SNF3) - SH; ScYDL138W
           (RGT2) - SH] complement(872925..874919) [1995 bp, 664
           aa]
          Length = 664

 Score =  210 bits (534), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 147/530 (27%), Positives = 245/530 (46%), Gaps = 34/530 (6%)

Query: 47  DLKPENEHFP------EIPQKKLSEYILVMCLCLMVAFGGFVFGWDTGTISGFVNMTDFK 100
           DL+ ++E F       E P  + S  + ++ + + VA GGF++G+DTG I+    M+  K
Sbjct: 66  DLRDDSEGFSIQETELERPAMRQSNKMSIL-VGIFVAVGGFLYGYDTGLINSITEMSFVK 124

Query: 101 RRFGNYSQSEGTYYLSNVRTGLIVAIFNIGCAFGGLTLGRLGDIYGRRLGLMCXXXXXXX 160
           + F     +      +++   ++V+  ++G   G L    L D YGR+  ++        
Sbjct: 125 KHF-----APNHVNFTSMEMSILVSFLSLGTFIGALAAPLLADSYGRKSTVIFSTFIMFL 179

Query: 161 XXXXXXATGDKWYQYFIGRIISGLGVGGIAVLSPTLISETAPKHLRGTCVAFYQLMITLG 220
                  +         GR+ SG+ VG I+V+ P    E A K  RG  +  YQ  IT G
Sbjct: 180 EGTLLQVSATSMALLVAGRVASGVAVGLISVVVPLYQGEAAQKWCRGAIICTYQWAITWG 239

Query: 221 IFLGYCTNYGTKTYTNSVQWRVPLGMCFAWAIFMIAGMLLVPESPRFLIEKGRFEEARRS 280
           + +    + GT    ++  +R+P+ + + W I + +GMLL+PESPR+ + + + ++A  S
Sbjct: 240 LLVSSAVSQGTYLRNDASSYRIPIALQYVWCIILGSGMLLLPESPRYYVLRDQLDKAALS 299

Query: 281 IAKSNKLTVEDPGVSAEVELINAGVEAEKLAGSATWGELFSS---KGKILQRVIMGVMIQ 337
           ++    +  +D G+  E+  I A  + E    S+++ + F +   + K   R++ G+++Q
Sbjct: 300 LSFLRGVPHDDAGLLEELVEIKANYDYEMSLKSSSYLDCFRTSEHRPKQQIRMLSGILLQ 359

Query: 338 SLQQLTGNNYFFYYGTTIFQAVGMDDSFQTSIVLGIVNFASTFVGLWTVEKFGRRKCLLW 397
           + QQ +G N+ FYYG   F + G+  S+  S V   VN      GL+ VE  GRRK LL 
Sbjct: 360 AFQQFSGINFIFYYGVNFFSSTGISKSYLVSFVTYAVNVVFNIPGLFLVEYAGRRKLLLV 419

Query: 398 GSASMASCFVVFASVGVTRLWPNGQDQPSSKGAGNCMIVXXXXXXXXXXXXWAPIAYVIV 457
           G   M     + A VGV+           S  A   MIV            W  + +V+ 
Sbjct: 420 GGVLMTISNFIIAIVGVS---------TDSVIAKKVMIVFICMFIAAFSATWGGVVWVMS 470

Query: 458 SESYPLRVKNRAMAISVGSNWIWGFLIGFFTPFI------TSAINFYYGYVFMGCLXXXX 511
           +E YPL V+++  AI   SNW+  F+    TP++      TS +     +V+        
Sbjct: 471 AEMYPLGVRSKCAAICAASNWLVNFVCAMITPYLIDISSYTSRLGSTIFFVWGSLNAIGV 530

Query: 512 XXXXXXXCETKGLTLEEVNEMYEEGVLPWKSDSWLPAGRRGTDYNTEEAH 561
                   ET GLTLEE+NE+Y        S +W     R    + E+ H
Sbjct: 531 MVVYLTVYETSGLTLEEINELYRRCPSSLASCAW----NRRIKSSPEDYH 576

>Scas_701.44
          Length = 876

 Score =  209 bits (532), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 149/499 (29%), Positives = 231/499 (46%), Gaps = 27/499 (5%)

Query: 56  PEIPQKKLSEYILVMCLCLMVAFGGFVFGWDTGTISGFVNMTDFKRRFGNYSQSEGTYYL 115
           P  PQ+K    I+ + + + VA GGF+FG+DTG I+    M           +   T  L
Sbjct: 94  PPRPQRK----IMSIVVGVFVAVGGFLFGYDTGLINSITEMDYVLTHLTPNHREFTTEQL 149

Query: 116 SNVRTGLIVAIFNIGCAFGGLTLGRLGDIYGRRLGLMCXXXXXXXXXXXXXATGDKWYQY 175
           S     + V+  ++G  FG LT     D YGR++ +M                 +     
Sbjct: 150 S-----ITVSFLSLGTFFGALTAPVFADNYGRKVTIMISTLIIFSVGNSLQVAANGIVLL 204

Query: 176 FIGRIISGLGVGGIAVLSPTLISETAPKHLRGTCVAFYQLMITLGIFLGYCTNYGTKTYT 235
            +GR+ISG G+G I+ + P   +E A K LRG  ++ YQ  IT G+ +      GT    
Sbjct: 205 IVGRVISGFGIGIISAVVPLYQAEAAHKSLRGAIISTYQWAITWGLLVSSAVAQGTHNRH 264

Query: 236 NSVQWRVPLGMCFAWAIFMIAGMLLVPESPRFLIEKGRFEEARRSIAKSNKLTVEDPGVS 295
            +  +R+P+G+ + W+  +  GM+ +PESPR+ + K + ++A  S++   ++ ++D G+ 
Sbjct: 265 GASSYRIPIGLQYIWSFILAFGMIFLPESPRYYVLKDQLDKAAESLSFLRRVPIQDSGLL 324

Query: 296 AEVELINAGVEAEKLAGSAT-WGELFSSKGKILQRVIM--GVMIQSLQQLTGNNYFFYYG 352
            E+  I A  + E   GS   W    SSK +  Q++ M  G+ IQ+ QQ +G N+ FYYG
Sbjct: 325 EELVEIKATYDYECSFGSTHFWDCFISSKTRPKQKLRMFTGIAIQAFQQFSGINFIFYYG 384

Query: 353 TTIFQAVGMDDSFQTSIVLGIVNFASTFVGLWTVEKFGRRKCLLWGSASMASCFVVFASV 412
              F   G+D+S+  S +   VN      G+  VE  GRRK LL G   M     + A V
Sbjct: 385 VNFFNKTGVDNSYLVSFITYAVNVIFNIPGMVLVEFIGRRKVLLIGGILMLMSNFIVAIV 444

Query: 413 GVTRLWPNGQDQPSSKGAGNCMIVXXXXXXXXXXXXWAPIAYVIVSESYPLRVKNRAMAI 472
           G T           S  A   MI             W  + +VI +E YPL V+++  AI
Sbjct: 445 GST---------VESVVADKVMIAFICLFIASFSATWGGVVWVISAELYPLGVRSKCTAI 495

Query: 473 SVGSNWIWGFLIGFFTPFI------TSAINFYYGYVFMGCLXXXXXXXXXXXCETKGLTL 526
              +NW+  F+    TP+I      TS++     Y++                ETKGLTL
Sbjct: 496 CAAANWLVNFICCLITPYIVDTGSHTSSMGTKIYYIWGSLNVLGVIVVYFTVYETKGLTL 555

Query: 527 EEVNEMYEEGVLPWKSDSW 545
           E+++E+Y        S  W
Sbjct: 556 EQIDELYSRASNSINSTKW 574

>KLLA0F05181g 510384..512747 gi|2440082|emb|CAA75114.1 Kluyveromyces
           lactis putative glucose sensor, start by similarity
          Length = 787

 Score =  207 bits (526), Expect = 7e-58,   Method: Compositional matrix adjust.
 Identities = 147/542 (27%), Positives = 250/542 (46%), Gaps = 31/542 (5%)

Query: 15  SGKVGASKDSDSALQLNLQTSTPSNKASRDDFDLKPENEHFPEIPQKKLSEYILVMCLCL 74
           S    A+   + AL+ + +    +N AS  +     E+E F   P K+  +  + + + +
Sbjct: 41  SNNASATSSPEEALENSGENFELTNFASLSEM----ESEIFLAPPAKQSKK--ISILVGM 94

Query: 75  MVAFGGFVFGWDTGTISGFVNMTDFKRRFGNYSQSEGTYYLSNVRTGLIVAIFNIGCAFG 134
            VA GGF+FG+DTG I+    M    ++F     +    + +  +  ++V+  ++G   G
Sbjct: 95  FVAVGGFLFGYDTGLINNISEMPYVNQKF-----APNKNHFTTPQISILVSFLSLGTFIG 149

Query: 135 GLTLGRLGDIYGRRLGLMCXXXXXXXXXXXXXATGDKWYQYFIGRIISGLGVGGIAVLSP 194
            L    + D YGR+  ++                        +GR++SG+ VG I+   P
Sbjct: 150 ALLAPLISDSYGRKTTMIFSTFVVFMIGNSLQVAAGSMTILVVGRVLSGMSVGLISAAVP 209

Query: 195 TLISETAPKHLRGTCVAFYQLMITLGIFLGYCTNYGTKTYTNSVQWRVPLGMCFAWAIFM 254
              SE A K +RG  ++ YQ  IT G+ +    + GT    ++  +++P+G+ + W+  +
Sbjct: 210 LYQSEAAQKSVRGAIISCYQWAITWGLLVASAVSQGTYKRMDASSYQIPIGLQYIWSFLL 269

Query: 255 IAGMLLVPESPRFLIEKGRFEEARRSIAKSNKLTVEDPGVSAEVELINAGVEAEKLAGSA 314
             G+L +PESPR+ + K R ++A +S++    +  +D G+  E+  I A  + E   G  
Sbjct: 270 GVGILFLPESPRYYVFKDRLDKAAKSLSFLRGVPEDDSGLLEELVEIKATYDYEMSFGKI 329

Query: 315 TWGELF-SSKGKILQRVIM--GVMIQSLQQLTGNNYFFYYGTTIFQAVGMDDSFQTSIVL 371
           ++ + F S++ +  QR+ M  G+ +Q+ QQ++G N+ FYYG   F   G+ +S+  S V 
Sbjct: 330 SYLDCFRSTRSRTKQRLRMLTGIALQAFQQVSGINFIFYYGVDFFNKSGVSESYLVSFVT 389

Query: 372 GIVNFASTFVGLWTVEKFGRRKCLLWGSASMASCFVVFASVGVTRLWPNGQDQPSSKGAG 431
             VN A    GL+ VE  GRRK LL G   M     + A VG+            S  A 
Sbjct: 390 YAVNVAFNIPGLFLVEYIGRRKLLLMGGILMTISNFIIAIVGLAT---------DSMVAN 440

Query: 432 NCMIVXXXXXXXXXXXXWAPIAYVIVSESYPLRVKNRAMAISVGSNWIWGFLIGFFTPFI 491
             MI             W    +VI +E YPL V+ +  AI   SNW+  F+    TP+I
Sbjct: 441 KVMIAFICLFIASFSATWGGGVWVISAELYPLGVRAKCTAICAASNWLINFICALITPYI 500

Query: 492 --------TSAINFYYGYVFMGCLXXXXXXXXXXXCETKGLTLEEVNEMYEEGVLPWKSD 543
                    ++I     +V+                ET GL+LEE++E+Y++      S 
Sbjct: 501 MHIDSSVRQTSIGTKIFFVWGSLNAVGVLVVYFTVYETNGLSLEEIDELYKKSSSGINSI 560

Query: 544 SW 545
            W
Sbjct: 561 EW 562

>Kwal_34.16261
          Length = 327

 Score =  184 bits (466), Expect = 5e-53,   Method: Compositional matrix adjust.
 Identities = 103/271 (38%), Positives = 152/271 (56%), Gaps = 19/271 (7%)

Query: 69  VMCLCLMVAFGGFVFGWDTGTISGFVNMTDFKRRFGNYSQSEGTYYLSNVRTGLIVAIFN 128
           V+  C  ++F GF FG+DTGTI G  NM  + RRFG+     G Y+++    G++V+ F+
Sbjct: 58  VVLSCFGISFTGFFFGYDTGTIGGITNMQAWLRRFGHLDVESGEYHMATALVGIVVSAFH 117

Query: 129 IGCAFGGLTLGRLGDIYGRRLGLMCXXXXXXXXXXXXXATG-DKWYQYFIGRIISGLGVG 187
           IGC  GG T+ RL D  GRR+ +               + G DKWYQ+ IGR+++GL VG
Sbjct: 118 IGCIIGGFTIARLADHLGRRIPIAIACIIYMIGISIQMSAGQDKWYQFMIGRMVTGLTVG 177

Query: 188 GIAVLSPTLISETAPKHLRGTCVAFYQLMITLGIFLGYCTNYGTK-TYTNSVQWRVPLGM 246
             AVLSP L+SE AP  +RG  V FYQ+ +T GI +GY   Y TK TY++   WR+PL  
Sbjct: 178 ANAVLSPMLLSEIAPPGIRGLFVNFYQVNVTHGILVGYIVVYATKSTYSDDRMWRLPLIG 237

Query: 247 CFAWAIFMIAGMLLVPESPRFLIEKGRFEEARRSIAK---------------SNKLTVED 291
            F +++ ++  +   PESPR+LI++ RFE+A+   A+                ++L + D
Sbjct: 238 GFVFSMIILPLLARAPESPRYLIKRCRFEDAKCVFARLRGIDLKQVEASSPSRDQLIILD 297

Query: 292 PGVSAEVELINAGVE-AEKLAGSATWGELFS 321
             +S E++ I       E+   S T+  LFS
Sbjct: 298 -SISEELQYIREAYHYQEQQQRSVTFWHLFS 327

>KLLA0F26246g 2432209..2433960 similar to sp|P39932 Saccharomyces
           cerevisiae YDR536w STL1 member of the sugar permease
           family, start by similarity
          Length = 583

 Score =  167 bits (423), Expect = 9e-45,   Method: Compositional matrix adjust.
 Identities = 140/489 (28%), Positives = 218/489 (44%), Gaps = 31/489 (6%)

Query: 75  MVAFGGF-VFGWDTGTISGFVNMTDFKRRFGNYSQSEGTYYLSNVRTGLIVAIFNIGCAF 133
           + A  GF +FG+D G +SG +    F   F    ++      + V  G + + + +GC F
Sbjct: 29  ITAVTGFSLFGYDQGLMSGIITGVRFNDEFPGTKETSDDDRHATVVQGAVTSCYELGCFF 88

Query: 134 GGLTLGRLGDIYGRR-LGLMCXXXXXXXXXXXXXATGDKWY--QYFIGRIISGLGVGGIA 190
           G L +   G+  GR+ L +               A GD W   Q+ IGR+I+GLG G   
Sbjct: 89  GSLFVMMRGEKIGRKPLIIFGALLTIVGAVISTAAFGDHWGLGQFVIGRVITGLGTGMNT 148

Query: 191 VLSPTLISETAPKHLRGTCVAFYQLMITLGIFLGYCTNYGTKTYTNSVQWRVPLGMCFAW 250
              P   SE +    RG  V     +I +G  + Y  ++G      SVQWR P+ M   +
Sbjct: 149 STIPVWQSEMSKPENRGLLVNLEGSVIAVGTMIAYWIDFGLSYVDTSVQWRFPVAMQIFF 208

Query: 251 AIFMIAGMLLVPESPRFLIEKGRFEEARRSIAKSNKLTVEDPGVSAEVELINAGVEAEKL 310
           AI ++ G++ +P+SPR+L+ +GR EEA   + K + L   D  + AEV  I   V   K 
Sbjct: 209 AILLMIGIVQLPDSPRWLVAQGRREEAMYVLGKLDDLDPNDDQIVAEVSTIQDAVNRFKH 268

Query: 311 AGSATWGELFSSKGKILQRVIMGVMIQSLQQLTGNNYFFYYGTTIF-QAVGMDDSFQTSI 369
              +    L   KG+ LQR ++    Q  QQ TG N   YY T +F + + ++D  + S+
Sbjct: 269 QKRSMKELLHGGKGQNLQRALVAASTQFFQQFTGCNAAIYYSTVLFKKTIKLED--RLSL 326

Query: 370 VLGIVNFA-----STFVGLWTVEKFGRRKCLLWGSASMASCFVVFASVGVTRLWPNGQDQ 424
           VLG V FA     ST    + +E  GRRK  + G+      F++  +  V     N    
Sbjct: 327 VLGGV-FATIYALSTIPSFFLIETLGRRKLFMLGAFGQGCSFLITFACLVHDTTQN---- 381

Query: 425 PSSKGAGNCMIVXXXXXXXXXXXXWAPIAYVIVSESYPLRVKNRAMAISVGSNWIWGFLI 484
             +KGA   + +               + ++   E   +RV++   A S  +NW+  F +
Sbjct: 382 --AKGAAVGLFLFIVFFGMSILS----LPWIYPPEIASMRVRSMTNAFSTCTNWLCNFAV 435

Query: 485 GFFTP-FITSAINFYYGYVFMGCLXXXXX-XXXXXXCETKGLTLEEVN----EMYEEGVL 538
             FTP FI  A   +  Y+F  C+             ET G TLEE++    + Y +   
Sbjct: 436 VMFTPIFIQDA--GWGCYLFFACINFLYLPVIFFFYPETAGRTLEEIDIIFAKSYTDKTA 493

Query: 539 PWKSDSWLP 547
            W+  + LP
Sbjct: 494 AWRVAANLP 502

>AEL042C [2464] [Homologous to ScYOL156W (HXT11) - SH]
           (557191..558834) [1644 bp, 547 aa]
          Length = 547

 Score =  165 bits (418), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 127/512 (24%), Positives = 224/512 (43%), Gaps = 40/512 (7%)

Query: 53  EHFPEIPQKKLSEYILVMCLCLMVAFGGFVFGWDTGTISGFVNMTDFKRRFGNYSQSEGT 112
           ++FP++     + Y++ +  C+     G +FG+D  ++S   +   +K  F + ++    
Sbjct: 20  DYFPKV----YNVYLVAVVACI----SGMMFGFDISSMSSMQDFEPYKDYFKHPNE---- 67

Query: 113 YYLSNVRTGLIVAIFNIGCAFGGLTLGRLGDIYGRRLGL-MCXXXXXXXXXXXXXATGDK 171
                +  G I A    G   G +    + D +GRR+ L MC             A    
Sbjct: 68  -----LTQGGITASMAAGSLLGSILSPGISDAFGRRVSLHMCSSLWIIGAVLQTAAQNQA 122

Query: 172 WYQYFIGRIISGLGVGGIAVLSPTLISETAPKHLRGTCVAFYQLMITLGIFLGYCTNYGT 231
               F+GRI++GLGVG  + ++P   +E +P  +RG     +QL +T+GI + +   YG+
Sbjct: 123 --MLFVGRIVAGLGVGFGSSVAPVYTAEVSPPKIRGAVGGLFQLSVTVGILVMFLIGYGS 180

Query: 232 KTYTNSVQWRVPLGMCFAWAIFMIAGMLLVPESPRFLIEKGRFEEARRSIAKSNK-LTVE 290
            +  +   +RV   M     + ++    L+PESPR+L   GR++E    + K  + + V 
Sbjct: 181 VSLNSVASFRVAWSMQLVPGVVLLLATFLLPESPRWLANHGRWDETTLVVEKVGRSVNVS 240

Query: 291 DPGVSAEVELINAGVEAEKLAGSATWGELFSSKGKILQRVIMGVMIQSLQQLTGNNYFFY 350
           D  +   +  I   V  +++A   T+ +LF  K +  +++ +G+  Q  QQL G N   Y
Sbjct: 241 DEELRIHINEIRERVALDEMARDFTYADLFRRKTQ--RKIFIGMAAQMWQQLCGMNVMMY 298

Query: 351 YGTTIFQAVGM--DDSFQTSIVLGIVNFASTFVGLWTVEKFGRRKCLLWGSASMASCFV- 407
           Y   +F+  G   + +  +SIV  ++N   T   L+ V++ GRR  L+ G   M +    
Sbjct: 299 YIVHVFKMAGFSGNQNLVSSIVQYVLNVGMTIPSLFLVDRAGRRPVLIIGGVLMFTWLYA 358

Query: 408 ---VFASVGVTRLWPNGQD---------QPSSKGAGNCMIVXXXXXXXXXXXXWAPIAYV 455
              + A+  V R  PNG +          P    A   +IV            W    +V
Sbjct: 359 VAGILATYSVPR--PNGVEGNTTVRIEIPPERSSAAKAVIVCSYLFVCSFAPTWGIGIWV 416

Query: 456 IVSESYPLRVKNRAMAISVGSNWIWGFLIGFFTPFITSAINFYYGYVFMGCLXXXXXXXX 515
             +E +    + R  A+    NW + F +  F P     I +    +F            
Sbjct: 417 YCAEIFNNIERARGSALCTSVNWAFNFALAMFVPTAFKNITWRTYIIFGTFSVALTIHAF 476

Query: 516 XXXCETKGLTLEEVNEMYEEGVLPWKSDSWLP 547
               ETKG TLEE++EM++  +  W++ S+ P
Sbjct: 477 LSFPETKGKTLEEIDEMWDAHIPAWRTASYKP 508

>Kwal_33.14911
          Length = 570

 Score =  164 bits (414), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 137/500 (27%), Positives = 225/500 (45%), Gaps = 33/500 (6%)

Query: 63  LSEYILVMCLCLMVAFGGFVFGWDTGTISGFVNMTDFKRRFGNYSQSEGTYYLSNVRTGL 122
           LS   L + + L    G  +FG+D G +SG +   +F   F     + G+   + +  G 
Sbjct: 15  LSGRSLRLAITLTSVIGFSLFGYDQGLMSGLITGEEFNSEF---PATGGSDRRTKLVQGA 71

Query: 123 IVAIFNIGCAFGGLTLGRLGDIYGRR-LGLMCXXXXXXXXXXXXXATGDKWY--QYFIGR 179
           + A + IGC FG L +   G+  GR+ L ++              A G  W   Q+ +GR
Sbjct: 72  VTACYEIGCFFGSLFVMFRGEQSGRKPLVIVGALLTIIGTVISTAAFGPHWGLGQFVVGR 131

Query: 180 IISGLGVGGIAVLSPTLISETAPKHLRGTCVAFYQLMITLGIFLGYCTNYGTKTYTNSVQ 239
           +++G+G G      P   SE +    RG  V     MI +G  + Y  ++G     +SVQ
Sbjct: 132 VMTGVGTGLNTSTIPVWQSEMSKPENRGILVNLEGSMIAVGTMIAYWIDFGLSYVGSSVQ 191

Query: 240 WRVPLGMCFAWAIFMIAGMLLVPESPRFLIEKGRFEEARRSIAKSNKLTVEDPGVSAEVE 299
           WR P+ M   +A+F++AG+  +P+SPR+L+ +GR ++A   +AK + L ++D  + AE  
Sbjct: 192 WRFPVAMQIFFALFLLAGIWELPDSPRWLMSRGRRDDALYVLAKLDDLPIDDDAIVAEAT 251

Query: 300 LINAGVEAEKLAGSATWGELFSSKGKILQRVIMGVMIQSLQQLTGNNYFFYYGTTIF-QA 358
            I   V   +    +        K + LQR ++    Q  QQ TG N   YY T +F ++
Sbjct: 252 AIQDAVNRFRHEKRSVKDLFTGGKTQNLQRALIASSTQFFQQFTGCNAAIYYSTVLFKES 311

Query: 359 VGMDDSFQTSIVLGIVNFAS-----TFVGLWTVEKFGRRKCLLWGSASMASCF-VVFASV 412
           +G+  + +  ++LG V FA+     T    + VE  GRRK  L G+   A  F + FA +
Sbjct: 312 IGL--TGKLPLILGGV-FATIYTMFTIPSFFLVETLGRRKLFLLGATGQAISFTITFACL 368

Query: 413 GVTRLWPNGQDQPSSKGAGNCMIVXXXXXXXXXXXXWAPIAYVIVSESYPLRVKNRAMAI 472
                     D   +KGA     V               + ++   E   +RV++   A+
Sbjct: 369 -------TKDDAEVAKGAA----VGLFLFICFFGMSLLSLPWIYPPEIASMRVRSATNAL 417

Query: 473 SVGSNWIWGFLIGFFTPFITSAINFYYGYVFMGCLXXXXX-XXXXXXCETKGLTLEEVN- 530
           S  +NW+  F +  FTP        Y  Y+F   +             ET G +LEE++ 
Sbjct: 418 STCTNWLCNFAVVMFTPIFIDDTG-YGCYLFFAVMNYIYIPVIFFFYPETAGRSLEEIDI 476

Query: 531 ---EMYEEGVLPWKSDSWLP 547
              + Y +G+ PW+  + LP
Sbjct: 477 IFAKSYVDGIQPWRVAANLP 496

>Kwal_34.16190
          Length = 556

 Score =  161 bits (408), Expect = 8e-43,   Method: Compositional matrix adjust.
 Identities = 139/561 (24%), Positives = 232/561 (41%), Gaps = 53/561 (9%)

Query: 47  DLKPENEHFPEIPQKKLSEYILVMCLCLMVAFGGFVFGWDTGTISGFVNMTDFKRRFGNY 106
           +++   E +   P K  + Y++ +  C+     G +FG+D  ++S  +   +++  FG  
Sbjct: 12  NVRYRGELYRRFP-KIYNIYVVGLVACI----SGLMFGFDISSMSSMIGTPEYREHFG-- 64

Query: 107 SQSEGTYYLSNVRTGLIVAIFNIGCAFGGLTLGRLGDIYGRRLGLMCXXXXXXXXXXXXX 166
                  Y  +   G I    + G   G L      D +GRR+ L               
Sbjct: 65  -------YPGSTAQGGITGAMSGGSLLGSLVSPNFTDAFGRRVSLHLCAALWIAGAIIQC 117

Query: 167 ATGDKWYQYFIGRIISGLGVGGIAVLSPTLISETAPKHLRGTCVAFYQLMITLGIFLGYC 226
           A  ++     +GR+I G+GVG  + ++P   SE AP ++RGT    +Q  +TLGI + + 
Sbjct: 118 AAQNRG-MLIVGRVIGGMGVGFGSSVAPVYCSEVAPPNIRGTVCGLFQFSVTLGIMILFY 176

Query: 227 TNYGTKTYTNSVQWRVPLGMCFAWAIFMIAGMLLVPESPRFLIEKGRFEEARRSIAK-SN 285
             YG      +  +R+  G+     + ++     +PESPR+L    R+EEA   +A+   
Sbjct: 177 VGYGCHFIHGTAAFRITWGVQIVPGLALLVAAFFLPESPRWLANNDRWEEASEVVARIGA 236

Query: 286 KLTVEDPGVSAEVELINAGVEAEKLAGSATWGELFSSKGKILQRVIMGVMIQSLQQLTGN 345
              V+DP V  ++E I   V  ++ A    +  LF  + K L ++++GV  Q  QQL G 
Sbjct: 237 NGDVDDPRVQIQLEEIKEQVILDQQALGFGYRHLF--REKTLNKIVVGVCAQMWQQLCGM 294

Query: 346 NYFFYYGTTIFQAVGMDDS--FQTSIVLGIVNFASTFVGLWTVEKFGRRKCLLWGSASMA 403
           N   YY   IFQ  G   S    +  +  ++N   T   L+ V+K GRR  L+ G   M 
Sbjct: 295 NVMMYYIVYIFQMAGYSGSRVLVSGSIQYVLNVVMTIPALFLVDKVGRRPVLIVGGIFMF 354

Query: 404 SCFVVFASV--GVTRLWPNGQDQ--------PS-SKGAGNCMIVXXXXXXXXXXXXWAPI 452
               V A +    T   PNG +         PS +K A   +I             W   
Sbjct: 355 IWLFVVAGLLANYTVPSPNGFEGDETVRIRIPSYNKSAAKGVIAASYLFVCSFAPSWGIG 414

Query: 453 AYVIVSESYPLRVKNRAMAISVGSNWIWGFLIGFFTPFITSAINFYYGYVFMGCLXXXXX 512
            ++  SE +    + R  A+    NW + F +  F P     I++    +F         
Sbjct: 415 IWIYCSEIFNNMERARGSALCTSVNWGFNFALALFVPSAFRNISWKTYIIFGVFSVVLTI 474

Query: 513 XXXXXXCETKGLTLEEVNEMYEEGVLPWKSDSWLP----------------------AGR 550
                  ETKG TLEE+++M+ + V  WK+ S++P                       G+
Sbjct: 475 QTFLMFPETKGKTLEEIDQMWADHVPAWKTASYVPDVPFARDEDGNKLAPKSHHFENTGK 534

Query: 551 RGTDYNTEEAHTDDKPLYKRF 571
            G  + +E   + D  L + +
Sbjct: 535 TGEKHTSEHQSSADNSLMRSY 555

>KLLA0A11110g 964084..965739 gi|1346290|sp|P49374|HGT1_KLULA
           Kluyveromyces lactis High-affinity glucose transporter,
           start by similarity
          Length = 551

 Score =  160 bits (406), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 136/551 (24%), Positives = 232/551 (42%), Gaps = 45/551 (8%)

Query: 47  DLKPENEHFPEIPQKKLSEYILVMCLCLMVAFGGFVFGWDTGTISGFVNMTDFKRRFGNY 106
           D++ E   + + P    + Y++    C+     G +FG+D  ++S  +    +K  F N 
Sbjct: 11  DIQYEGTFYKKFPHV-YNIYVIGFIACI----SGLMFGFDIASMSSMIGTDVYKDYFSN- 64

Query: 107 SQSEGTYYLSNVRTGLIVAIFNIGCAFGGLTLGRLGDIYGRRLGLMCXXXXXXXXXXXXX 166
                     ++  G I A    G   G L      D +GR++ L               
Sbjct: 65  --------PDSLTYGGITASMAGGSFLGSLISPNFSDAFGRKVSLHICAALWIIGAILQC 116

Query: 167 ATGDKWYQYFIGRIISGLGVGGIAVLSPTLISETAPKHLRGTCVAFYQLMITLGIFLGYC 226
           A  D+     +GR+ISG+G+G  +  +P   SE +P  +RGT    +Q  +T+GI + + 
Sbjct: 117 AAQDQ-AMLIVGRVISGMGIGFGSSAAPVYCSEISPPKIRGTISGLFQFSVTVGIMVLFY 175

Query: 227 TNYGTKTYTNSVQWRVPLGMCFAWAIFMIAGMLLVPESPRFLIEKGRFEEARRSIAK-SN 285
             YG      +  +R+  G+     + ++ G+  +PESPR+L    R+EE    +A    
Sbjct: 176 IGYGCHFIDGAAAFRITWGLQMVPGLILMVGVFFIPESPRWLANHDRWEETSLIVANIVA 235

Query: 286 KLTVEDPGVSAEVELINAGVEAEKLAGSATWGELFSSKGKILQRVIMGVMIQSLQQLTGN 345
              V +  V  ++E I   V  +  A +  + +LF  + K L + I+GV  Q  QQL G 
Sbjct: 236 NGDVNNEQVRFQLEEIKEQVIIDSAAKNFGYKDLF--RKKTLPKTIVGVSAQMWQQLCGM 293

Query: 346 NYFFYYGTTIFQAVGM--DDSFQTSIVLGIVNFASTFVGLWTVEKFGRRKCLLWGSASMA 403
           N   YY   IF   G   + +   S +  ++N   T   L+ ++KFGRR  L+ G   M 
Sbjct: 294 NVMMYYIVYIFNMAGYTGNTNLVASSIQYVLNVVMTIPALFLIDKFGRRPVLIIGGIFMF 353

Query: 404 SCFVVFASVGVTRLWP-----NGQDQ-----PS-SKGAGNCMIVXXXXXXXXXXXXWAPI 452
           +     A +  T   P     NG D      PS +  A N +I             W   
Sbjct: 354 TWLFSVAGILATYSVPAPGGVNGDDTVTIQIPSENTSAANGVIASSYLFVCFFAPTWGIG 413

Query: 453 AYVIVSESYPLRVKNRAMAISVGSNWIWGFLIGFFTPFITSAINFYYGYVFMGCLXXXXX 512
            ++  SE +    + +  A+S  +NW + F +  F P     I+ +  Y+  G       
Sbjct: 414 IWIYCSEIFNNMERAKGSALSAATNWAFNFALAMFVPSAFKNIS-WKTYIIFGVFSVALT 472

Query: 513 XXXXXXC-ETKGLTLEEVNEMYEEGVLPWKSDSWLPA------------GRRGTDYNTEE 559
                   ETKG TLEE+++M+ + +  W++ +++P             G  G   + E+
Sbjct: 473 IQTFFMFPETKGKTLEEIDQMWVDNIPAWRTANYIPQLPIVKDEEGNKLGLLGNPQHLED 532

Query: 560 AHTDDKPLYKR 570
            H+++K L  R
Sbjct: 533 VHSNEKGLLDR 543

>Sklu_2439.20 YDR536W, Contig c2439 31933-33648
          Length = 571

 Score =  157 bits (396), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 132/496 (26%), Positives = 218/496 (43%), Gaps = 32/496 (6%)

Query: 68  LVMCLCLMVAFGGFVFGWDTGTISGFVNMTDFKRRFGNYSQSEGTYYLSNVRTGLIVAIF 127
           L + + +    G  +FG+D G +SG +   +F   F    +       + V  G + + +
Sbjct: 21  LRLAITITAVTGFSLFGYDQGLMSGIITGKEFNSEFPATHKVSDHDRHATVVQGAVTSCY 80

Query: 128 NIGCAFGGLTLGRLGDIYGRR-LGLMCXXXXXXXXXXXXXATGDKWY--QYFIGRIISGL 184
            +GC FG L +   G+  GR+ L +               A G  W   Q+ IGR+I+G+
Sbjct: 81  ELGCFFGSLFVMFRGEHIGRKPLVIFGALLTVVGTVISTAAFGPHWGLGQFVIGRVITGI 140

Query: 185 GVGGIAVLSPTLISETAPKHLRGTCVAFYQLMITLGIFLGYCTNYGTKTYTNSVQWRVPL 244
           G G      P   SE +    RG  V     +I +G  + Y  ++G     +SVQWR P+
Sbjct: 141 GTGMNTSTIPVWQSEMSKPENRGLLVNLEGSVIAVGTMIAYWIDFGLSYVNSSVQWRFPV 200

Query: 245 GMCFAWAIFMIAGMLLVPESPRFLIEKGRFEEARRSIAKSNKLTVEDPGVSAEVELINAG 304
            M   +A+ ++ G++ +P+SPR+L+ +GR EEA   + K + L   D  + AE  +I   
Sbjct: 201 AMQIFFALLLLVGIVQLPDSPRWLMSQGRREEAMYVLGKLDGLDPNDDQILAEATVIQDA 260

Query: 305 VEAEKLAGSATWGELFSSKGKILQRVIMGVMIQSLQQLTGNNYFFYYGTTIF-QAVGMDD 363
           V   +    +        KG+  QR ++    Q  QQ TG N   YY T +F + + +D 
Sbjct: 261 VNRFRHQKRSVKDLFTGGKGQNFQRALIAASTQFFQQFTGCNAAIYYSTVLFNETIKLD- 319

Query: 364 SFQTSIVLGIVNFASTFVGLWT------VEKFGRRKCLLWGSASMASCFVVFASVGVTRL 417
            ++ S++LG V   ST   L+T      +E  GRRK  L G+   A  F +  +  +   
Sbjct: 320 -YRLSLILGGV--FSTIYALFTIPSFFLIESLGRRKLFLIGATGQAISFTITFACLIDDT 376

Query: 418 WPNGQDQPSSKGAGNCMIVXXXXXXXXXXXXWAPIAYVIVSESYPLRVKNRAMAISVGSN 477
             N      +KGA     V               + ++   E   +RV++   A+S  +N
Sbjct: 377 TQN------AKGAA----VGLFLFISFFGVALLSLPWIYPPEIASMRVRSSTNALSTCTN 426

Query: 478 WIWGFLIGFFTP-FITSAINFYYGYVFMGCLXXXXX-XXXXXXCETKGLTLEEVNEMYE- 534
           W+  F +  FTP FI  A   +  Y+F   +             ET G +LEE++ ++  
Sbjct: 427 WLCNFAVVMFTPIFIQDA--GWGCYLFFAVMNYLYIPVIFFFYPETAGRSLEEIDIIFAK 484

Query: 535 ---EGVLPWKSDSWLP 547
              +G  PW+  + LP
Sbjct: 485 SHVDGTRPWRVAANLP 500

>ADR139C [1880] [Homologous to ScYDR536W (STL1) - NSH]
           (950171..951847) [1677 bp, 558 aa]
          Length = 558

 Score =  154 bits (390), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 128/509 (25%), Positives = 215/509 (42%), Gaps = 26/509 (5%)

Query: 52  NEHFPEIPQKKLSEYILVMCLCLMVAFGGFVFGWDTGTISGFVNMTDFKRRFGNYSQSEG 111
            E F        S   L + + +    G  +FG+D G +SG +N   F   F    +   
Sbjct: 3   KESFSRTATGGFSGRALRLAVTITAVTGFSLFGYDQGLLSGLINGEQFNHEFPATLEQGD 62

Query: 112 TYYLSNVRTGLIVAIFNIGCAFGGLTLGRLGDIYGRR-LGLMCXXXXXXXXXXXXXATGD 170
               + V  G + + + +GC FG L +   G+  GR+ L +M              A  +
Sbjct: 63  NDRHATVVQGAVTSCYELGCFFGSLYVMVDGERRGRKPLIIMGSLLTILGTVVSVAAFRE 122

Query: 171 KWY--QYFIGRIISGLGVGGIAVLSPTLISETAPKHLRGTCVAFYQLMITLGIFLGYCTN 228
            W   Q+ IGR+++GLG G      P   SE +    RG  V     +I +G  + Y  +
Sbjct: 123 HWGLGQFVIGRVVTGLGTGLNTSTIPVWQSEMSKPKNRGLLVNLEGSVIAVGTMIAYWID 182

Query: 229 YGTKTYTNSVQWRVPLGMCFAWAIFMIAGMLLVPESPRFLIEKGRFEEARRSIAKSNKLT 288
           +G     +SVQWR P+ M   +A+ ++ G++ +PESPR+L+  GR  E++  + K + L 
Sbjct: 183 FGLSYVDSSVQWRFPVAMQIVFAVLLLVGIVQLPESPRWLMAHGRTAESKYVLGKLDNLD 242

Query: 289 VEDPGVSAEVELINAGVEAEKLAGSATWGELFSSKGKILQRVIMGVMIQSLQQLTGNNYF 348
             D  V AE   I   V   K    +    L   +G+ LQR ++    Q  QQ TG N  
Sbjct: 243 PSDDSVLAEAAAIEDAVNRFKHEKRSLKDALTGGRGQNLQRTLVACSTQFFQQFTGCNAA 302

Query: 349 FYYGTTIFQAVGMDDSFQTSIVLG----IVNFASTFVGLWTVEKFGRRKCLLWGSASMAS 404
            YY T +F    ++  ++ S++LG     V   +T    + +E  GRRK  L G+     
Sbjct: 303 IYYSTVLFHKT-INLEYRLSLILGGVFSTVYTLATIPSFFLIETVGRRKLFLIGALGQGF 361

Query: 405 CFVVFASVGVTRLWPNGQDQPSSKGAGNCMIVXXXXXXXXXXXXWAPIAYVIVSESYPLR 464
            F +  +  +         + ++KGA   + +               + ++   E   ++
Sbjct: 362 SFTITFACLIN------DTKNNAKGAAVGLFLFIIFFGMTILS----LPWIYPPEISSMK 411

Query: 465 VKNRAMAISVGSNWIWGFLIGFFTPFITSAINF--YYGYVFMGCLXXXXXXXXXXXCETK 522
           V++   A+S  +NW+  F +  FTP       +  Y  +  M  L            ET 
Sbjct: 412 VRSITNAMSTCTNWLCNFAVVMFTPIFIHEAGWGCYLFFAVMNFLYVPIIFFFYP--ETA 469

Query: 523 GLTLEEVNEMYE----EGVLPWKSDSWLP 547
           G +LEE++ +Y     +G   W+  + LP
Sbjct: 470 GRSLEEIDIIYAKSFVDGTQAWRVAANLP 498

>YDR536W (STL1) [1346] chr4 (1507992..1509701) Member of the hexose
           transporter family of the major facilitator superfamily
           (MFS) [1710 bp, 569 aa]
          Length = 569

 Score =  154 bits (390), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 133/502 (26%), Positives = 216/502 (43%), Gaps = 35/502 (6%)

Query: 61  KKLSEYILVMCLCLMVAFGGFVFGWDTGTISGFVNMTDFKRRFGNYSQSEGTYYLSNVRT 120
           KKL  +I +  +      G  +FG+D G ++  +    F   F    ++      + V  
Sbjct: 25  KKLRYFITIASMT-----GFSLFGYDQGLMASLITGKQFNYEFPATKENGDHDRHATVVQ 79

Query: 121 GLIVAIFNIGCAFGGLTLGRLGDIYGRR-LGLMCXXXXXXXXXXXXXATGDKWY--QYFI 177
           G   + + +GC  G L +   G+  GR+ L LM              A    W   Q+ I
Sbjct: 80  GATTSCYELGCFAGSLFVMFCGERIGRKPLILMGSVITIIGAVISTCAFRGYWALGQFII 139

Query: 178 GRIISGLGVGGIAVLSPTLISETAPKHLRGTCVAFYQLMITLGIFLGYCTNYGTKTYTNS 237
           GR+++G+G G      P   SE +    RG  V      I  G  + Y  ++G     +S
Sbjct: 140 GRVVTGVGTGLNTSTIPVWQSEMSKAENRGLLVNLEGSTIAFGTMIAYWIDFGLSYTNSS 199

Query: 238 VQWRVPLGMCFAWAIFMIAGMLLVPESPRFLIEKGRFEEARRSIAKSNKLTVEDPGVSAE 297
           VQWR P+ M   +A+F++A M+ +PESPR+LI + R EEAR  +   +     D  V  E
Sbjct: 200 VQWRFPVSMQIVFALFLLAFMIKLPESPRWLISQSRTEEARYLVGTLDDADPNDEEVITE 259

Query: 298 VELINAGVEAEKLAGSATWGELFSSKGKILQRVIMGVMIQSLQQLTGNNYFFYYGTTIF- 356
           V +++  V   K    +        + + LQR ++    Q  QQ TG N   YY T +F 
Sbjct: 260 VAMLHDAVNRTKHEKHSLSSLFSRGRSQNLQRALIAASTQFFQQFTGCNAAIYYSTVLFN 319

Query: 357 QAVGMDDSFQTSIVLGIVNFA-----STFVGLWTVEKFGRRKCLLWGSASMASCFVVFAS 411
           + + +D  ++ S+++G V FA     ST    + +EK GRRK  L G+   A  F +  +
Sbjct: 320 KTIKLD--YRLSMIIGGV-FATIYALSTIGSFFLIEKLGRRKLFLLGATGQAVSFTITFA 376

Query: 412 VGVTRLWPNGQDQPSSKGAGNCMIVXXXXXXXXXXXXWAPIAYVIVSESYPLRVKNRAMA 471
             V       +++ +++GA     V               + ++   E   ++V+    A
Sbjct: 377 CLVK------ENKENARGAA----VGLFLFITFFGLSLLSLPWIYPPEIASMKVRASTNA 426

Query: 472 ISVGSNWIWGFLIGFFTPFI--TSAINFYYGYVFMGCLXXXXXXXXXXXCETKGLTLEEV 529
            S  +NW+  F +  FTP     S    Y  +  M  L            ET G +LEE+
Sbjct: 427 FSTCTNWLCNFAVVMFTPIFIGQSGWGCYLFFAVMNYLYIPVIFFFYP--ETAGRSLEEI 484

Query: 530 N----EMYEEGVLPWKSDSWLP 547
           +    + YE+G  PW+  + LP
Sbjct: 485 DIIFAKAYEDGTQPWRVANHLP 506

>Scas_637.9
          Length = 607

 Score =  152 bits (384), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 117/424 (27%), Positives = 193/424 (45%), Gaps = 50/424 (11%)

Query: 21  SKDSDSALQLNLQTSTPSNKASRDDFDLKPENEH-------FPEIPQKKLSEYI------ 67
           +KD+ S+ Q NL      ++   + FD + ++E+        P   +   S  I      
Sbjct: 47  TKDTSSSTQSNLIVEGTQSRQDINSFDHETDDENENDRIVIKPVNDEDDTSVIITFNQGI 106

Query: 68  --LVMCLCLMVAFGGFVFGWDTGTIS-GFVNM-TDFKRRFGNYSQSEGTYYLSNVRTGLI 123
              ++ L  + +  GF+FG+DTG IS   V++ TD   +  +Y   E           +I
Sbjct: 107 SAFIITLTFVASISGFMFGYDTGYISSALVSIGTDLDNKVLSYGDKE-----------II 155

Query: 124 VAIFNIGCAFGGLTLGRLGDIYGRRLGLMCXXXXXXXXXXXXXATGDKWYQYFIGRIISG 183
            A  ++G        G   DI+GRR  LM               T  K++Q  +GR+I G
Sbjct: 156 TAATSLGALITSTMAGTAADIFGRRPCLMFSNVMFVIGAILQI-TAHKFWQMAVGRLIMG 214

Query: 184 LGVGGIAVLSPTLISETAPKHLRGTCVAFYQLMITLGIFLGYCTNYGTKTYTNSVQWRVP 243
            GVG  +++SP  ISE APK +RG       L +T G  + Y    G     N   WR+ 
Sbjct: 215 FGVGIGSLISPLFISEIAPKMIRGRLTVINSLWLTGGQLIAYGCGAGLNHVNNG--WRIL 272

Query: 244 LGMCFAWAIFMIAGMLLVPESPRFLIEKGRFEEARRSIAKSNKLTVED--PGVSAEVELI 301
           +G+     +   +  L +P++PR+ + KGR+++A+  + +S K   +D       E+  +
Sbjct: 273 VGLSLIPTVLQFSFFLFLPDTPRYYVMKGRYDDAKSVLHRSYKGASDDIIERKVEELREL 332

Query: 302 NAGVEAEKLAGSATWGELFSSKGKILQRV-------IMGVMIQSLQQLTGNNYFFYYGTT 354
           N  +E + +       + F +  K L RV       I+   +Q++QQ TG N   Y+  T
Sbjct: 333 NHSIEGKNIP------QRFWNTVKELHRVPSNFRALIIACGLQAIQQFTGWNSLMYFSGT 386

Query: 355 IFQAVGMDDSFQTSIVLGIVNFASTFVGLWTVEKFGRRKCLLWG----SASMASCFVVFA 410
           IF+ VG  +S   SI++   NF  T V  + ++K GRR  LL G    + S+  C + F 
Sbjct: 387 IFETVGFSNSSAVSIIVSGTNFIFTLVAFFAIDKIGRRYILLIGLPGMTGSLTVCAIAFH 446

Query: 411 SVGV 414
            +G+
Sbjct: 447 FIGI 450

>KLLA0E00264g 15302..16837 weakly similar to sp|P54854 Saccharomyces
           cerevisiae YDL245c HXT15, start by similarity
          Length = 511

 Score =  149 bits (376), Expect = 9e-39,   Method: Compositional matrix adjust.
 Identities = 117/458 (25%), Positives = 208/458 (45%), Gaps = 18/458 (3%)

Query: 84  GWDTGTISGFVNMTDFKRRFGNYSQSEGTYYLSNVRTGLIVAIFNIGCAFGGLTLGRLGD 143
           G+D    +    M  F  +FG Y    G Y +  V    + +   IG AFG +    +  
Sbjct: 57  GFDNQGFATIQAMDSFIEKFGQYDAQTGAYAIPPVFLSFLNSFQYIGFAFGLVCGSIVSS 116

Query: 144 IYGRRLGLMCXXXXXXXXXXXXXATGDKWYQYFIGRIISGLGVGGIAVLSPTLISETAPK 203
            +GR++ ++               +  K  Q    R+++ + +G    + P   +E  P 
Sbjct: 117 RFGRKICVLSMSLYALITATIGITSNSKE-QILSARVLNYVFIGMEMAVIPVFQAEIVPP 175

Query: 204 HLRGTCVAFYQLMITLGIFLGYCTNYGTKTYTNSVQWRVPLGMCFAWAIFMIAGMLLVPE 263
           + RG  V  +QL + +G  + +     T     +  WR+PLG+ + +   + + ++ +PE
Sbjct: 176 NTRGFFVGAFQLSLNIGGLVIHIITNSTAHIDGTSSWRIPLGLYYIFPSVIASLVMFIPE 235

Query: 264 SPRFLIEKGRFEEARRSIAKSNKLTVEDPGVSAEVELINAGVEAEKLAGSATWGELFSSK 323
           SPR+LI KG+ EEA RS+ +    T+ +  +  E E I + VEAEK   S  + ELF+  
Sbjct: 236 SPRWLILKGKKEEAMRSLVRLRNGTIYESEIINEYESIISSVEAEKQEKSK-YTELFTGT 294

Query: 324 GKILQRVIMGVMIQSLQQLTGNNYFFYYGTTIFQAVGMDDSFQTSIVLGIVNFASTFVGL 383
            K  +R ++ ++    QQ+TG  +   YGT   +++   D FQ SIV  +V   +  + L
Sbjct: 295 NK--RRTLIVILANIFQQVTGQAFASQYGTIFIKSLNTVDPFQMSIVSSVVAIVAVIIVL 352

Query: 384 WTVEKFGRRKCLLWGSASMASCFVVFASVGVTRLWPNGQDQPSSKGAGNCMIVXXXXXXX 443
              ++FGR+K L+ GS   A   +V   +G         D  ++K  G  ++        
Sbjct: 353 LFTDEFGRKKFLVIGSVIQAIALLVMGGLGT-------GDVTTAKKNG--IVATMMINSF 403

Query: 444 XXXXXWAPIAYVIVSESYPLRVKNRAMAISVGSNWIWGFLIGFFTPFITSA----INFYY 499
                WAP++YVI SE    R++++  A+ +  N ++ F+  F  P++ S     +    
Sbjct: 404 AYCISWAPLSYVISSEIPTPRLRDKTYAVGILFNILFAFITAFTLPYLLSKPYANLQSKV 463

Query: 500 GYVFMGCLXXXXXXXXXXXCETKGLTLEEVNEMYEEGV 537
           G+++ G              E +GL+LEE+   +   V
Sbjct: 464 GFIY-GAFTVLSVVFSYYLPECRGLSLEEIESNFVNKV 500

>Scas_552.0d
          Length = 112

 Score =  138 bits (347), Expect = 9e-39,   Method: Compositional matrix adjust.
 Identities = 62/101 (61%), Positives = 74/101 (73%)

Query: 470 MAISVGSNWIWGFLIGFFTPFITSAINFYYGYVFMGCLXXXXXXXXXXXCETKGLTLEEV 529
           MA++ G NW W FLI FFTPFIT AINFYYGYVFMGC+            E KGLTLEEV
Sbjct: 7   MALANGCNWFWNFLISFFTPFITGAINFYYGYVFMGCMVFGYFYVFFFVPEMKGLTLEEV 66

Query: 530 NEMYEEGVLPWKSDSWLPAGRRGTDYNTEEAHTDDKPLYKR 570
           NE++E+GVLPWKS +W+P+ RRG D N +E   DDKPL+K+
Sbjct: 67  NELWEDGVLPWKSPNWVPSSRRGADVNMDEFQKDDKPLFKK 107

>KLLA0C12309g 1046848..1048557 highly similar to sp|P30606
           Saccharomyces cerevisiae YOL103w ITR2 myo-inositol
           permease, minor, start by similarity
          Length = 569

 Score =  149 bits (375), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 152/601 (25%), Positives = 244/601 (40%), Gaps = 82/601 (13%)

Query: 2   STSVTPIDNRSVASGKVGASKDSDSALQLNLQTSTPSNKASRDDFDLKPENEHFPE---- 57
           S+ V+PI    ++  K+   KDS             S   + D   +KP N+        
Sbjct: 8   SSDVSPIIFDDISQSKL---KDS-------------SENETTDRIIIKPVNDEDDTSVMI 51

Query: 58  IPQKKLSEYILVMCLCLMVAFGGFVFGWDTGTIS-GFVNM-TDFKRRFGNYSQSEGTYYL 115
              +K+S +IL+  L    +  GF+FG+DTG IS   V++ TD   +   Y   E     
Sbjct: 52  TFNQKISPFILI--LTFTASISGFMFGYDTGYISSALVSIGTDLDNKALTYGDKE----- 104

Query: 116 SNVRTGLIVAIFNIGCAFGGLTLGRLGDIYGRRLGLMCXXXXXXXXXXXXXATGDKWYQY 175
                 +I A  ++G     +  G   DI+GR+  LM              +    W Q 
Sbjct: 105 ------IITAATSLGALISAVFAGISADIFGRKPCLMFSNILFVIGAALQVSAHSFW-QM 157

Query: 176 FIGRIISGLGVGGIAVLSPTLISETAPKHLRGTCVAFYQLMITLGIFLGYCTNYGTKTYT 235
            +GR+I G GVG  ++L+P  ISE APKH+RG       L +T G  + Y    G     
Sbjct: 158 AVGRLIMGFGVGIGSLLAPLFISEIAPKHIRGRLTVINSLWLTGGQLIAYACGAGLNKVH 217

Query: 236 NSVQWRVPLGMCFAWAIFMIAGMLLVPESPRFLIEKGRFEEARRSIAKSNKLTVEDPGVS 295
           N   WR+ +G+     +        +P++PRF + KG +++A   + KS         ++
Sbjct: 218 NG--WRILVGLSLIPTVVQFTCFSFLPDTPRFYVIKGNYKKAAEVLQKSY--------IN 267

Query: 296 AEVELINAGVEA-----EKLAGSATWGELFSSKGKI------LQRVIMGVMIQSLQQLTG 344
           A  ELI+  +       E + G     + F++  ++       + +++G  +Q +QQ  G
Sbjct: 268 APQELIDQKIRELSDLNEAIPGKTPVHKFFNTVKELHTVPCNFRALVIGCALQGIQQFCG 327

Query: 345 NNYFFYYGTTIFQAVGMDDSFQTSIVLGIVNFASTFVGLWTVEKFGRRKCLLWG----SA 400
            N   Y+  TIFQ VG ++S   SI++   NF  T V  + ++K GRR  LL G      
Sbjct: 328 WNSLMYFSGTIFQTVGFENSTAVSIIVAGTNFVFTLVAFFAIDKVGRRAILLIGLPGMMV 387

Query: 401 SMASCFVVFASVGVTRLWPNGQDQPSSKGAGNCMIVXXXXXXXXXXXXWAPIAYV--IVS 458
           S+  C + F  + + +    G+ + S+ G  +  IV               I  V    S
Sbjct: 388 SLVMCAIAFHFLDI-KFTGAGESEVSNGGFSSWGIVVIVFIMVYAAFYALGIGTVPWQQS 446

Query: 459 ESYPLRVKNRAMAISVGSNWIWGFLIGFFTPFITSAINFYYGYVFMGCLXXXXXXXXXXX 518
           E +   V+    +    +NW    +I   + F+T   N      F   L           
Sbjct: 447 ELFATSVRGVGTSYCTATNWAGSLIIA--STFLTMLQNITPTGTF--SLFAALAAVSTVF 502

Query: 519 C-----ETKGLTLEEVNEMYEEGVLPWKSDSWLPAGRRGTDYNTE--------EAHTDDK 565
           C     E  GL LEEV  +  +G    K+   L   R+  +   +        EA+  DK
Sbjct: 503 CYLCYPELSGLELEEVQTILSDG-FNIKASKQLAKKRKQQNSEMQRRFREKDMEAYQKDK 561

Query: 566 P 566
           P
Sbjct: 562 P 562

>Kwal_56.22724
          Length = 578

 Score =  145 bits (366), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 119/436 (27%), Positives = 194/436 (44%), Gaps = 46/436 (10%)

Query: 1   MSTSVTPIDNRSVASGKVGASKDSDSALQLNLQTSTPSNKASRDDFDLKPENEHFPE--- 57
           M+T    +   SV+S K G S D  +   ++         A  D   ++P N+       
Sbjct: 1   MTTHKFEMSTESVSSLK-GPSNDEPTKAGISDAAGASGAAALEDRIQIRPVNDEDDTSVM 59

Query: 58  -IPQKKLSEYILVMCLCLMVAFGGFVFGWDTGTIS-GFVNM-TDFKRRFGNYSQSEGTYY 114
               +K+S +I++  L  + +  GF+FG+DTG IS   +++ TD   R   Y   E    
Sbjct: 60  ITFNQKVSPFIII--LTFVASISGFLFGYDTGYISSALISIGTDLDNRVLTYGDKE---- 113

Query: 115 LSNVRTGLIVAIFNIGCAFGGLTLGRLGDIYGRRLGLMCXXXXXXXXXXXXXATGDKWYQ 174
                  +I A  ++G     +  G   DI+GR+  LM              +    W Q
Sbjct: 114 -------IITAATSLGALISAVAAGTCADIWGRKPCLMISNLFFVIGAVLQVSASTFW-Q 165

Query: 175 YFIGRIISGLGVGGIAVLSPTLISETAPKHLRGTCVAFYQLMITLGIFLGYCTNYGTKTY 234
             +GR+I G GVG  +++SP  I E APK +RG  V    L +T G  + Y    G    
Sbjct: 166 MAVGRLIMGFGVGIGSLISPLFIGEIAPKMIRGRLVVINSLCLTGGQLIAYGCGAGLDHV 225

Query: 235 TNSVQWRVPLGMCFAWAIFMIAGMLLVPESPRFLIEKGRFEEARRSIAKSNKLTVEDPGV 294
            N   WR+ +G+              +P++PR+ + KG+ ++A   +AKS         V
Sbjct: 226 HNG--WRILVGLSLIPTFTQFVCFCFLPDTPRYYVMKGKLDKAAEVLAKSY--------V 275

Query: 295 SAEVELINAGVEA-----EKLAGSATWGELFSSKGKI------LQRVIMGVMIQSLQQLT 343
            A  +LI+  ++        + G +  G+++++  +I       + +I+G  +Q +QQ  
Sbjct: 276 DAPADLIHQKIQELHALNRTIPGDSVPGKVWNTIKEIHTVPANFRALILGCALQGIQQFC 335

Query: 344 GNNYFFYYGTTIFQAVGMDDSFQTSIVLGIVNFASTFVGLWTVEKFGRRKCLLWG----S 399
           G N   Y+  TIF+ VG  +S   SIV+   NF  T V  + +++ GRR  LL G     
Sbjct: 336 GWNSLMYFSGTIFETVGFKNSAAVSIVVAGTNFIFTLVAFFAIDRIGRRSILLIGLPGMC 395

Query: 400 ASMASCFVVFASVGVT 415
            S+  C V F  +GVT
Sbjct: 396 VSLIVCAVAFHYLGVT 411

>Sklu_2313.3 YDR497C, Contig c2313 3640-5376 reverse complement
          Length = 578

 Score =  139 bits (350), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 145/556 (26%), Positives = 231/556 (41%), Gaps = 53/556 (9%)

Query: 42  SRDDFDLKPENEHFPE----IPQKKLSEYILVMCLCLMVAFGGFVFGWDTGTIS-GFVNM 96
           S+D   +KP N+           +K+S +I++  L  + +  GF+FG+DTG IS   V++
Sbjct: 39  SQDRILIKPVNDEDDTSVMITFNQKVSPFIII--LTFVASISGFMFGYDTGYISSALVSI 96

Query: 97  -TDFKRRFGNYSQSEGTYYLSNVRTGLIVAIFNIGCAFGGLTLGRLGDIYGRRLGLMCXX 155
            TD   +   Y + E           +I A  ++G     +  G   D++GR+  +M   
Sbjct: 97  GTDLDNKTLTYGEKE-----------IITAATSLGALITAVFAGVSADLFGRKPCIMFSN 145

Query: 156 XXXXXXXXXXXATGDKWYQYFIGRIISGLGVGGIAVLSPTLISETAPKHLRGTCVAFYQL 215
                      +    W Q  IGR++ G GVG  +++SP  ISE APK +RG       L
Sbjct: 146 LLFVIGAILQVSAHTFW-QMAIGRLVMGFGVGIGSLISPLFISEIAPKMIRGRLTVVNSL 204

Query: 216 MITLGIFLGYCTNYGTKTYTNSVQWRVPLGMCFAWAIFMIAGMLLVPESPRFLIEKGRFE 275
            +T G  + Y    G     N   WR+ +G+     +      + +P++PR+ + KG  E
Sbjct: 205 CLTGGQLIAYACGAGLDKVHNG--WRILVGLSLIPTVIQFTMFMFLPDTPRYYVMKGNLE 262

Query: 276 EARRSIAKSNKLTVEDPGVSAEVELINAGVEAEKLAGSATWGELFSSKGKILQRV----- 330
           +A + + KS    V+ PG   E + +N  VE       A   E   +  K +  V     
Sbjct: 263 KAAQVLGKS---YVDAPGDLIERK-VNELVELNTTIPGANIFEKVRNTVKEIHVVPANFR 318

Query: 331 --IMGVMIQSLQQLTGNNYFFYYGTTIFQAVGMDDSFQTSIVLGIVNFASTFVGLWTVEK 388
             I+G  +Q +QQ  G N   Y+  TIFQ VG ++S   SI++   NF  T V  + ++K
Sbjct: 319 ALIIGCALQGIQQFCGWNSLMYFSGTIFQTVGFENSTAVSIIVAGTNFIFTLVAFFAIDK 378

Query: 389 FGRRKCLLWG----SASMASCFVVFASVGVTRLWPNGQDQPSSKGAGNCMIVXXXXXXXX 444
            GRR  LL G      S+  C + F  + + +    G  + ++ G     IV        
Sbjct: 379 IGRRAILLIGLPGMMVSLIVCAIAFHFLDI-KFVGGGAAEVANGGFSAWGIVIIVSIIVY 437

Query: 445 XXXXWAPIAYV--IVSESYPLRVKNRAMAISVGSNWIWGFLIGFFTPFITSAINFYYGYV 502
                  I  V    SE +P  V+    + S  +NW    +I   + F+T   N      
Sbjct: 438 AAFYALGIGTVPWQQSELFPQSVRGIGTSYSTATNWAGSLIIA--STFLTMLQNITPTGT 495

Query: 503 FMGCLXXXXXXXXXXXC-----ETKGLTLEEVNEMYEEGVLPWKSDSWLPAGRR---GTD 554
           F   L           C     E  GL LEEV  + ++G    K+   L   R+      
Sbjct: 496 F--SLFAAFAAVSTVFCYFCYPELSGLELEEVQMILKDG-FNIKASKVLAKKRKQQMAQQ 552

Query: 555 YNTEEAHTDDKPLYKR 570
              ++  T D  LY++
Sbjct: 553 KADDKCRTKDMELYQQ 568

>Scas_581.6
          Length = 587

 Score =  136 bits (343), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 106/394 (26%), Positives = 179/394 (45%), Gaps = 32/394 (8%)

Query: 35  STPSNKASRDDFDLKPENEHFPEIP-----QKKLSEYILVMCLCLMVAFGGFVFGWDTGT 89
           S   ++   D   +KP N+   ++       + +S +IL+  L  + +  GF+FG+DTG 
Sbjct: 52  SLSDDEEDNDRIQIKPVNDE-DDVSVIITFNQGISPFILI--LTFVASISGFMFGYDTGY 108

Query: 90  IS-GFVNMTDFKRRFGNYSQSEGTYYLSNVRTGLIVAIFNIGCAFGGLTLGRLGDIYGRR 148
           IS   +++     R   Y   E           +I A  ++G     +  G   DI+GR+
Sbjct: 109 ISSALISINKDLGRTLTYGDKE-----------IITAATSLGALISSIFAGTAADIFGRK 157

Query: 149 LGLMCXXXXXXXXXXXXXATGDKWYQYFIGRIISGLGVGGIAVLSPTLISETAPKHLRGT 208
             LM               T  +++Q   GR+I G GVG  +++SP  ISE APK +RG 
Sbjct: 158 PCLMFSNVLFVIGAILQI-TAHRFWQMNAGRLIMGFGVGIGSLISPLFISEIAPKMIRGR 216

Query: 209 CVAFYQLMITLGIFLGYCTNYGTKTYTNSVQWRVPLGMCFAWAIFMIAGMLLVPESPRFL 268
                 L +T G  + Y    G     N   WR+ +G+     +   +  L +P++PR+ 
Sbjct: 217 LTVINSLWLTGGQLIAYGCGAGLNHVHNG--WRILVGLSLIPTVLQFSFFLFLPDTPRYY 274

Query: 269 IEKGRFEEARRSIAKSNKLTVED--PGVSAEVELINAGVEAEKLAGSA--TWGELFSSKG 324
           + KG +E A+  + +S     ED       E+  +N  +  +  A     T  EL ++  
Sbjct: 275 VMKGDYENAKAVLRRSYINAPEDIIDRKVEELTELNHSIPGKNKAVQVWNTVKELHTNPA 334

Query: 325 KILQRVIMGVMIQSLQQLTGNNYFFYYGTTIFQAVGMDDSFQTSIVLGIVNFASTFVGLW 384
              + +I+   +Q++QQ TG N   Y+  TIF+ VG  +S   SI++   NF  T V  +
Sbjct: 335 N-FRALIIACGLQAIQQFTGWNSLMYFSGTIFETVGFSNSSAVSIIVSGTNFVFTLVAFF 393

Query: 385 TVEKFGRRKCLLWG----SASMASCFVVFASVGV 414
            ++K GRR  LL G    + ++  C + F  +G+
Sbjct: 394 AIDKIGRRAILLIGLPGMTMALTICAIAFHFIGI 427

>Kwal_27.11638
          Length = 723

 Score =  136 bits (343), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 130/499 (26%), Positives = 212/499 (42%), Gaps = 44/499 (8%)

Query: 50  PENEHFPEIPQKK--LSEYILVMCLCLMVAFGGFVFGWDTGTISGFVNMTDFKRRFGNYS 107
           P N+  P I  K   L+   L+    + V+ G F+FG+D G +SG +    FK  F + S
Sbjct: 93  PSND-TPHIQVKDSFLTGRALLYFTSVFVSLGVFLFGYDQGVMSGIITGPLFKDYFHDPS 151

Query: 108 QSEGTYYLSNVRTGLIVAIFNIGCAFGGLTLGRLGDIYGRRLGLMCXXXXXXXXXXXXXA 167
           +            G +V+I  IG     L +GRLG+ +GRR  +                
Sbjct: 152 R---------FAIGNMVSILEIGALISSLMVGRLGEKWGRRRTIR-YGSFVFIIGGLFQT 201

Query: 168 TGDKWYQYFIGRIISGLGVGGIAVLSPTLISETAPKHLRG--TCVAFYQLMITLGIFLGY 225
           +  K     IGR+ISGLGVG ++ + P   SE +P H RG   C+ F       G  +GY
Sbjct: 202 SATKLSHLIIGRVISGLGVGLLSTIVPIYQSEISPPHNRGKLACIEF------TGNIVGY 255

Query: 226 CT----NYGTKTYTNSVQWRVPLGMCFAWAIFMIAGMLLVPESPRFLIEKGRFEEARRSI 281
           C+    +YG     N+  WR+PL +     + ++ G  ++ E+PR+L+      E    I
Sbjct: 256 CSSVWVDYGCSYIPNNAAWRLPLFIQCVMGLGLMLGTFVIVETPRWLLNHDHDVEGLIVI 315

Query: 282 AK-SNKLTVEDPGVSAEVELINAGVEAEKLAGS-ATWGELFSSKGKILQRVIMGVMIQSL 339
           A   +   V+D    AE + I   V   +L G   ++  +F    +   R+++ +  Q  
Sbjct: 316 ADLHSNGDVQDQRAHAEFQAIKETVLISRLEGEKKSYSYVFK---RYRTRMLIAMSSQMF 372

Query: 340 QQLTGNNYFFYYGTTIFQA---VGMDDSFQTSIVLGIVNFASTFVGLWTVEKFGRRKCLL 396
            QL G N   YY   +F+    VG D    T I   ++   ST +    V+K+GR+  LL
Sbjct: 373 AQLNGINVISYYAPLVFEQAGWVGRDAILMTGIN-SVIYVLSTILPWHLVDKWGRKPILL 431

Query: 397 WGSASMASCFVVFASVGVTRLWPNGQDQPSSKGAGNCMIVXXXXXXXXXXXXWAPIAYVI 456
            G   M    V  ++     L+ N    P+       ++V            W PI ++ 
Sbjct: 432 IGGMVMGLSLVSISAA----LYINIASTPT------LVVVFVVVFNAFFGFSWGPIPWLY 481

Query: 457 VSESYPLRVKNRAMAISVGSNWIWGFLIGFFTPFITSAINFYYGYVFMGCLXXXXXXXXX 516
             E  PL  ++   + S  +NW+  +L+G  TP +   I +    +              
Sbjct: 482 PVEIAPLSARSAMASASTATNWLCNWLVGIMTPVLQEKIQWRMYLIHAASCFISFWCVLR 541

Query: 517 XXCETKGLTLEEVNEMYEE 535
              ET GL LE++  ++++
Sbjct: 542 VYPETAGLRLEDMGSVFDD 560

>AFR343C [3535] [Homologous to ScYOL103W (ITR2) - SH; ScYDR497C
           (ITR1) - SH] (1060729..1062444) [1716 bp, 571 aa]
          Length = 571

 Score =  135 bits (340), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 125/493 (25%), Positives = 206/493 (41%), Gaps = 54/493 (10%)

Query: 68  LVMCLCLMVAFGGFVFGWDTGTISGFVNMTDFKRRFGNYSQSEGT---YYLSNVRTGLIV 124
            ++ L  + +  GF+FG+DTG IS  +             QS GT   + L+      I 
Sbjct: 65  FIVMLTFVASLSGFLFGYDTGYISSAL-------------QSVGTDLGHQLTYRDKEYIT 111

Query: 125 AIFNIGCAFGGLTLGRLGDIYGRRLGLMCXXXXXXXXXXXXXATGDKWYQYFIGRIISGL 184
           +  ++G     L  G   D++GRR  +M              A  + W Q  +GR++ G 
Sbjct: 112 SATSLGALIAALGAGICADLFGRRKCIMFSNILFVVGTVLQVAAFNFW-QMVVGRLVMGF 170

Query: 185 GVGGIAVLSPTLISETAPKHLRGTCVAFYQLMITLGIFLGYCTNYGTKTYTNSVQWRVPL 244
           G+G  +++SP  ISE APK +RG       L +T G  + Y    G +   +   WR+ +
Sbjct: 171 GIGFGSLISPLFISEIAPKMIRGRLTVINSLWLTGGQLIAYACGAGFQHVKHG--WRILV 228

Query: 245 GMCFAWAIFMIAGMLLVPESPRFLIEKGRFEEARRSIAKSNKLTVEDPGVSAEVELINAG 304
           G+    A+      + +P++PRF + KGR E+A   + ++         V AE  LI+  
Sbjct: 229 GISMLPAVLQFVSFIFLPDTPRFYVMKGRLEDAANVLERTY--------VGAERALIDRK 280

Query: 305 VEA-----EKLAGSATWGELFSSKGKI------LQRVIMGVMIQSLQQLTGNNYFFYYGT 353
           +E      + + G   +  ++++   I      L+ +I+   +Q +QQ  G N   Y+  
Sbjct: 281 IEELVLLNKTIPGRTVFHRVWNTIVAIHTVPANLRALIIACGLQGIQQFCGWNSLMYFSG 340

Query: 354 TIFQAVGMDDSFQTSIVLGIVNFASTFVGLWTVEKFGRRKCLLWG----SASMASCFVVF 409
            IF  VG  D    SIV+   NF  T V  + ++K GRR  LL G    + +M  C + F
Sbjct: 341 DIFSLVGFKDPVAVSIVVAATNFIFTLVAFFAIDKIGRRIILLIGLPGMTTAMTVCAIAF 400

Query: 410 ----ASVGVTRLWPNGQDQPSSKGAGNCMIVXXXXXXXXXXXXWAPIAYVIVSESYPLRV 465
                 V   +L P G+    S   G  +++               + +   SE +P  V
Sbjct: 401 HYIKTEVDGEKLKPVGE----SNAWGIVVVIFIIVYAAFYALGIGTVPWQ-QSELFPQPV 455

Query: 466 KNRAMAISVGSNWIWGFLIG--FFTPFITSAINFYYGYVFMGCLXXXXXXXXXXXCETKG 523
           +    + +  +NW    +I   F T F        +G+ F G              E  G
Sbjct: 456 RGVGTSFATATNWAGSMVIASTFLTMFKNITPTATFGF-FAGISVISLVAVYLCYPELSG 514

Query: 524 LTLEEVNEMYEEG 536
           L LEEV  + ++G
Sbjct: 515 LELEEVQFVLKDG 527

>YDR497C (ITR1) [1312] chr4 complement(1443701..1445455)
           Myo-inositol permease (major), closely related to Itr2p,
           member of the hexose transporter family of the major
           facilitator superfamily (MFS) [1755 bp, 584 aa]
          Length = 584

 Score =  134 bits (337), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 109/426 (25%), Positives = 184/426 (43%), Gaps = 39/426 (9%)

Query: 7   PIDNRSVASGKVGASKDSDSALQLNLQTSTPSNKA-------------SRDDFD---LKP 50
           P      +   VG +  +  +++ N +  +PS +              + DD D   +KP
Sbjct: 6   PYLTSKTSQSNVGDAVGNADSVEFNSEHDSPSKRGKITLESHEIQRAPASDDEDRIQIKP 65

Query: 51  ENEHFPEIPQKKLSEYI--LVMCLCLMVAFGGFVFGWDTGTIS-GFVNM-TDFKRRFGNY 106
            N+          ++ +   ++ L  + +  GF+FG+DTG IS   +++ TD   +   Y
Sbjct: 66  VNDEDDTSVMITFNQSLSPFIITLTFVASISGFMFGYDTGYISSALISIGTDLDHKVLTY 125

Query: 107 SQSEGTYYLSNVRTGLIVAIFNIGCAFGGLTLGRLGDIYGRRLGLMCXXXXXXXXXXXXX 166
            + E           ++ A  ++G     +  G   DI+GR+  LM              
Sbjct: 126 GEKE-----------IVTAATSLGALITSIFAGTAADIFGRKRCLMGSNLMFVIGAILQV 174

Query: 167 ATGDKWYQYFIGRIISGLGVGGIAVLSPTLISETAPKHLRGTCVAFYQLMITLGIFLGYC 226
           +    W Q  +GR+I G GVG  ++++P  ISE APK +RG       L +T G  + Y 
Sbjct: 175 SAHTFW-QMAVGRLIMGFGVGIGSLIAPLFISEIAPKMIRGRLTVINSLWLTGGQLVAYG 233

Query: 227 TNYGTKTYTNSVQWRVPLGMCFAWAIFMIAGMLLVPESPRFLIEKGRFEEARRSIAKSNK 286
              G     N   WR+ +G+           +  +P++PR+ + KG    A   + +S  
Sbjct: 234 CGAGLNYVNNG--WRILVGLSLIPTAVQFTCLCFLPDTPRYYVMKGDLARATEVLKRSYT 291

Query: 287 LTVEDPGVSAEVELI--NAGVEAEKLAGSA--TWGELFSSKGKILQRVIMGVMIQSLQQL 342
            T E+       EL+  N  +  + +      T  EL +     L+ +I+G  +Q++QQ 
Sbjct: 292 DTSEEIIERKVEELVTLNQSIPGKNVPEKVWNTIKELHTVPSN-LRALIIGCGLQAIQQF 350

Query: 343 TGNNYFFYYGTTIFQAVGMDDSFQTSIVLGIVNFASTFVGLWTVEKFGRRKCLLWGSASM 402
           TG N   Y+  TIF+ VG  +S   SI++   NF  T V  ++++K GRR  LL G   M
Sbjct: 351 TGWNSLMYFSGTIFETVGFKNSSAVSIIVSGTNFIFTLVAFFSIDKIGRRTILLIGLPGM 410

Query: 403 ASCFVV 408
               VV
Sbjct: 411 TMALVV 416

>YOL103W (ITR2) [4718] chr15 (124000..125829) Myo-inositol permease
           (minor), closely related to Itr1p, member of the hexose
           transporter family of the major facilitator superfamily
           (MFS) [1830 bp, 609 aa]
          Length = 609

 Score =  134 bits (337), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 136/534 (25%), Positives = 226/534 (42%), Gaps = 54/534 (10%)

Query: 32  LQTSTPSNKASRDDFD------LKPENEHFPEIPQKKLSEYI--LVMCLCLMVAFGGFVF 83
           + TST   K+ +D+ +      +KP N+          ++ I   ++ L  + +  GF+F
Sbjct: 64  VSTSTMQIKSRQDEDEDDGRIVIKPVNDEDDTSVIITFNQSISPFIITLTFVASISGFMF 123

Query: 84  GWDTGTIS-GFVNMT-DFKRRFGNYSQSEGTYYLSNVRTGLIVAIFNIGCAFGGLTLGRL 141
           G+DTG IS   +++  D   +   Y + E           LI A  ++G     +  G  
Sbjct: 124 GYDTGYISSALISINRDLDNKVLTYGEKE-----------LITAATSLGALITSVGAGTA 172

Query: 142 GDIYGRRLGLMCXXXXXXXXXXXXXATGDKWYQYFIGRIISGLGVGGIAVLSPTLISETA 201
            D++GRR  LM               T  K++Q   GR+I G GVG  +++SP  ISE A
Sbjct: 173 ADVFGRRPCLM-FSNLMFLIGAILQITAHKFWQMAAGRLIMGFGVGIGSLISPLFISEIA 231

Query: 202 PKHLRGTCVAFYQLMITLGIFLGYCTNYGTKTYTNSVQWRVPLGMCFAWAIFMIAGMLLV 261
           PK +RG       L +T G  + Y    G     N   WR+ +G+     +   +    +
Sbjct: 232 PKMIRGRLTVINSLWLTGGQLIAYGCGAGLNHVKNG--WRILVGLSLIPTVLQFSFFCFL 289

Query: 262 PESPRFLIEKGRFEEARRSIAKSNKLTVEDPGVSAEVELINAGVEAEKLAGSAT--WG-- 317
           P++PR+ + KG  + A+  + K + +  ED  +  +VE +++  ++       T  W   
Sbjct: 290 PDTPRYYVMKGDLKRAKM-VLKRSYVNTEDEIIDQKVEELSSLNQSIPGKNPITKFWNMV 348

Query: 318 -ELFSSKGKILQRVIMGVMIQSLQQLTGNNYFFYYGTTIFQAVGMDDSFQTSIVLGIVNF 376
            EL +      + +I+G  +Q++QQ TG N   Y+  TIF+ VG  +S   SI++   NF
Sbjct: 349 KELHTVPSN-FRALIIGCGLQAIQQFTGWNSLMYFSGTIFETVGFKNSSAVSIIVSGTNF 407

Query: 377 ASTFVGLWTVEKFGRRKCLLWG----SASMASCFVVFASVGVTRLWPNGQDQP------S 426
             T +  + ++K GRR  LL G    + ++  C + F  +G+     NG D        S
Sbjct: 408 VFTLIAFFCIDKIGRRYILLIGLPGMTVALVICAIAFHFLGIKF---NGADAVVASDGFS 464

Query: 427 SKGAGNCMIVXXXXXXXXXXXXWAPIAYVIVSESYPLRVKNRAMAISVGSNWIWGFLIG- 485
           S G    + +              P      SE +P  V+    + +  +NW    +I  
Sbjct: 465 SWGIVIIVFIIVYAAFYALGIGTVPWQQ---SELFPQNVRGVGTSYATATNWAGSLVIAS 521

Query: 486 -FFTPF--ITSAINFYYGYVFMGCLXXXXXXXXXXXCETKGLTLEEVNEMYEEG 536
            F T    IT    F +   F G              E  GL LEEV  + ++G
Sbjct: 522 TFLTMLQNITPTGTFSF---FAGVACLSTIFCYFCYPELSGLELEEVQTILKDG 572

>Sklu_2427.8 , Contig c2427 19304-21040
          Length = 578

 Score =  132 bits (333), Expect = 8e-33,   Method: Compositional matrix adjust.
 Identities = 113/480 (23%), Positives = 210/480 (43%), Gaps = 21/480 (4%)

Query: 69  VMCLCLMVAFGGFVFGWDTGTISGFVNMTDFKRRFGNYSQSEGTYYLSNVRTGLIVAIFN 128
           +    ++ +    + G+DTG + G  +   F R FG Y +   T   +N     +++ F+
Sbjct: 49  IYATAMIASTASILIGYDTGFVGGCFSNEYFLRNFG-YEKDTPT---ANDALSNMISCFH 104

Query: 129 IGCAFGGLTLGRLGDIYGRRLGLMCXXXXXXXXX-XXXXATGDKWYQYFIGRIISGLGVG 187
               FG L    +   +GRR+ L+               A        +IGR+++GL VG
Sbjct: 105 AAAFFGALISYPMSHYWGRRVSLIIAAGVAAIGAALMMAAVTSHLAPLYIGRVLTGLTVG 164

Query: 188 GIAVLSPTLISETAPKHLRGTCVAFYQLMITLGIFLGYCTNYGTKTYTN--SVQWRVPLG 245
               L+   +SE +P  +RG  +AFY++   +G  +G+  N+G   + +  + QW +PLG
Sbjct: 165 ASTNLTVVYLSEVSPAPIRGQIIAFYEVGWRIGDLIGFWINFGVSEHISPGNKQWIIPLG 224

Query: 246 MCFAWAIFMIAGMLLVPESPRFLIEKGRFEEARRSIAKSNKLTVEDPGVSAEVELINAGV 305
           +    A     G  ++ ESPR+L +  R  EA  ++    +L  +   +  E+  I   +
Sbjct: 225 VQLIPAGMFFVGSFIMKESPRWLFQMDRDHEAIENLHYLRQLPEDHEYMVWEINSIKNSI 284

Query: 306 EAEK----LAGSATWGELFSSKGKILQRVIMGVMIQSLQQLTGNNYFFYYGTTIFQAVGM 361
           E +     L       E+F    K  +R+++  ++   Q   G     YY   IF+++G+
Sbjct: 285 EEQNSTVGLGMFDPVKEVFVRNRKYSRRLVITALLFLFQNFMGIQSINYYSPRIFKSIGV 344

Query: 362 DDSFQT---SIVLGIVNFASTFVG-LWTVEKFGRRKCLLWGSASMASCFVVFASVGVTRL 417
             +  T   S + G+V F  TF+  L+ V+ FGRR+  +W   S + C V F  VG   L
Sbjct: 345 QGTNATLFSSGMFGVVKFICTFIYILFIVDNFGRRRAFMW---SASVCSVCFWYVG-AYL 400

Query: 418 WPNGQDQP--SSKGAGNCMIVXXXXXXXXXXXXWAPIAYVIVSESYPLRVKNRAMAISVG 475
             N   +P  S+   G   I             W+   +V  +E Y   +++   +I+  
Sbjct: 401 KINDPSKPGVSAGPGGKAAIGFMFIWTASFILAWSGGPFVWGAEVYEQNIRSFVQSINAA 460

Query: 476 SNWIWGFLIGFFTPFITSAINFYYGYVFMGCLXXXXXXXXXXXCETKGLTLEEVNEMYEE 535
            +W+  F++   T  +   + +   + F                ETKG+ LE++++++++
Sbjct: 461 ISWVPIFIMTRMTNDMVDKMQYGIFFFFASLAALAVPFVFFFVPETKGIALEDIDKLFDK 520

>CAGL0I07447g 716104..717816 highly similar to sp|P30606
           Saccharomyces cerevisiae YOL103w ITR2 myo-inositol
           permease, minor, hypothetical start
          Length = 570

 Score =  129 bits (324), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 125/487 (25%), Positives = 206/487 (42%), Gaps = 40/487 (8%)

Query: 68  LVMCLCLMVAFGGFVFGWDTGTIS-GFVNM-TDFKRRFGNYSQSEGTYYLSNVRTGLIVA 125
            ++ L  + +  GF+FG+DTG IS   +++ TD   +   Y + E T            A
Sbjct: 72  FIIMLTFVASLSGFLFGYDTGYISSALISIGTDLDNKELTYGEKEIT-----------TA 120

Query: 126 IFNIGCAFGGLTLGRLGDIYGRRLGLMCXXXXXXXXXXXXXATGDKWYQYFIGRIISGLG 185
             ++G     L  G   DI+GR+  LM               T  K++Q   GR I G G
Sbjct: 121 ATSLGALIFALVAGFSVDIFGRKPCLM-FSNIMFLIGAILQVTAHKFWQMTAGRFIMGFG 179

Query: 186 VGGIAVLSPTLISETAPKHLRGTCVAFYQLMITLGIFLGYCTNYGTKTYTNSVQWRVPLG 245
           VG  ++++P  ISE APK +RG       L +T G  + Y    G     N   WR+ +G
Sbjct: 180 VGIGSLIAPLYISEIAPKMIRGRLTVINSLWLTGGQLIAYGCGAGLNHVHNG--WRILVG 237

Query: 246 MCFAWAIFMIAGMLLVPESPRFLIEKGRFEEARRSIAKSNKLTVEDPGVSAEVE---LIN 302
           +     +      + +P++PR+ + KG +E+A+ S+ K +   V D  +  ++E    +N
Sbjct: 238 LSLIPTVLQFVFFIFLPDTPRYYVMKGDYEKAK-SVLKRSYNGVSDELIDRKIEELLALN 296

Query: 303 AGVEAEKLAGSATWGEL--FSSKGKILQRVIMGVMIQSLQQLTGNNYFFYYGTTIFQAVG 360
             +  +      TW  +    +K    + +I+   +Q +QQ TG N   Y+  TIF++VG
Sbjct: 297 QSIPGKNHV-ERTWNAVKELHTKPANFRALIIACGLQGIQQFTGWNSLVYFSGTIFESVG 355

Query: 361 MDDSFQTSIVLGIVNFASTFVGLWTVEKFGRRKCLLWGSASMASCFVV----FASVGVTR 416
             +S   SI++   NF  T V  + ++K GRR  L+ G   M    V+    F  +G+  
Sbjct: 356 FKNSSAVSIIVSGTNFIFTLVAFFCIDKIGRRNILIIGIPGMTVAHVMSAIAFHFIGIKF 415

Query: 417 LWPNGQDQP---SSKGAGNCMIVXXXXXXXXXXXXWAPIAYVIVSESYPLRVKNRAMAIS 473
           +      +    SS G    + +              P      SE +P  V+    A +
Sbjct: 416 VGNTAIVEHSGFSSWGIVIIVFIIMFAAFYALGIGTVPWQQ---SELFPQNVRGVGTAFA 472

Query: 474 VGSNWIWGFLIGFFTPFITSAINF----YYGYVFMGCLXXXXXXXXXXXCETKGLTLEEV 529
             +NW    +I   + F+T   N      +G+ F G              E  GL LEEV
Sbjct: 473 TATNWAGSLVIA--STFLTMLQNITPTGTFGF-FAGLCVVSFFFCYFCYPELSGLELEEV 529

Query: 530 NEMYEEG 536
             + ++G
Sbjct: 530 QTILQDG 536

>KLLA0A03223g 290002..292035 some similarities with sp|P39932
           Saccharomyces cerevisiae YDR536w STL1 member of the
           sugar permease family P33.1.f24.1, hypothetical start
          Length = 677

 Score =  129 bits (324), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 118/508 (23%), Positives = 206/508 (40%), Gaps = 37/508 (7%)

Query: 37  PSNKASRDDFDLKPENEHFPEIPQKKLSEYILVMCLCLMVAFGGFVFGWDTGTISGFVNM 96
           P N    D   + P      ++    L+   L+    + V+ G F+FG+D G +SG +  
Sbjct: 84  PPNVQPLDQQRIPPSYTDHLQVKDTYLTGRTLLYFTSIFVSLGVFLFGYDQGVMSGIITG 143

Query: 97  TDFKRRFGNYSQSEGTYYLSNVRTGLIVAIFNIGCAFGGLTLGRLGDIYGRRLGLMCXXX 156
             FK  F N + +           G +V+I  IG     L +  +G+ +GRR  +     
Sbjct: 144 PYFKTYFNNPTAAT---------IGTMVSILEIGALVSSLLVSNIGEKFGRRFTIKYGSL 194

Query: 157 XXXXXXXXXXATGDKWYQYFIGRIISGLGVGGIAVLSPTLISETAPKHLRG--TCVAFYQ 214
                      + +  +  F GRIISG+GVG ++ + P   SE +P H RG   C+ F  
Sbjct: 195 IFILGGLVQTFSWEMGHMIF-GRIISGIGVGLLSTIVPIYQSEISPPHNRGKLACIEF-- 251

Query: 215 LMITLGIFLGYCT----NYGTKTYTNSVQWRVPLGMCFAWAIFMIAGMLLVPESPRFLIE 270
                G  +GY +    +Y      +   WR+PL +     + +  G  ++ E+PR+L+ 
Sbjct: 252 ----TGNIVGYASSVWVDYACSYIESDTSWRLPLFIQCVMGLLLFLGSFVIVETPRWLLN 307

Query: 271 KGRFEEARRSIAK-SNKLTVEDPGVSAEVELINAGVEAEKLAGSATWGELFSSKGKILQR 329
                E    IA   +   V       E +LI   V   +L G      L  +  +   R
Sbjct: 308 HDHDIEGLVVIADLHSDGDVLHSKAHEEYKLIKETVLISRLEGEKK--SLRFAFKRYRTR 365

Query: 330 VIMGVMIQSLQQLTGNNYFFYYGTTIFQAVGM--DDSFQTSIVLGIVNFASTFVGLWTVE 387
           +++ +  Q   QL G N   YY   +F+  G    ++   + +  I+   ST +    V+
Sbjct: 366 MLIAMSSQMFAQLNGINVISYYAPLVFEQAGWVGREALLMTGINSIIYILSTILPWKLVD 425

Query: 388 KFGRRKCLLWGSASMASCFVVFASVGVTRLWPNGQDQPSSKGAGNCMIVXXXXXXXXXXX 447
           K+GR+  LL G+  M +  +  A      LW N    P        ++V           
Sbjct: 426 KWGRKPILLSGALVMGTSLLAIA----MSLWANVAATP------RLVVVFVIIFNAFFGY 475

Query: 448 XWAPIAYVIVSESYPLRVKNRAMAISVGSNWIWGFLIGFFTPFITSAINFYYGYVFMGCL 507
            W PI ++   E  P   ++   + S  +NW++ +L+G  TP +   I++    +     
Sbjct: 476 SWGPIPWLYPVEIAPAMARSAMASASTATNWLFNWLVGIMTPILQEKIHWRMYLIHTVSC 535

Query: 508 XXXXXXXXXXXCETKGLTLEEVNEMYEE 535
                       ET GL LE+++ ++++
Sbjct: 536 YLSFWCVLKVYPETAGLRLEDMDSVFDD 563

>KLLA0D00374g 30962..32632 weakly similar to sp|Q9P8X7 Aspergillus
           parasiticus Hexose transporter protein, start by
           similarity
          Length = 556

 Score =  122 bits (307), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 140/578 (24%), Positives = 236/578 (40%), Gaps = 61/578 (10%)

Query: 21  SKDSDSA-LQLNLQTSTPSNKASRDDFDLKPENEHFPEI--PQKKLSEYILVMCLCLMVA 77
           S DS S   +  +  S  ++K + DD      ++  P++  P  K+     +    + ++
Sbjct: 2   SSDSVSENAKYEVADSCSADKINADDRHHMIMSDVLPDLGKPFYKVPYLRTLSLFVVGLS 61

Query: 78  FGGFVFGWDTGTISGFVNMTDFKRRFGNYSQSEGTYYLSNVRTGLIVAIFNIGCAFGGLT 137
                 G+D   ++G   M D+    GN + +E             + + + G  FG L 
Sbjct: 62  LSSTNLGYDGSLLNGLYAMPDYLNAMGNPNGAE-------------LGVISNGMVFGMLI 108

Query: 138 LGRLG----DIYGRRLGLMCXXXXXXXXXXXXXATG-------------DKWYQYFIGRI 180
           L +L     D YGR++G+                +G             D +  +   RI
Sbjct: 109 LFQLAPYIIDKYGRKVGMYVGNVLICIGVLIQALSGTWINGLPEDYDKKDVFGMFVASRI 168

Query: 181 ISGLGVGGIAVLSPTLISETA-PKHLRGTCVAFYQLMITLGIFLGYCTNYGTKTYTNSVQ 239
           I G GV  I++ +P LISE + P H R  C + Y     LG  +     YG +   +   
Sbjct: 169 ILGSGVLLISIATPALISEISYPPH-RELCTSIYNTCWYLGAIVSAWVTYGCRNLAHHWN 227

Query: 240 WRVPLGMCFAWAIFMIAGMLLVPESPRFLIEKGRFEEARRSIAKSNKLTVEDPG--VSAE 297
           WR+P  +   + +  +  +   PESPR+L+   R  EAR  + K +    E+    +  E
Sbjct: 228 WRIPSIIQALFPLVQLVALYKCPESPRYLVFHNRDAEARAILNKYHAGNNEEYAGLIDFE 287

Query: 298 VELINAGVEAEKLAGSATWGELFSSKGKILQRVIMGVMIQSLQQLTGNNYFFYYGTTIFQ 357
           +  I   +E EK + S  + +   + G    R+ + +      QL+GN    YY + +F 
Sbjct: 288 LAEIKLAIEQEKASQSTKFSDFIKTSGN-RHRLWILIWTAIFTQLSGNGLVSYYLSKVFN 346

Query: 358 AVGM---DDSFQTSIVLGIVNFASTFVGL-WTVEKFGRRKCLLWGSASMASCFVVFASVG 413
           ++G+   DD  + +  L + N+  + + + +    F RR+  L    SM SC+VV+ ++ 
Sbjct: 347 SIGITDPDDQLKWNGWLMLYNWLCSLILIGYIAPFFKRRQLFLISLVSMTSCYVVWTALS 406

Query: 414 VTRLWPNGQDQPSSKGAGNCMIVXXXXXXXXXXXXWAPIAYVIVSESYPLRVK-----NR 468
                 N +D+  + G     ++              P  Y      Y LR K       
Sbjct: 407 AENQKRNFEDKSLANGV--LAMIFLYYLSYNFGFNGFPNLYTTEILPYTLRGKGLTIFQL 464

Query: 469 AMAISVGSNWIWGFLIGFFTPFITSAINFYYGYVFMGC-LXXXXXXXXXXXCETKGLTLE 527
           A++ISV  N       GF  P    AI + Y Y+F  C L            ET G +LE
Sbjct: 465 AISISVIFN-------GFVNPVAMDAIEWKY-YIFYCCFLAVEIVVCYFTFVETSGRSLE 516

Query: 528 EVNEMYEEGV--LPW-KSDSWLPAGRRGTDYNTEEAHT 562
           EV+E++ +G+  LP   S   L AG+R +  + E   T
Sbjct: 517 EVDEVFGDGITQLPEVTSQIMLEAGKRLSVEHVERTDT 554

>KLLA0E25025g complement(2219051..2220721) weakly similar to
           sp|P32466 Saccharomyces cerevisiae YDR345c HXT3
           low-affinity hexose transporter P33.1.f24.1,
           hypothetical start
          Length = 556

 Score =  117 bits (294), Expect = 9e-28,   Method: Compositional matrix adjust.
 Identities = 127/513 (24%), Positives = 209/513 (40%), Gaps = 58/513 (11%)

Query: 83  FGWDTGTISGFVNMTDFKRRFGNYSQSEGTYYLSNVRTGLIVAIFNIGCAFGGLTLGRLG 142
            G+D   ++G   M D+    GN + +E             + + + G  FG L L +L 
Sbjct: 67  LGYDGSLLNGLYAMPDYLNAMGNPNGAE-------------LGVISNGMVFGMLILFQLA 113

Query: 143 ----DIYGRRLGLMCXXXXXXXXXXXXXATG-------------DKWYQYFIGRIISGLG 185
               D YGR++G+                +G             D +  +   RII G G
Sbjct: 114 PFIIDKYGRKVGMYVGNVLICIGVLIQALSGTWINGLPEDYDRKDVFGMFVASRIILGSG 173

Query: 186 VGGIAVLSPTLISETA-PKHLRGTCVAFYQLMITLGIFLGYCTNYGTKTYTNSVQWRVPL 244
           V  I++ +P LISE + P H R  C + Y     LG  +     YG +   +   WR+P 
Sbjct: 174 VLLISIATPALISEISYPPH-RELCTSIYNTCWYLGAIVSAWVTYGCRNLAHHWNWRIPS 232

Query: 245 GMCFAWAIFMIAGMLLVPESPRFLIEKGRFEEARRSIAKSNKLTVEDPG--VSAEVELIN 302
            +   + +  +  +   PESPR+L+   R  EAR  + K +    E+    +  E+  I 
Sbjct: 233 IIQALFPLVQLVALYKCPESPRYLVFHNRDAEARAILNKYHAGNNEEYAGLIDFELAEIK 292

Query: 303 AGVEAEKLAGSATWGELFSSKGKILQRVIMGVMIQSLQQLTGNNYFFYYGTTIFQAVGM- 361
             +E EK + S  + +   + G    R+ + +      QL+GN    YY + +F ++G+ 
Sbjct: 293 LAIEQEKASQSTKFSDFIKTSGN-RHRLWILIWTAIFTQLSGNGLVSYYLSKVFNSIGIT 351

Query: 362 --DDSFQTSIVLGIVNFASTFVGL-WTVEKFGRRKCLLWGSASMASCFVVFASVGVTRLW 418
             DD  + +  L + N+  + + + +    F RR+  L    SM SC+VV+ ++      
Sbjct: 352 DPDDQLKWNGWLMLYNWLCSLILIGYIAPFFKRRQLFLISLVSMTSCYVVWTALSAENQK 411

Query: 419 PNGQDQPSSKGAGNCMIVXXXXXXXXXXXXWAPIAYVIVSESYPLRVK-----NRAMAIS 473
            N +D+  + G     ++              P  Y      Y LR K       A++IS
Sbjct: 412 RNFEDKTLANGV--LAMIFLYYLSYNFGFNGFPNLYTTEILPYTLRGKGLTIFQLAISIS 469

Query: 474 VGSNWIWGFLIGFFTPFITSAINFYYGYVFMGC-LXXXXXXXXXXXCETKGLTLEEVNEM 532
           V  N       GF  P    AI + Y Y+F  C L            ET G +LEEV+E+
Sbjct: 470 VIFN-------GFVNPIAMDAIEWKY-YIFYCCFLSVEIVVCYFTFVETSGRSLEEVDEV 521

Query: 533 YEEGV--LP-WKSDSWLPAGRRGTDYNTEEAHT 562
           + + +  LP   S   L  G+R +  + E   T
Sbjct: 522 FGDRIIQLPEMTSQIMLEDGKRLSVEHVERTVT 554

>Kwal_34.16266
          Length = 158

 Score =  108 bits (271), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 60/157 (38%), Positives = 86/157 (54%), Gaps = 2/157 (1%)

Query: 379 TFVGLWTVEKFGRRKCLLWGSASMASCFVVFASVGVTRLWPNGQDQPSSKGAGNCMIVXX 438
           T+V ++  +  GR+K LLWGS S   C  +F++VGV  +  +    P  K +G  MI+  
Sbjct: 2   TYVSIFVADNLGRKKGLLWGSISCFICLFIFSTVGVVMV--DHAADPDYKLSGYVMIIFT 59

Query: 439 XXXXXXXXXXWAPIAYVIVSESYPLRVKNRAMAISVGSNWIWGFLIGFFTPFITSAINFY 498
                     W+ IA V+VSE + L +K++AMA+S   NW   F I   TP IT+ I + 
Sbjct: 60  CFFVVSFCCSWSAIASVLVSEIFTLEIKSQAMALSQAFNWGANFFIALCTPIITARIGYA 119

Query: 499 YGYVFMGCLXXXXXXXXXXXCETKGLTLEEVNEMYEE 535
           +GYVF G +            ETKGLTLEE++E YE+
Sbjct: 120 FGYVFTGFMFVAIFFVYVFIPETKGLTLEEIDEFYEK 156

>ABR223C [817] [Homologous to ScYFL040W - SH] (820632..822506) [1875
           bp, 624 aa]
          Length = 624

 Score =  114 bits (286), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 105/448 (23%), Positives = 196/448 (43%), Gaps = 56/448 (12%)

Query: 80  GFVFGWDTGTISGFVNMTDFKRRFGNYSQSEGTYYLSNVRTGLIVAIFNIGCAFGGLTLG 139
           G V G D   ++ F++   F R F         +Y +    G++     +    G L  G
Sbjct: 18  GLVLGIDISAMAVFISSDYFNRYF---------HYPNAFEQGMVSGAHPMEGLTGCLLFG 68

Query: 140 RLGDIYGRRLGLMCXXXXXXXXXXXXXATGDKWYQYFIGRIISGLGVGGIAVLSPTLISE 199
            +G+   R LG                      Y   IGR I G+ VG ++V++   + E
Sbjct: 69  YVGERVSR-LGCFRYFTFIWIIGCIVSVLVMDIYMVAIGRFIKGVAVGSLSVVASVYLVE 127

Query: 200 TAPKHLRGTCVAFYQLMITLGIFLGYCTNYGTKTYTNSVQWRVPLGMCFAWAIFMIAGML 259
             P + +G   A  QL +T GIFL Y   +    + N + +R+  G+    A+ +I+G L
Sbjct: 128 IFPSNRKGIATALVQLTLTFGIFLMYMLCWTFSRFNNHMAFRISWGLEIIPAVALISGTL 187

Query: 260 LVPESPRFLIEKGRFEEAR--------RSIAKSNKLTVEDPGVSAEVELINAGVEAEKLA 311
            VPESPR+ + +G++++A+        RS  + NK T           L+N   +  K  
Sbjct: 188 FVPESPRWFVMQGQYKKAQEILTLLNCRSKNEFNKQT-----------LLNMYGDTAK-- 234

Query: 312 GSATWGELFSSKGKILQRVIMGVMIQSLQQLTGNNYFFYYGTTIFQAVGMD--DSFQTSI 369
             A++ +L   K   ++++IMG+ IQ+L Q TG N   YY   I +  G++  +    + 
Sbjct: 235 --ASFKDLI--KLPYIKQLIMGMTIQALVQFTGINVVMYYVVYICEMAGLEGREKMNVAS 290

Query: 370 VLGIVNFASTFVGLWTVEKFGRRKCLLWGSASMASCFVVFASVGVTRLWPNGQDQPSSKG 429
           +  ++N   TF+ L  +++  R+  +++GS ++A+   +   +G+T +W +G D     G
Sbjct: 291 IPYLLNILFTFIPLHLLDRVQRKVLIVYGSFALAA---IMNLIGLT-MWIHGHDVSPING 346

Query: 430 -----------AGNCMIVXXXXXXXXXXXXWAPIAYVIVSESYPLRVKNRAMAISVGSNW 478
                       G   I              +   ++  +E    ++++R ++I +  +W
Sbjct: 347 NPALVWKLSPLGGQITISLCFAFIAIFASTLSCAGWLYTNEVLADKIRSRGLSICMSVSW 406

Query: 479 IWGFLIGFFTPFITSAIN----FYYGYV 502
           I   ++ F +P + S +     F +G V
Sbjct: 407 ICNAVLTFLSPLMMSTMKWGTFFLFGMV 434

>KLLA0B00264g 12844..14574 gi|5441459|emb|CAB46745.1 Kluyveromyces
           lactis maltose permease, start by similarity
          Length = 576

 Score =  109 bits (273), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 114/495 (23%), Positives = 205/495 (41%), Gaps = 28/495 (5%)

Query: 63  LSEYILVMCLCLMVAFGGFVFGWDTGTISGFVNMTDFKRRFGNYSQSEGTYYLSN---VR 119
           L +Y   +   L+V+ G  + G+DT  I+    +  F+  FG Y+Q+   + + +   + 
Sbjct: 62  LRKYPKAVGWSLVVSTGLIMEGYDTAFINNLFALPIFRTTFGEYNQANDIWEIPSKWQIG 121

Query: 120 TGLIVAIFNIGCAFGGLTLGRLGDIYGRRLGLMCXXXXXXXXXXXXXATGDKWYQYFIGR 179
            G+ VA    G   G    G   D YG RL L+                 +      IG+
Sbjct: 122 LGMCVAC---GEIIGLQITGIFADRYGYRLVLIAGLVLLIAFNFILYF-ANSLTMIAIGQ 177

Query: 180 IISGLGVGGIAVLSPTLISETAPKHLRGTCVAFYQLMITLG--IFLGYCTNYGTKTYTNS 237
           I+SG+  G    L  +  SE  P  LR     +  L   +G  I  G           + 
Sbjct: 178 ILSGIPWGSFQTLCVSYASEVCPLVLRYYLTTYINLCWLIGQVIAAGVLKACQEHLANDE 237

Query: 238 VQWRVPLGMCFAWAIFMIAGMLLVPESPRFLIEKGRFEEARRSIAKSNKLTVEDPGVSAE 297
           + WR+P  + + W + +I G+ L PESP +L+ KGR ++A+RS+ +   L   +     +
Sbjct: 238 LGWRLPFALQWIWPVPLIVGIYLAPESPWWLVRKGRIDQAKRSVTRILTLPTSEKDKLTD 297

Query: 298 VEL--INAGVEAEKLAGSATWGELFSSKGKILQRVIMGVMIQSLQQLTGNNYFFYYGTTI 355
           + +  +   VE E    S +   +   KG   +R  +  +   +Q LTG+     Y T  
Sbjct: 298 IMITKMRMTVEKENRLASESSSYMDCFKGIDARRTRITCLTWVMQNLTGSA-LMGYSTYF 356

Query: 356 FQAVGMDDS--FQTSIVLGIVNFASTFVGLWTVEKFGRRKCLLWGSASMASCFVVFASVG 413
           ++  G+D S  F  SI+  ++    T    +   + GR   L WG         +   +G
Sbjct: 357 YEKAGLDTSAAFTFSIIQYVIGIVGTLTSWFLSSRAGRFTILFWGVFFQTIVMFITGGLG 416

Query: 414 VTRLWPNGQDQPSSKGAGNCMIVXXXXXXXXXXXXWAPIAYVIVSESYPLRVKNRAMAIS 473
            +        + +S GAG+ +++              P+ Y +VSE    R++ + + ++
Sbjct: 417 FS------SSEGASWGAGSMLLIYNFFYNSTL----GPVVYCVVSEIPSDRLRTKTVVLA 466

Query: 474 VGSNWIWGFLIGFFTPFITSAINFYYGY---VFMGCLXXXXXXXXXXXC-ETKGLTLEEV 529
             S  +   +    TP++ ++  + +G    +F G L             ETKG T  E+
Sbjct: 467 RNSYNLIAIVNSILTPYMLNSDQWNWGAKTGLFWGGLAAISLVWAYFDLPETKGRTFAEL 526

Query: 530 NEMYEEGVLPWKSDS 544
           +E++ + V   K +S
Sbjct: 527 DELFHQRVPARKFNS 541

>KLLA0D00253g <12780..14534 gi|5441459|emb|CAB46745.1 Kluyveromyces
           lactis maltose permease, hypothetical start
          Length = 584

 Score =  109 bits (273), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 114/495 (23%), Positives = 205/495 (41%), Gaps = 28/495 (5%)

Query: 63  LSEYILVMCLCLMVAFGGFVFGWDTGTISGFVNMTDFKRRFGNYSQSEGTYYLSN---VR 119
           L +Y   +   L+V+ G  + G+DT  I+    +  F+  FG Y+Q+   + + +   + 
Sbjct: 70  LRKYPKAVGWSLVVSTGLIMEGYDTAFINNLFALPIFRTTFGEYNQANDIWEIPSKWQIG 129

Query: 120 TGLIVAIFNIGCAFGGLTLGRLGDIYGRRLGLMCXXXXXXXXXXXXXATGDKWYQYFIGR 179
            G+ VA    G   G    G   D YG RL L+                 +      IG+
Sbjct: 130 LGMCVAC---GEIIGLQITGIFADRYGYRLVLIAGLVLLIAFNFILYF-ANSLTMIAIGQ 185

Query: 180 IISGLGVGGIAVLSPTLISETAPKHLRGTCVAFYQLMITLG--IFLGYCTNYGTKTYTNS 237
           I+SG+  G    L  +  SE  P  LR     +  L   +G  I  G           + 
Sbjct: 186 ILSGIPWGSFQTLCVSYASEVCPLVLRYYLTTYINLCWLIGQVIAAGVLKACQEHLANDE 245

Query: 238 VQWRVPLGMCFAWAIFMIAGMLLVPESPRFLIEKGRFEEARRSIAKSNKLTVEDPGVSAE 297
           + WR+P  + + W + +I G+ L PESP +L+ KGR ++A+RS+ +   L   +     +
Sbjct: 246 LGWRLPFALQWIWPVPLIVGIYLAPESPWWLVRKGRIDQAKRSVTRILTLPTSEKDKLTD 305

Query: 298 VEL--INAGVEAEKLAGSATWGELFSSKGKILQRVIMGVMIQSLQQLTGNNYFFYYGTTI 355
           + +  +   VE E    S +   +   KG   +R  +  +   +Q LTG+     Y T  
Sbjct: 306 IMITKMRMTVEKENRLASESSSYMDCFKGIDARRTRITCLTWVMQNLTGSA-LMGYSTYF 364

Query: 356 FQAVGMDDS--FQTSIVLGIVNFASTFVGLWTVEKFGRRKCLLWGSASMASCFVVFASVG 413
           ++  G+D S  F  SI+  ++    T    +   + GR   L WG         +   +G
Sbjct: 365 YEKAGLDTSAAFTFSIIQYVIGIVGTLTSWFLSSRAGRFTILFWGVFFQTIVMFITGGLG 424

Query: 414 VTRLWPNGQDQPSSKGAGNCMIVXXXXXXXXXXXXWAPIAYVIVSESYPLRVKNRAMAIS 473
            +        + +S GAG+ +++              P+ Y +VSE    R++ + + ++
Sbjct: 425 FS------SSEGASWGAGSMLLIYNFFYNSTL----GPVVYCVVSEIPSDRLRTKTVVLA 474

Query: 474 VGSNWIWGFLIGFFTPFITSAINFYYGY---VFMGCLXXXXXXXXXXXC-ETKGLTLEEV 529
             S  +   +    TP++ ++  + +G    +F G L             ETKG T  E+
Sbjct: 475 RNSYNLIAIVNSILTPYMLNSDQWNWGAKTGLFWGGLAAISLVWAYFDLPETKGRTFAEL 534

Query: 530 NEMYEEGVLPWKSDS 544
           +E++ + V   K +S
Sbjct: 535 DELFHQRVPARKFNS 549

>CAGL0M01672g 186088..187731 similar to tr|Q04162 Saccharomyces
           cerevisiae YDR387c, hypothetical start
          Length = 547

 Score =  108 bits (271), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 94/366 (25%), Positives = 152/366 (41%), Gaps = 64/366 (17%)

Query: 79  GGFVFGWDTGTISGFVNMTDFKRRFGNYSQSEGTYYLSNVRTGLIVAIFNIGCAFGGLTL 138
           GG +FG+DTG ISG +             Q  G   +S+    LI +I  +GC  G L  
Sbjct: 60  GGLLFGYDTGVISGVL--------LSLKPQDLGRATISDWDKELITSITCLGCFVGSLLG 111

Query: 139 GRLGDIYGRR--LGLMCXXXXXXXXXXXXXATGDKWYQYFIGRIISGLGVGGIAVLSPTL 196
             L D YGRR  L + C             A          GR + G+ VG  A  +P  
Sbjct: 112 SPLADKYGRRITLAIFCVLFIVAALWM---ALASNLVLLVFGRFVVGIAVGTAAQCTPVY 168

Query: 197 ISETAPKHLRGTCVAFYQLMITLGIFLGYCTNYGTKTYTNSVQWRVPLGMCFAWAIFMIA 256
           + E +P  +RG  +A   + +T G FL Y   Y  + Y  +  WR+  G+    AI  ++
Sbjct: 169 LCEISPAKIRGQILALNSIAVTGGQFLSYIFAY--ELYDVNGSWRILFGLSAVPAIIFLS 226

Query: 257 GMLLVPESPRFLIEKGRFEEARRSI-------------AKSNKLTV--------EDPGVS 295
            +  +PESPR+L+   +++ A+ ++              K N+L +        +D   S
Sbjct: 227 MLDFIPESPRWLVSMSKYDSAKAALRMIYPTASPGQINLKFNELVINLSKLKHYQDEQTS 286

Query: 296 AEVELINAGVEAEKLA-GSATWGELFS----------------SKGKILQR--------V 330
             V L    V + ++   SA +G + +                S   +  R        +
Sbjct: 287 LMVPL---SVRSSRVTINSADYGSVANLRSLHSLMNEPSGTNHSNKTVHHRMEPRTKRAL 343

Query: 331 IMGVMIQSLQQLTGNNYFFYYGTTIFQAVGMDDSFQTSIVLGIVNFASTFVGLWTVEKFG 390
           ++G ++   QQ+TG N F YY   IF  +   +    ++ +   NF  TF+ ++ V+  G
Sbjct: 344 LIGCVLMFFQQITGFNAFMYYAPLIFSKLNSHNPLLPAMSIAFTNFLFTFLAVYLVDLVG 403

Query: 391 RRKCLL 396
           RR  LL
Sbjct: 404 RRSMLL 409

>Kwal_55.21289
          Length = 537

 Score =  105 bits (263), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 123/522 (23%), Positives = 205/522 (39%), Gaps = 67/522 (12%)

Query: 57  EIPQKKLSEYILVMCLCLMVAFGGFVFGWDTGTISGFVNMTDFKRRFGNYSQSEGTYYLS 116
           +I  +  S     + + L  + GG +FG+DTG I+G +         G      G   L 
Sbjct: 32  DIDHRHYSLTWKTLNIYLGASIGGLLFGYDTGVIAGVL--------LGLKPGDLGLDILQ 83

Query: 117 NVRTGLIVAIFNIGCAFGGLTLGRLGDIYGRRLGL-MCXXXXXXXXXXXXXATGDKWYQY 175
           + +  +I  +  IG   G +   +L +  GRRL L +C             A    +   
Sbjct: 84  DHQKEVITGVTGIGSVMGSMVAFKLANCLGRRLTLGLCSVVFTLAAALMALAL--SFRAL 141

Query: 176 FIGRIISGLGVGGIAVLSPTLISETAPKHLRGTCVAFYQLMITLGIFLGYCTNYGTKTYT 235
             GR+I G+ +G  A   P  +SE +P   RGT +AF    IT G  L     +      
Sbjct: 142 VAGRLIVGVAIGIAAQCVPLYLSEISPSSRRGTILAFNTSAITGGQLLASLIAWAIIDKP 201

Query: 236 NSVQWRVPLGMCFAWAIFMIAGMLLVPESPRFLIEKGRFEEARRSI----AKSNKLTVED 291
           NS  WR   G     ++ ++  +  +PESPR+L+   + + AR +I     ++++L + D
Sbjct: 202 NS--WRYLFGASAIPSLLLLFTLKFIPESPRWLLLTEQPQRAREAIETMYPEASELEIND 259

Query: 292 --------------------PGVSAEVEL---INAGVEAEKLAGSATWGELFSS------ 322
                               P +S   E     N+G  ++ +A +  +     S      
Sbjct: 260 KLTKMGRDLTKLRKYQDENQPLLSRRPEASRRYNSGSSSDNIALARDFTHSIRSNNRRGL 319

Query: 323 --KGKILQR----VIMGVMIQSLQQLTGNNYFFYYGTTIFQAVGMDDSFQTSIVLGIVNF 376
             K K+  R    +++G ++   QQ TG N F YY   I   +G+ D    +I +  VNF
Sbjct: 320 KIKHKLEPRTRRALLVGCLLMFFQQATGFNAFIYYSPVILLRIGVSDPLLPAIGIAFVNF 379

Query: 377 ASTFVGLWTVEKFGRRKCLLWGSASMASCFVVFASVGVTRLWPNGQDQPSSKGAGNCMIV 436
           A T V +  V+ +GRR  LL+    M    +V  S G+       Q   SS   G+ ++ 
Sbjct: 380 AFTGVAMKVVDHYGRRTALLYTVWIMTVGLIV-GSAGL-------QYNNSSLFLGSLLVF 431

Query: 437 XXXXXXXXXXXXWAPIAYVIVSESYPLRVKNRAMAISVGSNWIWGFLIGF-FTPFITSAI 495
                       W  + ++      PL  ++   +    +NW   F +   F   I    
Sbjct: 432 IAGYAAGIGSVPWMSVEFL------PLNQRSFGASCIACTNWFTNFAVSISFLSMIRIIG 485

Query: 496 NFYYGYVFMGCLXXXXXXXXXXXCETKGLTLEEVNEMYEEGV 537
                 +F                E KGL+LEE+ +++E G+
Sbjct: 486 GEASMLIFAAMSALGWLFVYFWYPEVKGLSLEEIGQVFETGI 527

>KLLA0E14696g 1309427..1310860 weakly similar to sp|Q9P8X7
           Aspergillus parasiticus Hexose transporter protein,
           hypothetical start
          Length = 477

 Score =  104 bits (260), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 95/394 (24%), Positives = 170/394 (43%), Gaps = 16/394 (4%)

Query: 179 RIISGLGVGGIAVLSPTLISETAPKHLRGTCVAFYQLMITLGIFLGYCTNYGTKTYTNSV 238
           RI+ G GV  I++ +P LISE +    R  C + Y     LG  +     YG +   +  
Sbjct: 88  RIVLGTGVLLISISTPALISEISYPPHRELCTSIYNTCWYLGAVVSAWVTYGCRNLAHHW 147

Query: 239 QWRVPLGMCFAWAIFMIAGMLLVPESPRFLIEKGRFEEARRSIAKSNKLTVEDPG--VSA 296
            WR+P  +   + I  +  +   PESPR+L+   R  EAR  + K +    E+    +  
Sbjct: 148 NWRIPSIIQAFFPIVQLIVLYNCPESPRYLVFHNRDSEARAILNKYHAGDNEEYAGLIDF 207

Query: 297 EVELINAGVEAEKLAGSATWGELFSSKGKILQRVIMGVMIQSLQQLTGNNYFFYYGTTIF 356
           E+  I   +E EK + +  + + F + G    R+ + +      QL+GN    YY + +F
Sbjct: 208 ELAEIKLAIEQEKASQATNFSDFFKTSGN-RHRLWILIWTAIFTQLSGNGLVSYYLSKVF 266

Query: 357 QAVGM---DDSFQTSIVLGIVNFASTFVGL-WTVEKFGRRKCLLWGSASMASCFVVFASV 412
            ++G+   D+  + +  L + N+  + + + +    F RR+  L    SMA C++V+ ++
Sbjct: 267 NSIGITDPDEQLEWNGWLMLYNWLCSLILMSYIAPFFKRRQLFLISLTSMACCYIVWTAL 326

Query: 413 GVTRLWPNGQDQPSSKGAGNCMIVXXXXXXXXXXXXWAPIAYVIVSESYPLRVKNRAMAI 472
                  N +D    K   N ++             +    ++  +E  P  ++ + + I
Sbjct: 327 SAENQKRNFED----KSLANGVLAMIFLYYLSYNFGFNGYPFLYTTEILPYTLRGKGLTI 382

Query: 473 SVGSNWIWGFLIGFFTPFITSAINFYYGYVFMGC-LXXXXXXXXXXXCETKGLTLEEVNE 531
              +  +     GF       AI + Y Y+F  C L            ET G +LEEV+E
Sbjct: 383 FQLAISLAVIFNGFVNSIAMDAIEWKY-YIFYCCFLAVEIVVCYFTFVETSGRSLEEVDE 441

Query: 532 MYEEGV--LP-WKSDSWLPAGRRGTDYNTEEAHT 562
           ++ +G+  LP   S   L  G+R +  + E   T
Sbjct: 442 VFGDGITQLPEVTSQVMLEDGKRLSVEHLERTET 475

>Sklu_2144.6 YFL040W, Contig c2144 7747-9330 reverse complement
          Length = 527

 Score =  104 bits (259), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 93/379 (24%), Positives = 168/379 (44%), Gaps = 32/379 (8%)

Query: 173 YQYFIGRIISGLGVGGIAVLSPTLISETAPKHLRGTCVAFYQLMITLGIFLGYCTNYGTK 232
           +   + R+I G+ VG  + L P  I E  PK  +GT  +  QL +T  I L +   +   
Sbjct: 104 WMVILSRLIKGVSVGIFSALLPVYIGEVIPKKRKGTATSTIQLALTAAILLMFYVCFFMN 163

Query: 233 TYTNSVQWRVPLGMCFAWAIFMIAGMLLVPESPRFLIEKGRFEEARRSIAKSNKLTVEDP 292
              N + +R+  G+    A+ +     L+PESPR+L+  G++ +A+  + +  K T    
Sbjct: 164 FIGNHLSFRISWGLEMIPALLLFFLAFLLPESPRWLVTHGKYTDAQELLERL-KSTKFGK 222

Query: 293 GVSAEVELINAGVEAEKLAGSATWGELFSSKGKILQRVIMGVMIQSLQQLTGNNYFFYYG 352
           GVS    L   G  +++     T+ +LF  K  + +  I+G+ IQ+L Q  G     YY 
Sbjct: 223 GVSKIDILDKYGSSSQR----CTYLDLF--KKTLWRHTIIGMTIQALVQCCGIGVLMYYV 276

Query: 353 TTIFQAVGMDDSFQ--TSIVLGIVNFASTFVGLWTVEKFGRRKCLLWGSASMASCFVVFA 410
             I + +G++   +  ++ +  I+N   T   +  ++KF R+  +++GS  +A   V+  
Sbjct: 277 VYICEMIGLEGDIRLFSASIQYIINVLFTIFPIIWLDKFRRKDVIVYGSYLLA---VIMF 333

Query: 411 SVGVTRLW-------PNG--------QDQPSSKGAGNCMIVXXXXXXXXXXXXWAPIAYV 455
           S+G T  W        NG        + +P S   G C +             W     +
Sbjct: 334 SIGFTMNWYGHEVPPINGNKAMVWEVKGRPGSVILGLCFLFVAIFAATLSCGAW-----L 388

Query: 456 IVSESYPLRVKNRAMAISVGSNWIWGFLIGFFTPFITSAINFYYGYVFMGCLXXXXXXXX 515
             +E  P + K + M+I +  +W+  F++ F  P++ + I +    +  G          
Sbjct: 389 YTNEILPAKTKAKGMSICMAMSWVMNFILTFLAPWLLNRIKWVTFIILGGMTLVITTIVA 448

Query: 516 XXXCETKGLTLEEVNEMYE 534
               ET GLT  E+ ++YE
Sbjct: 449 FSFPETYGLTDLEIEKLYE 467

>YBR241C (YBR241C) [420] chr2 complement(702546..704012) Member of
           the hexose transporter family of the major facilitator
           superfamily (MFS) [1467 bp, 488 aa]
          Length = 488

 Score =  102 bits (254), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 99/384 (25%), Positives = 156/384 (40%), Gaps = 31/384 (8%)

Query: 115 LSNVRTGLIVAIFNIGCAFGGLTLGRLGDIYGRRLGLMCXXXXXXXXXXXXXATGDKWYQ 174
           L++ + G I +IF+IG  FG    G   + YGR+   M               + + + Q
Sbjct: 82  LTDSQYGAITSIFSIGGLFGSYYAGNWANRYGRKYVSMGASAMCMVSSLLLFFS-NSYLQ 140

Query: 175 YFIGRIISGLGVGGIAVLSPTLISETAPKHLRGTCVAFYQLMITLGIFLGYCTNYGTKTY 234
              GR + G+  G   V++P  I+E AP   RG   +  Q+ I LGI L   T      Y
Sbjct: 141 LLFGRFLVGMSCGTAIVITPLFINEIAPVEWRGAMGSMNQVSINLGILL---TQTLALKY 197

Query: 235 TNSVQWRVPLGMCFAWAIFMIAGMLLVPESPRFLIEKGRFEEARRSIAKSNKLTVEDPGV 294
            +S  WR  L      A+  I   L V ESPR+L+  G   EA  ++ K    T +    
Sbjct: 198 ADSYNWRWLLFSGSVIAVANILAWLKVDESPRWLVSHGFVSEAETALFKLRPGTYQQAKQ 257

Query: 295 SAEVELINAG------VEAEKLAGSATWGELFSSKGKILQRVIMGVMIQSLQQLTGNNYF 348
             +    + G         E  +G   W  +     K  + VI+ ++  S QQ  G N  
Sbjct: 258 EIQDWQRSHGHNRDPESSEETHSGPTLWQYVTDPSYKKPRTVILAIL--SCQQFCGINSI 315

Query: 349 FYYGTTIFQAVGMDDSFQTSIVLGIVNFASTFVGLWTVEKFGRRKCLLWGSASMASCFVV 408
            +YG  +   +  D S Q +  + I+N   T      ++  GRR  LL  S ++ +   +
Sbjct: 316 IFYGVKVIGKILPDYSIQVNFAISILNVVVTLAASAIIDHVGRRPLLL-ASTTVMTAMSL 374

Query: 409 FASVGVTRLWPNGQDQPSSKGAGNCMIVXXXXXXXXXXXXWAPIAYVIVSE-SYPLRVKN 467
             SVG+T                  ++               PI ++I+ E SYP   ++
Sbjct: 375 LISVGLTL------------SVSFLLVTATFVYIAAFAIGLGPIPFLIIGELSYP---QD 419

Query: 468 RAMAISVGS--NWIWGFLIGFFTP 489
            A A S G+  NW+  F++G+  P
Sbjct: 420 AATAQSFGTVCNWLATFIVGYLFP 443

>Kwal_14.1105
          Length = 522

 Score =  102 bits (254), Expect = 9e-23,   Method: Compositional matrix adjust.
 Identities = 111/479 (23%), Positives = 204/479 (42%), Gaps = 38/479 (7%)

Query: 75  MVAFGGFVFGWDTGTISGFVNMTDFKRRFGNY-SQSEGTYYLSNVRTGLIVAIFNIGCAF 133
           ++A  G + G D  +IS F+    FK  F N    ++G    +N   GL+      GC  
Sbjct: 14  ILAVAGTILGMDISSISIFLTSDFFKSYFNNPGPAAQGIMTGANPVGGLV------GCVL 67

Query: 134 GGLTLGRLGDIYGRRLGLMCXXXXXXXXXXXXXATGDKWYQYFIGRIISGLGVGGIAVLS 193
            G+   R G +   R+                 A     +   +GR++ G+ VG  +VL 
Sbjct: 68  FGVLTERTGRVSTFRI-----LSLIWILGSIFSALVLNVWMITVGRLVRGMAVGSFSVLL 122

Query: 194 PTLISETAPKHLRGTCVAFYQLMITLGIFLGYCTNYGTKTYTNSVQWRVPLGMCFAWAIF 253
           P  I E  P H +GT  A  QL IT  I + +   +      +   +R+  G+    A+ 
Sbjct: 123 PVYIGEVIPAHKKGTATAVVQLSITSAILVTFFVCFLLSFLGDQASFRIAWGLEMIPALL 182

Query: 254 MIAGMLLVPESPRFLIEKGRFEEARRSIAKSNKLTVEDPGVSAEVELIN---AGVEAEKL 310
           ++     + ESP++L+  G +++AR  +        + PG+  E    N   + ++  +L
Sbjct: 183 VLLLSFSLIESPKWLVSHGEYDKAREILQH-----FKPPGMPGEKVTNNVRVSKIDILEL 237

Query: 311 AGSAT---WGELFSSKGKILQRVIMGVMIQSLQQLTGNNYFFYYGTTIFQAVGM--DDSF 365
            G+A    + +LFS    + +  I G+ IQ L Q  G N   +Y   I + +G+   +  
Sbjct: 238 YGTAQKTRYSDLFSR--SLWKHTIAGITIQVLVQTCGINTLMFYIVYICEMIGLRGKNKL 295

Query: 366 QTSIVLGIVNFASTFVGLWTVEKFGRRKCLLWGSASMASCFVVFASV----GVTRLWPNG 421
             +++  ++N   TFV + T++   R+  ++ G  ++A+  ++        G      NG
Sbjct: 296 VAALIPCLINVVFTFVPILTLDHLRRKVVIVSGGFTLAAIMILIGGTMGVFGHAVATVNG 355

Query: 422 QDQPSSK---GAGNCMIVXXXXXXXXXXXXWAPIAYVIVSESYPLRVKNRAMAISVGSNW 478
               + K    +G  ++              +  A++  SE +PLR K + MA  +  +W
Sbjct: 356 NSTVTWKVEGASGFLVMALCFLFVAIFASTLSCCAWLYTSEIFPLRAKPKGMAFCMAISW 415

Query: 479 IWGFLIGFFTPFITSAINFYYGYVFMGCLXXXXXXXXXXXC--ETKGLTLEEVNEMYEE 535
                + F TP + S I +   +V +GC+           C  ET GLT ++V  ++++
Sbjct: 416 FLNATLTFTTPLLLSKIRWVL-FVLLGCI-TCALTVLIGVCFPETLGLTEQQVCNLFKD 472

>KLLA0E08987g 804915..806615 gi|22293246|emb|CAC79614.1
           Kluyveromyces lactis hexose transporter, start by
           similarity
          Length = 566

 Score =  101 bits (251), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 118/485 (24%), Positives = 209/485 (43%), Gaps = 52/485 (10%)

Query: 68  LVMCLCLMVAFGGFVFGWDTGTISGFVNMTDFKRRFGNYSQSEGTYYLSNVRTGLIVAIF 127
           +V+ L    +F G + G D  TISG            +Y   + +  L++    LI ++ 
Sbjct: 91  MVIMLGFFASFAGILSGVDQSTISG-----------ASYGM-KASLKLTSDEDSLISSLM 138

Query: 128 NIGCAFGGLTLGRLGDIYGRRLGLMCXXXXXXXXXXXXXATGDKWYQYFIGRIISGLGVG 187
            +G   G + L  L + +GR++ L+              A  D    Y  GR + G+GVG
Sbjct: 139 PLGAVGGSILLTPLSEYFGRKVALVISCIFYTIGGILCAAAQDVHTMY-AGRFLIGVGVG 197

Query: 188 GIAVLSPTLISETAPKHLRGTCVAFYQLMITLGIFLGYCTNYGTKTYTNSVQWRVPLGMC 247
                    I+E+ P  +RG+ V+ YQ  I LG  +GY    G   +     WR  LG  
Sbjct: 198 IEGGGVGVYIAESVPSTVRGSLVSLYQFNIALGELVGYVI--GVIFFDVKGGWRYMLGSS 255

Query: 248 FAWAIFMIAGMLLVPESPRFLIEKGRFEEARRSIAKSNKLTVEDPGVSAE-VELINAGVE 306
             ++  +  G+  +PESPR+LI KG   EA +   +    +  D G   E +E+ +A  +
Sbjct: 256 LVFSTILFVGLFFLPESPRWLIHKGYDVEAYKVWRRLRDTS--DLGNKREFLEMKHAAEQ 313

Query: 307 AEKLAGSATWGELFSSKGKIL------QRVIMGVMIQSLQQLTGNNYFFYYGTTIFQAVG 360
             +L    +    F S   ++      + ++  +M+ SL QLTG N   YY +T+   +G
Sbjct: 314 DRQLKEQESR---FKSMFDLILIPRNRRALLYSIMMVSLGQLTGINAIMYYMSTLMGQIG 370

Query: 361 MDDSFQTSIVLGIVNFASTFVG----LWTVEKFGRRKCLLWGSASMASCFVVFASVGVTR 416
              S + ++ + +V  A+  +G    +  ++KFGRR    W      S  ++  SVG+  
Sbjct: 371 F--SPKQAVAMSMVGGAALLIGTIPAILYMDKFGRRP---W------SMTIIGFSVGLVL 419

Query: 417 LWPNGQ-DQPSSKGAGNCMIVXXXXXXXXXXXXWAPIAYVIVSESYPLRVKNRAMAISVG 475
           +    Q D  ++  A   + +            +A + +V+ SES+ L  ++  M I   
Sbjct: 420 VGVGYQIDLNTNLAAAEGVYLTGQILYNIFFGTYATLTWVVPSESFSLATRSIGMTICSA 479

Query: 476 SNWIWGFLIGFFTPFITSAINF------YYGYVFMGCLXXXXXXXXXXXCETKGLTLEEV 529
             ++W F + +    +  A  +      +YG +    +            ETK  TLEE+
Sbjct: 480 FLYLWAFTVTYNFNKMKDAFTYTGLTLGFYGGI---AIVIGIPYQLLFMPETKDKTLEEI 536

Query: 530 NEMYE 534
           ++++E
Sbjct: 537 DDIFE 541

>AFL034W [3159] [Homologous to ScYBR241C - SH; ScYGL104C - SH]
           complement(371827..373251) [1425 bp, 474 aa]
          Length = 474

 Score = 99.4 bits (246), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 98/395 (24%), Positives = 163/395 (41%), Gaps = 24/395 (6%)

Query: 110 EGTYYLSNVRTGLIVAIFNIGCAFGGLTLGRLGDIYGRRLGLMCXXXXXXXXXXXXXATG 169
           E   +L + + GL+ +IF++G   G L  G   D YGRR   +                 
Sbjct: 71  EQCLHLDDSQYGLVTSIFSVGGLLGSLCTGSQADRYGRRAAAI-GSSVLAAAGSAAMVFA 129

Query: 170 DKWYQYFIGRIISGLGVGGIAVLSPTLISETAPKHLRGTCVAFYQLMITLGIFLGYCTNY 229
           + + Q  +GR+++G+G GG  V++  +++E AP  L+G   A  Q  I LGI +   T  
Sbjct: 130 NSYAQLLLGRLVAGVGCGGGIVVTSLMLNEMAPAELKGALGALNQTCINLGILV---TQL 186

Query: 230 GTKTYTNSVQWRVPLGMCFAWAIFMIAGMLLVPESPRFLIEKGRFEEARRSIAKSNKLTV 289
               + NSVQWR+   +  A A+     +L V ESPR+L   G  + A R++     L  
Sbjct: 187 LAFAWANSVQWRLLFAVSAAVAVAHCGLLLGVEESPRWLAANGHEQRAERAL---RWLRA 243

Query: 290 EDPGVSAEVELINAGVEAEKLAGSATWGELFSSKGKILQRVIMGVMIQSLQQLTGNNYFF 349
           +D   + E+       E E  A  ++     +       R ++ V++   QQ  G N   
Sbjct: 244 DDAAAAHELREWRRAREHEAAAQCSSLRRYIADARYAHVRCVVAVLLMG-QQFCGINSIV 302

Query: 350 YYGTTIFQAVGMDDSFQTSIVLGIVNFASTFVGLWTVEKFGRRKCLLWGSASMASCFVVF 409
           +YG  +        S   +  +  VN   T      V++ GRR  L   +A+MA    + 
Sbjct: 303 FYGVKLINGALPGLSIAVNFGISAVNLVVTLTAAALVDRVGRRPLLQCSAAAMAVASTLM 362

Query: 410 ASVGVTRLWPNGQDQPSSKGAGNCMIVXXXXXXXXXXXXWAPIAYVIVSESYPLRVKNRA 469
           A+  +               +   ++V            + PI ++I++E         A
Sbjct: 363 AAGILLE-------------SAAVLVVCTFAYITFFALGFGPIPFLIIAELSSPGTAAVA 409

Query: 470 MAISVGSNWIWGFLIGFFTPFITSAINFYYGYVFM 504
            +  +  NW+  F +GF  P +   I    GYVFM
Sbjct: 410 QSYGLALNWVATFFVGFGFPVLNQLIG---GYVFM 441

>KLLA0F06853g 656373..657959 gi|24943210|gb|AAN65374.1 Kluyveromyces
           lactis YGL104C, start by similarity
          Length = 528

 Score = 99.0 bits (245), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 107/438 (24%), Positives = 179/438 (40%), Gaps = 87/438 (19%)

Query: 115 LSNVRTGLIVAIFNIGCAFGGLTLGRLGDIYGRR-----------LGLMCXXXXXXXXXX 163
           L++ + GLI ++F++G   G L  G L D YGR+           LG +C          
Sbjct: 89  LTDSQFGLITSVFSVGGLIGSLVAGPLADSYGRKPISYWNCSVGILGAVCLF-------- 140

Query: 164 XXXATGDKWYQYFIGRIISGLGVGGIAVLSPTLISETAPKHLRGTCVAFYQLMITLGIFL 223
               + + +     GR+++G+  G + V++P  I+E +P HL+G+  +  Q+ I  GI +
Sbjct: 141 ----SSNNYLGMLFGRLLAGISCGSLIVVTPLFINEMSPVHLKGSLGSMNQVSINCGILV 196

Query: 224 GYCTNYGTKTYTNSVQWRVPLGMCFAWAIFMIAGMLLVPESPRFLIEKGRF--------- 274
              T      + N +QWR  L      ++     +  + ESPR+L+ KG           
Sbjct: 197 ---TQSLAMLWANMLQWRWILLFGGLISLLNFGLLFRINESPRWLVSKGNMTDAEDVLSQ 253

Query: 275 ------EEARRSI-----AKSNKLTVEDPGVSAEVELINAGVEAEKLAGSATWGELFSS- 322
                 +E+R+ I           T  D       ++ N G        S+T   L  S 
Sbjct: 254 LRGNSRQESRQEIDGWLQGSQPVRTFSDLEAHTNSQM-NLGSNLNLERPSSTRSSLRDSE 312

Query: 323 -----------KGKILQRVIMGVMIQSLQQLTGNNYFFYYGTTIFQAVGMDDSFQTSIVL 371
                      K K  +RVI  +++   QQ  G N   +YG  + +    D +   +  +
Sbjct: 313 SITVVEYWKDPKYKYPRRVITTILMA--QQFCGINSIVFYGVKVIKKAFPDTAIIINFAI 370

Query: 372 GIVNFASTFVGLWTVEKFGRRKCLLWGSASMASC--FVVFASVGVTRLWPNGQDQPSSKG 429
            IVN   TF     V+ +GR+  L+  S  M+ C   + F  VG                
Sbjct: 371 SIVNVLMTFFSSPLVDHWGRKPLLISSSTLMSICSFMICFGIVG---------------N 415

Query: 430 AGNCMIVXXXXXXXXXXXXWAPIAYVIVSE-SYPLRVKNRAMAISVGS--NWIWGFLIGF 486
           A   +++              PI ++I+SE S+P  V    +A S G+  NWI  F++G+
Sbjct: 416 APMILVIFVILYITAFAGGLGPIPFLIISELSHPETV---GVAQSYGTTMNWIATFMVGY 472

Query: 487 FTPFITSAINFYYGYVFM 504
             P + S ++   GYVF+
Sbjct: 473 GFPALNSVMD---GYVFL 487

>Kwal_27.12811
          Length = 181

 Score = 92.4 bits (228), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 62/177 (35%), Positives = 88/177 (49%), Gaps = 15/177 (8%)

Query: 74  LMVAFGGFVFGWDTGTISGFVNMTDFKRRF---GNYSQSEGTYYLSNVRTGLIVAIFNIG 130
           L VAFG  +FG++TGTISG + M   K++F   G+++  E         T LI  I + G
Sbjct: 16  LFVAFGDILFGYNTGTISGMLAMDYVKQQFTSRGHFTADE---------TSLITEILSAG 66

Query: 131 CAFGGLTLGRLGDIYGRRLGLMCXXXXXX-XXXXXXXATGDKWYQYFIGRIISGLGVGGI 189
              G +      D  G RLGL+               ATG        GR+I+G GVG +
Sbjct: 67  TFCGAILAPLASDTIGHRLGLILSTIIFTFGVILQVAATGQDLL--IAGRVIAGAGVGVL 124

Query: 190 AVLSPTLISETAPKHLRGTCVAFYQLMITLGIFLGYCTNYGTKTYTNSVQWRVPLGM 246
           + + P   SE +PK +RG  V+ YQ  IT+G+ L  C N GT    +S  +R+PL +
Sbjct: 125 SAIVPLYQSEASPKWIRGAVVSCYQWAITIGLLLAACVNQGTHARQDSGSYRIPLAL 181

>KLLA0B14861g complement(1305927..1307690)
           gi|125935|sp|P07921|LACP_KLULA Kluyveromyces lactis
           Lactose permease, start by similarity
          Length = 587

 Score = 98.6 bits (244), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 122/498 (24%), Positives = 207/498 (41%), Gaps = 49/498 (9%)

Query: 58  IPQKKLSEYILVMCLCLMVAFGGFVFGWDTGTISGFVNMTDFKRRFGNYSQSEGTYYL-- 115
           +P     +Y  +  LC +      + G+D G + G +   D   ++         Y+L  
Sbjct: 61  LPGYLSKQYYKLYGLCFITYLCATMQGYD-GALMGSIYTEDAYLKY---------YHLDI 110

Query: 116 -SNVRTGLIVAIFNIGCAFGGLTLGRLGDIYGRR-------LGLMCXXXXXXXXXXXXXA 167
            S+  TGL+ +IFN+G   G   +  L D  GR+       LG++               
Sbjct: 111 NSSSGTGLVFSIFNVGQICGAFFVP-LMDWKGRKPAILIGCLGVVIGAIISSLTTTKSAL 169

Query: 168 TGDKWYQYFIGRIISGLGVGGIAVLSPTLISETAPKHLRGTCVAFYQLMITLGIFLGYCT 227
            G +W+  F   I +          +PT  +E AP HLRG     Y  + ++G  +   +
Sbjct: 170 IGGRWFVAFFATIANAA--------APTYCAEVAPAHLRGKVAGLYNTLWSVGSIVAAFS 221

Query: 228 NYGT-KTYTNSVQ-WRVPLGMCFAWAIFMIAGMLLVPESPRFLIEKGRFEEARRSIAKSN 285
            YGT K + NS + +++PL +   +   +     L+PESPR+L+  GR EEAR  I K +
Sbjct: 222 TYGTNKNFPNSSKAFKIPLYLQMMFPGLVCIFGWLIPESPRWLVGVGREEEAREFIIKYH 281

Query: 286 -KLTVEDPGVSAEVELINAGVEAEKLAGSATWGE---LFSSKGKILQRVIMGVMIQSLQQ 341
                  P +  E+  I        L+      +   LF ++     R ++ +++    Q
Sbjct: 282 LNGDRTHPLLDMEMAEIIESFHGTDLSNPLEMLDVRSLFRTRSD-RYRAMLVILMAWFGQ 340

Query: 342 LTGNNYFFYYGTTIFQAVGMDDSFQTSIVLG---IVNFASTFVGLWTVEKFGRRKCLLWG 398
            +GNN   YY  T+ + VGM       ++ G   IV + S+  G + ++K GRR+  L G
Sbjct: 341 FSGNNVCSYYLPTMLRNVGMKSVSLNVLMNGVYSIVTWISSICGAFFIDKIGRREGFL-G 399

Query: 399 SASMASCFVVFASVGVTRLWPNGQDQPSSKGAGNCMIVXXXXXXXXXXXXWAPIAYVIVS 458
           S S A+  +   S+   R      ++   K A N  +V            + P+  +  +
Sbjct: 400 SISGAALALTGLSICTARY-----EKTKKKSASNGALVFIYLFGGIFSFAFTPMQSMYST 454

Query: 459 ESYPLRVKNRAMAISVGSNWIWGFLIGFFTPFITSAIN--FYYGYVFMGCLXXXXXXXXX 516
           E      +++A  ++   + +  F+  F TP     I   FY  YVF             
Sbjct: 455 EVSTNLTRSKAQLLNFVVSGVAQFVNQFATPKAMKNIKYWFYVFYVFFDIF--EFIVIYF 512

Query: 517 XXCETKGLTLEEVNEMYE 534
              ETKG +LEE+  ++E
Sbjct: 513 FFVETKGRSLEELEVVFE 530

>Kwal_27.12815
          Length = 198

 Score = 92.8 bits (229), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 55/188 (29%), Positives = 91/188 (48%), Gaps = 12/188 (6%)

Query: 371 LGIVNFASTFVGLWTVEKFGRRKCLLWGSASMASCFVVFASVGVTRLWPNGQDQPSSKGA 430
           + +VN   T  G+  VE  GRR  LLWG+  M    ++ A+VG           P S  A
Sbjct: 1   MNVVNVIMTIPGIALVEIAGRRNLLLWGAVGMCVSELIVAAVGTAL--------PDSFSA 52

Query: 431 GNCMIVXXXXXXXXXXXXWAPIAYVIVSESYPLRVKNRAMAISVGSNWIWGFLIGFFTPF 490
              +I             W P+A+V+V E +PLRV+ +++A+   SNW++ F I + TP+
Sbjct: 53  NKTLIAFSCTFIASFAATWGPLAWVVVGEIFPLRVRAKSVAVCAASNWLFNFAIVYATPY 112

Query: 491 ITSA----INFYYGYVFMGCLXXXXXXXXXXXCETKGLTLEEVNEMYEEGVLPWKSDSWL 546
           +  +    +     +++ GC             ETKGLTLE++++++E      +S  ++
Sbjct: 113 LVDSEHANLQSKLFFIWGGCTFLCFLFVYFFIYETKGLTLEQIDQLFETCSSARQSKGFI 172

Query: 547 PAGRRGTD 554
           P  R  TD
Sbjct: 173 PTERLETD 180

>Kwal_27.10664
          Length = 653

 Score = 98.2 bits (243), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 132/510 (25%), Positives = 210/510 (41%), Gaps = 59/510 (11%)

Query: 49  KPENEHFPEIPQKKLSEYILVMCLCLMVAFGGFVFGWDTGTISGFVNMTDFKRRFGNYSQ 108
           + +N  F  +P+K     I ++C   M   G  V G D   I+G  N+  F  R    + 
Sbjct: 117 EEDNHPFRNLPRK----LIAIICASAM---GAAVQGMDETVING-ANL--FYPR--QLAL 164

Query: 109 SEGTYYLSNVRTGLIVAIFNIGCAFGGLTLGR-LGDIYGRRLGLM--CXXXXXXXXXXXX 165
             GT Y    R GL+     + CA     +   L +  GR+  +   C            
Sbjct: 165 GHGTAY-DEWREGLVNGAPYLCCAAVSCWMTDWLNNWLGRKRVIFWTCAVSAITCLLQAF 223

Query: 166 XATGDK-WYQYFIGRIISGLGVGGIAVLSPTLISETAPKHLRGTCVAFYQLMITLGIFLG 224
             TG++ W+  F  R + GLG+G  +      ++E + K LRG     +Q     GI  G
Sbjct: 224 APTGERGWHYLFAMRFLLGLGIGPKSATVSVYLAECSTKKLRGIICMNWQTFTAFGIMWG 283

Query: 225 YCTNY-----GTKTYTNSVQWRVPLGMCFAWAIFMIAGMLLVPESPRFLIEKGRFEEARR 279
           Y  +      G+   +  + WR+ L      AIF++  +   PESPR+L+ KGR+ EA  
Sbjct: 284 YVFSLIFYRVGSGAVSGGLNWRLTLASAMIPAIFVLFQIPYCPESPRWLMGKGRYLEAYE 343

Query: 280 SIAKSNKLTVEDPGVSAEVELINAGV---EAEKLAGS--ATWGELFSSKGKILQRVIMGV 334
           S  +     +    + A  +L    V   E E L        GE+F+ + +     I   
Sbjct: 344 STVQ-----IRPHRILACRDLFYQHVLLMEEESLEKPYFKRLGEVFTVR-RNRNAFIAAF 397

Query: 335 MIQSLQQLTGNNYFFYYGTTIFQAVGMDD--SFQTSIVLGIVNFASTFVGLWTVEKFGRR 392
           +   +QQ    N   YY + IF   G  +  S   S+  G+VNF       + +++FGRR
Sbjct: 398 ICAFMQQFCAINVIAYYSSAIFLQSGFSEISSLCASLGFGLVNFFFAIPAFFMIDRFGRR 457

Query: 393 KCLLWGSASMASCFVVFASVGVTRLWPNGQDQPSSKGAGNCMIVXXXXXXXXXXXXWAPI 452
             LL    +MA    VF  +     W    DQ +  G  +  I                +
Sbjct: 458 FLLLSTFPAMA----VFLFITGFAFWI--PDQQTRIGIVSMGIYIFSAIYSFGCGV---V 508

Query: 453 AYVIVSESYPLRVKNRAMAISVGSNWIWG--FLIGFFTPFITSAIN------FYYGYVFM 504
            +V+  E +PL V  RA+  S+ +  +WG  F++    P + SA++      FY G+  +
Sbjct: 509 PFVVAGEVFPLYV--RAIGASLFTIILWGFNFILSLTWPRMLSALHPQGAFGFYAGWNVV 566

Query: 505 GCLXXXXXXXXXXXCETKGLTLEEVNEMYE 534
           G              ETK LTLEE++E+++
Sbjct: 567 GWFLVYFLLP-----ETKQLTLEELDEVFD 591

>KLLA0E02970g complement(278965..280587) similar to sgd|S0002795
           Saccharomyces cerevisiae YDR387c, start by similarity
          Length = 540

 Score = 96.3 bits (238), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 89/357 (24%), Positives = 142/357 (39%), Gaps = 53/357 (14%)

Query: 79  GGFVFGWDTGTISGFV---NMTDFKRRFGNYSQSEGTYYLSNVRTGLIVAIFNIGCAFGG 135
           GG +FG+DTG ISG +   N  D         Q E           +I +I   G   G 
Sbjct: 60  GGMLFGYDTGVISGVLIAMNPKDLNFHSLEIWQKE-----------IITSITCAGSFIGS 108

Query: 136 LTLGRLGDIYGRR--LGLMCXXXXXXXXXXXXXATGDKWYQYFIGRIISGLGVGGIAVLS 193
           +    L D  GR+  L + C              T +       GR++ G+ VG  A   
Sbjct: 109 IIAFPLADRCGRKHTLTVCCIIFAASSMLMAVSYTFE---MLVTGRLVVGIAVGIAAQCI 165

Query: 194 PTLISETAPKHLRGTCVAFYQLMITLGIFLGYCTNY---GTKTYTNSVQWRVPLGMCFAW 250
           P  ++E +P  +RGT +    + IT G F  Y   Y         ++  WR    +    
Sbjct: 166 PIYLTEISPAKIRGTMLTLNSISITGGQFAAYVIAYFMIDNDHPQSTAAWRYLFALGSIP 225

Query: 251 AIFMIAGMLLVPESPRFLIEKGRFEEARRSIAKS--------------------NKLTVE 290
           AI  +  +  +PESPR+L+ K R  EA  ++ K                     NKL   
Sbjct: 226 AIVFLLTLDFIPESPRWLLSKSRLVEAELALHKVYPAATVPEIRHKLRKLTSDLNKLRYH 285

Query: 291 DPGVSAEVELINAGVE-AEKLAGSATWGELFSS----------KGKILQRVIMGVMIQSL 339
           +      +  +N     A    G ++ G  + +          +GK  + +I+G ++   
Sbjct: 286 NDETDPLLFPVNKRRSVASTRTGRSSLGATYYNEQLGKKRHRWEGKSKRALIIGCVLMFF 345

Query: 340 QQLTGNNYFFYYGTTIFQAVGMDDSFQTSIVLGIVNFASTFVGLWTVEKFGRRKCLL 396
           QQ +G N F YY  TIF+ VG  +    +I++   NF+ T + +  ++  G+R  LL
Sbjct: 346 QQTSGFNAFMYYSATIFEQVGFTNPLVPAIIVAFTNFSFTLLAMKLIDTMGKRTLLL 402

>YIL171W (HXT12) [2507] chr9 (19515..19844) Member of the hexose
           transporter family of the major facilitator superfamily
           (MFS) [330 bp, 109 aa]
          Length = 109

 Score = 86.3 bits (212), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 40/70 (57%), Positives = 49/70 (70%), Gaps = 1/70 (1%)

Query: 42  SRDDFDLKPENEHFPEIPQKKLSEYILVMCLCLMVAFGGFVFGWDTGTISGFVNMTDFKR 101
           S+D  +L    E   ++PQK LS Y  V  LCLM+AFGGF+FGWDTGTISGFVN++DF R
Sbjct: 35  SKDSLNLD-ATEAPIDLPQKPLSAYTTVAILCLMIAFGGFIFGWDTGTISGFVNLSDFIR 93

Query: 102 RFGNYSQSEG 111
           RFG    + G
Sbjct: 94  RFGQKKTTRG 103

>Scas_105.1
          Length = 56

 Score = 84.3 bits (207), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 36/53 (67%), Positives = 41/53 (77%)

Query: 520 ETKGLTLEEVNEMYEEGVLPWKSDSWLPAGRRGTDYNTEEAHTDDKPLYKRFL 572
           ETKGL+LEEVN M+EEGVLPWKS  W+P  RRG DY+     TDDKPL+KR L
Sbjct: 2   ETKGLSLEEVNTMWEEGVLPWKSSEWVPPSRRGADYDAAAMATDDKPLFKRML 54

>YDR387C (YDR387C) [1215] chr4 complement(1248142..1249809) Member
           of the hexose transporter family of the major
           facilitator superfamily (MFS) [1668 bp, 555 aa]
          Length = 555

 Score = 93.2 bits (230), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 125/533 (23%), Positives = 201/533 (37%), Gaps = 110/533 (20%)

Query: 79  GGFVFGWDTGTISGFVNMTDFKRRFGNYSQSEGTYYLSNVRTGLIVAIFNIGCAFGGLTL 138
           GG +FG+DTG ISG +             +      L++V+  LI +  ++G  FG +  
Sbjct: 49  GGLLFGYDTGVISGVL--------LSLKPEDLSLVVLTDVQKELITSSTSVGSFFGSILA 100

Query: 139 GRLGDIYGRRLGL-MCXXXXXXXXXXXXXATGDKWYQYFI-GRIISGLGVGGIAVLSPTL 196
             L D YGRR+ L +C             A   +   + I GR++ G+ VG  A   P  
Sbjct: 101 FPLADRYGRRITLAICCSIFILAAIGMAIA---RTLTFLICGRLLVGIAVGVSAQCVPLF 157

Query: 197 ISETAPKHLRGTCVAFYQLMITLGIFLGYCTNYGTKTYTNSVQWRVPLGMCFAWAIFMIA 256
           +SE +P  +RG  +    + IT G  + Y      K   NS  WR    +    AI  ++
Sbjct: 158 LSEISPSRIRGFMLTLNIIAITGGQLVSYVIASLMKEIDNS--WRYLFALSAIPAILFLS 215

Query: 257 GMLLVPESP---------------------------------RFLIEKGR---FEEAR-- 278
            +  +PESP                                 + +IE  +   +E+A   
Sbjct: 216 ILDFIPESPRWSISKGDILYTRDSLRMLYPTASTYHVNSKIKQLIIELDKLRLYEDASEP 275

Query: 279 ---------RSIAKSNKLTVEDPGV---SAEVE-----LINAGVEAEKLAGSATWGELFS 321
                    R +  S   T+  P +   S+  E     + ++      L G A  G L S
Sbjct: 276 LLVQSQSVIRYMDSSTSGTLSPPNIKRLSSNTERTSNTMSSSSAYLSALRGPAPNGALAS 335

Query: 322 SKGK-------ILQRVIMGVMIQSLQQLTGNNYFFYYGTTIFQAVGMDDSFQTSIVLGIV 374
           +K K        ++ +I+G M+   QQ+TG N F YY   IF    + +     I++   
Sbjct: 336 NKKKRHRMEPRTIRALIVGCMLMFFQQITGFNAFMYYAAIIFSKFNIKNPLLPPILIAST 395

Query: 375 NFASTFVGLWTVEKFGRRKCLLWGSASMASCFVVFASVGVTRLWPNGQDQPSSKGAGNCM 434
           NF  TF  ++T++  GRR  LL     M +  ++  SVG       G DQ       N +
Sbjct: 396 NFIFTFFAMYTMDSLGRRAILLRTILIM-TVGLLLCSVGF------GHDQV------NLL 442

Query: 435 IVXXXXXXXXXXXXWAPIAYVIVSESYPLRVKNRAMAISVGSNWIWGFLIGFFTPFITSA 494
           ++               + +  V E  PL  ++   +    +NW+      F +    S 
Sbjct: 443 LISVVIYVAAYASAMGSVPWTCV-EFLPLNRRSFGASCIACTNWLTN---AFVSMTYLST 498

Query: 495 INFYYGYVFMGCLXXXXXXXXXXXC----------ETKGLTLEEVNEMYEEGV 537
           IN       +G             C          E KGL+LEEV  +++ G+
Sbjct: 499 IN------TIGDENTMLIFAFFTVCAWFFVYFWYPEVKGLSLEEVGRVFDNGI 545

>Kwal_33.12950
          Length = 566

 Score = 93.2 bits (230), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 120/489 (24%), Positives = 197/489 (40%), Gaps = 38/489 (7%)

Query: 59  PQKKLSEYILVMCLCLMVAFGGFVFGWDTGTISGFVNMTDFKRRFGNYSQSEGTYYLSNV 118
           P   LS+++++  LC   +     FG D   I G V             Q +  + +++V
Sbjct: 92  PLLCLSKHMILAALC--TSLAALNFGMDESAIGGAV------------LQYQNQFNITDV 137

Query: 119 RT-GLIVAIFNIGCAFGGLTLGRLGDIYGRRLGLMCXXXXXXXXXXXXXATGDKWYQYFI 177
              GL VA   +  A  G  L    D Y  R  ++                 + +     
Sbjct: 138 NIQGLTVAAPYLAAACIGSPLTVYLDKYTGRRWIVFWSCLIGFAGSLIQGFANGFGCLLF 197

Query: 178 GRIISGLGVGGIAVLSPTLISETAPKHLRGTCVAFYQLMITLGIFLGYCTNYGTKTYTNS 237
            R++ G+G+G  +   P   +E +P + RG  +  +Q  I LG+ LG   N        S
Sbjct: 198 ARLLLGVGMGLNSATVPIYTAECSPANSRGALLMLWQTFIALGVCLGSVFNRAFVNINGS 257

Query: 238 VQWRVPLGMCFAWAIFMIAGMLLVPESPRFLIEKGRFEEARRSIAK--SNKLTVEDPGVS 295
           + WR+ +G      +   A +   PESPR+L+   R ++A  S+ K   N L+    G  
Sbjct: 258 LSWRLMIGSSAVAPVITAALIFFPPESPRWLVVHKRAKQALISLTKLRPNDLS----GAR 313

Query: 296 AEVELINA-GVEAEKLAGSATWGE---LFSSKGKILQRVIMGVMIQSLQQLTGNNYFFYY 351
               LI++   EAE     + W +   LFS+K      ++  + I   QQ  G N    Y
Sbjct: 314 DFYILIDSLKFEAELNNNLSPWNQFVSLFSNKRNRFALIVSLIGILG-QQYGGVNILVSY 372

Query: 352 GTTIFQAVGMD--DSFQTSIVLGIVNFASTFVGLWTVEKFGRRKCLLWGSASMASCFVVF 409
            TTI    G+D   +   SI +G   F +T +    +++FGRRK LL+     A C    
Sbjct: 373 TTTILTKAGVDPVTAIAGSIGIGGGCFLATLLSAQLIDRFGRRKMLLYTLPVEALCLFWL 432

Query: 410 ASVGVTRLWPNGQDQPSSKGAGNCMIVXXXXXXXXXXXXWAPIAYVIVSESYPLRVKNRA 469
             V       N  +  S  GAG   +               P+++ +V+E+  + V+   
Sbjct: 433 GGV------LNVTNAKSRLGAG---LASMYVYVLFYGTGIGPVSFTLVAETSSISVRMAH 483

Query: 470 MAISVGSNWIWGFLIGFFTPFITSAINFYYGYVFMGCLXXXX-XXXXXXXCETKGLTLEE 528
            +  +  NWI  F +    P + S ++   G  F G               ETK  TLE+
Sbjct: 484 SSTCMFVNWILDFCLSMTWPKMDSTMSTSGGLYFYGGFNIVVWTLAFLCIPETKQFTLEQ 543

Query: 529 VNEMYEEGV 537
           ++E+++ GV
Sbjct: 544 LDEIFKVGV 552

>YJR160C (MPH3) [3050] chr10 complement(737923..739731) Protein with
           maltose permease activity, member of hexose transporter
           family of the major facilitator superfamily (MFS),
           identical to Mph2p [1809 bp, 602 aa]
          Length = 602

 Score = 89.7 bits (221), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 112/524 (21%), Positives = 212/524 (40%), Gaps = 30/524 (5%)

Query: 31  NLQTSTPSNKASRDDFDLKPENEHFPEIPQ-----KKLSEYILVMCLCLMVAFGGFVFGW 85
           + +  + SNK   + FD   + +   E  +       L+ Y       L+V+    + G+
Sbjct: 54  DTRAPSDSNKVITEIFDATEDAKEADESERGMPLATALNTYPKAAAWSLLVSTTLIMEGY 113

Query: 86  DTGTISGFVNMTDFKRRFGNYSQSEGTYYLSNVRTGLIVAIFNIGCAFGGLTLGRLGDIY 145
           DT  +  F  +  F+R+FG+ +   G + +S      +   +  G   G    G   D+ 
Sbjct: 114 DTAILGAFYALPIFQRKFGSQNDKTGEWEISASWQIGLTLCYMAGEIVGLQLTGPSVDLV 173

Query: 146 GRRLGLMCXXXXXXXXXXXXXATGDKWYQYFIGRIISGLGVGGIAVLSPTLISETAPKHL 205
           G R  L+                 +      +G+ + G+  G    L+ +  SE  P  L
Sbjct: 174 GNRYTLIIALFFLAAFTFILYFC-NSLGMIAVGQALCGMPWGCFQCLTVSYASEICPLAL 232

Query: 206 RGTCVAFYQLMITLG-IFLGYCTNYGTKTYTNS-VQWRVPLGMCFAWAIFMIAGMLLVPE 263
           R     +  L    G +F         K Y +S + +++P  + +   + +  G+   PE
Sbjct: 233 RYYLTTYSNLCWLFGQLFAAGIMKNSQKKYADSELGYKLPFALQWILPVPLALGIFFAPE 292

Query: 264 SPRFLIEKGRFEEARRSIAK--SNKLTVEDPGVSAEVELINAGVEAEKLAGS--ATWGEL 319
           SP +L++KGRF+EARRS+ +  S K   ++  V+ EV+ I   ++ EK   S   ++ + 
Sbjct: 293 SPWWLVKKGRFDEARRSLRRTLSGKGPEKEILVTLEVDKIKVTIDKEKRLTSKEGSYSDC 352

Query: 320 FSSKGKILQRVIMGVMIQSLQQLTGNNYFFYYGTTIFQAVGM--DDSFQTSIVLGIVNFA 377
           F  + KI +R      +    Q T  +    Y T  ++  G+  + SF  SI+   +   
Sbjct: 353 F--EDKINRRRTRITCLCWAGQATCGSILIGYSTYFYEKAGVSTEMSFTFSIIQYCLGIC 410

Query: 378 STFVGLWTVEKFGRRKCLLWGSASMASCFVVFASVGVTRLWPNGQDQPSSKGAGNCMIVX 437
           +TF+  W  + FGR     +G A     F +   +G +          S  G+G+ ++  
Sbjct: 411 ATFLSWWASKYFGRYDLYAFGLAFQTIVFFIIGGLGCS------STHGSKMGSGSLLMAV 464

Query: 438 XXXXXXXXXXXWAPIAYVIVSESYPLRVKNRAMAISVGSNWIWGFLIGFFTPFITSAINF 497
                       AP+ + +VSE    R++ + + ++  +  +   +      +  ++  +
Sbjct: 465 AFFYNLGI----APVVFCLVSEMPSSRLRTKTIILARNTYNVVSIICSVLILYQLNSKKW 520

Query: 498 YYGY---VFMGCLXXXXXXXXXXXC-ETKGLTLEEVNEMYEEGV 537
            +G     F G L             ET G T  E+NE+++ GV
Sbjct: 521 NWGAKSGFFWGVLCFCTLIWAVVDLPETAGKTFVEINELFKLGV 564

>YDL247W (MPH2) [630] chr4 (5985..7814) Protein with maltose
           permease activity, member of hexose transporter family
           of the major facilitator superfamily (MFS), identical to
           Mph3p [1830 bp, 609 aa]
          Length = 609

 Score = 89.0 bits (219), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 112/524 (21%), Positives = 212/524 (40%), Gaps = 30/524 (5%)

Query: 31  NLQTSTPSNKASRDDFDLKPENEHFPEIPQ-----KKLSEYILVMCLCLMVAFGGFVFGW 85
           + +  + SNK   + FD   + +   E  +       L+ Y       L+V+    + G+
Sbjct: 54  DTRAPSDSNKVITEIFDATEDAKEADESERGMPLATALNTYPKAAAWSLLVSTTLIMEGY 113

Query: 86  DTGTISGFVNMTDFKRRFGNYSQSEGTYYLSNVRTGLIVAIFNIGCAFGGLTLGRLGDIY 145
           DT  +  F  +  F+R+FG+ +   G + +S      +   +  G   G    G   D+ 
Sbjct: 114 DTAILGAFYALPIFQRKFGSQNDKTGEWEISASWQIGLTLCYMAGEIVGLQLTGPSVDLV 173

Query: 146 GRRLGLMCXXXXXXXXXXXXXATGDKWYQYFIGRIISGLGVGGIAVLSPTLISETAPKHL 205
           G R  L+                 +      +G+ + G+  G    L+ +  SE  P  L
Sbjct: 174 GNRYTLIIALFFLAAFTFILYFC-NSLGMIAVGQALCGMPWGCFQCLTVSYASEICPLAL 232

Query: 206 RGTCVAFYQLMITLG-IFLGYCTNYGTKTYTNS-VQWRVPLGMCFAWAIFMIAGMLLVPE 263
           R     +  L    G +F         K Y +S + +++P  + +   + +  G+   PE
Sbjct: 233 RYYLTTYSNLCWLFGQLFAAGIMKNSQKKYADSELGYKLPFALQWILPVPLALGIFFAPE 292

Query: 264 SPRFLIEKGRFEEARRSIAK--SNKLTVEDPGVSAEVELINAGVEAEKLAGS--ATWGEL 319
           SP +L++KGRF+EARRS+ +  S K   ++  V+ EV+ I   ++ EK   S   ++ + 
Sbjct: 293 SPWWLVKKGRFDEARRSLRRTLSGKGPEKEILVTLEVDKIKVTIDKEKRLTSKEGSYSDC 352

Query: 320 FSSKGKILQRVIMGVMIQSLQQLTGNNYFFYYGTTIFQAVGM--DDSFQTSIVLGIVNFA 377
           F  + KI +R      +    Q T  +    Y T  ++  G+  + SF  SI+   +   
Sbjct: 353 F--EDKINRRRTRITCLCWAGQATCGSILIGYSTYFYEKAGVSTEMSFTFSIIQYCLGIC 410

Query: 378 STFVGLWTVEKFGRRKCLLWGSASMASCFVVFASVGVTRLWPNGQDQPSSKGAGNCMIVX 437
           +TF+  W  + FGR     +G A     F +   +G +          S  G+G+ ++  
Sbjct: 411 ATFLSWWASKYFGRYDLYAFGLAFQTIVFFIIGGLGCS------STHGSKMGSGSLLMAV 464

Query: 438 XXXXXXXXXXXWAPIAYVIVSESYPLRVKNRAMAISVGSNWIWGFLIGFFTPFITSAINF 497
                       AP+ + +VSE    R++ + + ++  +  +   +      +  ++  +
Sbjct: 465 AFFYNLGI----APVVFCLVSEMPSSRLRTKTIILARNTYNVVSIICSVLILYQLNSKKW 520

Query: 498 YYGY---VFMGCLXXXXXXXXXXXC-ETKGLTLEEVNEMYEEGV 537
            +G     F G L             ET G T  E+NE+++ GV
Sbjct: 521 NWGAKSGFFWGVLCFCTLIWAVVDLPETAGKTFVEINELFKLGV 564

>KLLA0D05379g complement(464200..465690) weakly similar to sp|P43562
           Saccharomyces cerevisiae YFL040w, start by similarity
          Length = 496

 Score = 87.4 bits (215), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 94/463 (20%), Positives = 196/463 (42%), Gaps = 32/463 (6%)

Query: 80  GFVFGWDTGTISGFVNMTDFKRRFGNYSQSEGTYYLSNVRTGLIVAIFNIGCAFGGLTLG 139
           GF+ G DT ++S F+  + FK  F   +          ++TG++     IG   G L  G
Sbjct: 18  GFMLGMDTSSLSLFLGTSYFKEYFKQPTA---------LQTGMMTGANQIGGFVGCLMSG 68

Query: 140 RLGDIYGRRLGLMCXXXXXXXXXXXXXATGDKWYQYFIGRIISGLGVGGIAVLSPTLISE 199
            L ++ G +  L C                 + Y   + R + G+ VG ++VL+   + E
Sbjct: 69  SLIELIGCKWCL-CACSVIWTMGSVGSFFVLEVYTMALSRFVKGIAVGILSVLASFYLME 127

Query: 200 TAPKHLRGTCVAFYQLMITLGIFLGYCTNYGTKTYTNSVQWRVPLGMCFAWAIFMIAGML 259
               ++RG   A  Q+ +T+ I   Y  +         + +++  G+    ++ ++    
Sbjct: 128 VFSSNIRGQATALMQMALTISILSIYFLSMLLDKIQGPLAFKITWGLEVIPSLLLLMLFQ 187

Query: 260 LVPESPRFLIEKG-RFEEARRSIAKSNKLTVEDPGVSAEVELINAGVEAEKLAGSATWGE 318
            +PESPR+L + G   ++  RS+A    L V+D     E + ++   +  KL+       
Sbjct: 188 ALPESPRWLYKHGYSNKDIDRSLA---ILRVKDVEKLRE-KFVSETKQKPKLS------- 236

Query: 319 LFSSKGKILQRVIMGVMIQSLQQLTGNNYFFYYGTTIFQAVGMDDSFQTSIVLG--IVNF 376
            +  K    + + +G+++Q L Q++G N   YY   I + VG DD   + +  G  IVN 
Sbjct: 237 -YIIKKGYWKHMSLGIIVQILIQISGINVVMYYTIYICEMVGFDDDVSSKLTAGPYIVNT 295

Query: 377 ASTFVGLWTVEKFGRRKCLLWGSASMASCFVVFASVGVTRLWPNGQDQPSSKGAGNCMIV 436
             T V ++ ++KF R+  + W S  +    ++   +   R     +         N ++ 
Sbjct: 296 IFTLVPVFLLDKFNRKVFIGWASVFLGGIMLLIGFLIGER-----ERHVGDVVLRNIVVA 350

Query: 437 XXXXXXXXXXXXWAPIAYVIVSESYPLRVKNRAMAISVGSNWIWGFLIGFFTPFITSAIN 496
                        +   ++  +E  P  +K+ A+++ + ++W  GF +    P++   + 
Sbjct: 351 LCFLFVSVFSSSLSCAGFIYTNEILPESIKSVALSVCISTSWFTGFALALMAPYLMQIVE 410

Query: 497 FYYGYVFMGCLXXXXXXXXXX-XCETKGLTLEEVNEMYEEGVL 538
            ++ +V +G               ET+ L+  +++ ++++  L
Sbjct: 411 -WWTFVMLGTSTIALAFIIIMWFPETRDLSPHDIDNLFKQDAL 452

>CAGL0C01771g 187030..188487 similar to sp|P38142 Saccharomyces
           cerevisiae YBR241c or sp|P53142 Saccharomyces cerevisiae
           YGL104c, start by similarity
          Length = 485

 Score = 87.0 bits (214), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 89/374 (23%), Positives = 150/374 (40%), Gaps = 25/374 (6%)

Query: 121 GLIVAIFNIGCAFGGLTLGRLGDIYGRRLGLMCXXXXXXXXXXXXXATGDKWYQYFIGRI 180
           G++ ++ ++G   G    G+L   YG++                       W   F GR+
Sbjct: 87  GVVTSVLSVGGLIGSYIAGQLAAKYGKKKISQGTAFVYFIGSLMLTMANGYWTMIF-GRL 145

Query: 181 ISGLGVGGIAVLSPTLISETAPKHLRGTCVAFYQLMITLGIFLGYCTNYGTKTYTNSVQW 240
           + G+  G   V+ P  I+E  P   +G      QL I +GI     T      +TNS  W
Sbjct: 146 LVGMASGISIVVIPVYINEITPAEYKGAMGTMNQLSINIGILF---TQTIALVFTNSYYW 202

Query: 241 RVPLGMCFAWAIFMIAGMLLVPESPRFLIEKGRFEEARRSIAKSNKLTVEDPGVSAEV-- 298
           R  L +  A A+        + ESP++L+++G   EA   + K +  T +D     +   
Sbjct: 203 RWILLIGTAIALVNFVAWSTIDESPKWLLKRGLTSEAEMVVYKLHGGTYQDAKDQIQTWQ 262

Query: 299 ELINAGVEAEKLAG--SATWGELFSSKGKILQRVIMGVMIQSLQQLTGNNYFFYYGTTIF 356
             +N+  E    AG     W  +   + K  + VI   MI   QQ  G N   +YG  + 
Sbjct: 263 TDMNSHHEHADFAGREPTLWEFVTREEYKKPRNVIF--MILCAQQFCGINSIIFYGVKVI 320

Query: 357 QAVGMDDSFQTSIVLGIVNFASTFVGLWTVEKFGRRKCLLWGSASMA-SCFVVFASVGVT 415
                + +   +  + ++N   TFV    ++  GR+  LL  SA MA + F++  S+G++
Sbjct: 321 SNSLPNSAVLVNFGISVLNVLMTFVASVIIDSLGRKPLLLSSSALMAGTSFLI--SIGIS 378

Query: 416 RLWPNGQDQPSSKGAGNCMIVXXXXXXXXXXXXWAPIAYVIVSESYPLRVKNRAMAISVG 475
           +      D P        +++              PI  +I+SE        +A +    
Sbjct: 379 K------DVPI------LLVIAVFAYIASFAIGVGPIPLMIISELTTHEAAAKAQSFGTI 426

Query: 476 SNWIWGFLIGFFTP 489
            NW+  FL+GF  P
Sbjct: 427 CNWLATFLVGFLFP 440

>YBR298C (MAL31) [475] chr2 complement(802587..804431) Maltose
           permease, a high affinity maltose/H[+] symporter, member
           of the hexose transporter family of the major
           facilitator superfamily (MFS) [1845 bp, 614 aa]
          Length = 614

 Score = 87.8 bits (216), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 108/512 (21%), Positives = 208/512 (40%), Gaps = 43/512 (8%)

Query: 47  DLKPENEHFPEIP-QKKLSEYILVMCLCLMVAFGGFVFGWDTGTISGFVNMTDFKRRFGN 105
           D K  +E    +P    L  Y       L+V+      G+DT  +  F  +  F++++G+
Sbjct: 76  DAKEADESERGMPLMTALKTYPKAAAWSLLVSTTLIQEGYDTAILGAFYALPVFQKKYGS 135

Query: 106 YSQSEGTYYLS-NVRTGLIVAIFN---IGCAFGGLTLGRLGDIYGRRLGLMCXXXXXXXX 161
            + + G Y +S + + GL +       +G    G ++  +G+ Y   + L          
Sbjct: 136 LNSNTGDYEISVSWQIGLCLCYMAGEIVGLQMTGPSVDYMGNRYTLIMALFFLAAFIFIL 195

Query: 162 XXXXXATGDKWYQYFIGRIISGLGVGGIAVLSPTLISETAPKHLR-------GTCVAFYQ 214
                          +G+ + G+  G    L+ +  SE  P  LR         C AF Q
Sbjct: 196 YFCKSLG-----MIAVGQALCGMPWGCFQCLTVSYASEICPLALRYYLTTYSNLCWAFGQ 250

Query: 215 LMITLGIFLGYCTNYGTKTYTNSVQWRVPLGMCFAWAIFMIAGMLLVPESPRFLIEKGRF 274
           L        G   N   K   + + +++P  + + W + +  G+   PESP +L++KGR 
Sbjct: 251 LFAA-----GIMKNSQNKYANSELGYKLPFALQWIWPLPLAVGIFFAPESPWWLVKKGRI 305

Query: 275 EEARRSIAK--SNKLTVEDPGVSAEVELINAGVEAE-KLAGSATWGELFSSKGKILQRVI 331
           ++ARRS+ +  S K   ++  VS E++ I   +E E K++   T+ +    K  I +R  
Sbjct: 306 DQARRSLERTLSGKGPEKELLVSMELDKIKTTIEKEQKMSDEGTYWDCV--KDGINRRRT 363

Query: 332 MGVMIQSLQQLTGNNYFFYYGTTIFQAVGM--DDSFQTSIVLGIVNFASTFVGLWTVEKF 389
               +  + Q +       Y T  ++  G+  D +F  SI+   +  A+TF+  W  +  
Sbjct: 364 RIACLCWIGQCSCGASLIGYSTYFYEKAGVSTDTAFTFSIIQYCLGIAATFISWWASKYC 423

Query: 390 GRRKCLLWGSASMASCFVVFASVGVTRLWPNGQDQPSSKGAGNCMIVXXXXXXXXXXXXW 449
           GR     +G A  A  F +   +G +          +  G+G  ++V             
Sbjct: 424 GRFDLYAFGLAFQAIMFFIIGGLGCS------DTHGAKMGSGALLMVVAFFYNLGI---- 473

Query: 450 APIAYVIVSESYPLRVKNRAMAISVGSNWIWGFLIGFFTPFITSAINFYY----GYVFMG 505
           AP+ + +VSE    R++ + + ++  +  +   ++     +  ++  + +    G+ + G
Sbjct: 474 APVVFCLVSEIPSSRLRTKTIILARNAYNVIQVVVTVLIMYQLNSEKWNWGAKSGFFWGG 533

Query: 506 CLXXXXXXXXXXXCETKGLTLEEVNEMYEEGV 537
                         ET G T  E+NE++  GV
Sbjct: 534 FCLATLAWAVVDLPETAGRTFIEINELFRLGV 565

>YFL040W (YFL040W) [1643] chr6 (51350..52972) Putative hexose
           transporter, member of the hexose transport family of
           the major facilitator superfamily (MFS) [1623 bp, 540
           aa]
          Length = 540

 Score = 87.4 bits (215), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 104/507 (20%), Positives = 200/507 (39%), Gaps = 51/507 (10%)

Query: 54  HFPEIPQKKLSEYILVMCLCLMVAFGGFVFGWDTGTISGFVNMTDFKRRFGNYSQSEGTY 113
             P++P+ K+++   V  +  ++   GF+ G +  +++ F+    F   F   +  +   
Sbjct: 10  RLPKMPKIKITKTYEVTKITAILTLVGFIMGLEVPSLATFLTNKTFNEYFKYPTPLQQGL 69

Query: 114 YLSNVRTGLIVAIFNIGCAFGGLTLGRLGDIYGRRLGLMCXXXXXXXXXXXXXATGDKWY 173
            + +   G I     +GC    +   R   IY  + G++                G    
Sbjct: 70  LMGSTPLGGI-----MGCFICCIMNDRFSRIYQFQSGIIIWNIVTLLNFCIWDILG---- 120

Query: 174 QYFIGRIISGLGVGGIAVLSPTLISETAPKHLRGTCVAFYQLMITLGIFLGYCTNYGTKT 233
              I R+I G+ +G  ++L  +  +E  P+  RG+ +++ QL +T+GI + +        
Sbjct: 121 -LLICRMIKGMILGNFSILVASYANEVIPRGKRGSTMSYIQLCLTIGILVMHYLCIALSL 179

Query: 234 YTNSVQWRVPLGMCFAWAIFMIAGMLL------VPESPRFLIEKGRFEEARRSIAKSNKL 287
           + +   +R+      AW I +I G+L       +PES  +L+  G+  EA+       K 
Sbjct: 180 WDSHFAFRI------AWCIGIIPGLLFWMASYALPESYHWLVLHGKMSEAQEIQHNLAKK 233

Query: 288 TVEDPGVSAEVELINAGVEAEKLAGSATWGELFSSKGKILQR-----VIMGVMIQSLQQL 342
             E     A  E+        +LAG    G       K L R     +I+G+ +Q L Q 
Sbjct: 234 FNESQPRDAVPEM-----SKIELAGDFWIGVNDLDFSKKLPRGSFKPLILGMTLQLLVQF 288

Query: 343 TGNNYFFYYGTTIFQAVGMDDSFQ--TSIVLGIVNFASTFVGLWTVEKFGRRKCLLWGSA 400
           +G N    Y T I + VG++ + +  TS +   +N   + + +  ++   R+   L G  
Sbjct: 289 SGINIILGYITYICEIVGLEGNVKLFTSSIPYFINMVLSLLPITFIDYTSRKLITLLGGF 348

Query: 401 SMASCFVVFASVGVTRLWPNGQDQPSSKG-------------AGNCMIVXXXXXXXXXXX 447
            ++   +   ++ V      GQD     G              G  ++            
Sbjct: 349 PISGLLITIGALFVKY----GQDTKPIDGNRSLVWSIGENPFVGGWILTLCFLIVGIFAM 404

Query: 448 XWAPIAYVIVSESYPLRVKNRAMAISVGSNWIWGFLIGFFTPFITSAINFYYGYVFMGCL 507
             + I +V  +E  P RVK +  AI V   W+  F++ F  P +   +      +F    
Sbjct: 405 SLSSIPWVYTNEMLPSRVKVKGFAICVTFGWLGNFILTFLCPVMIERLKGTTFIIFGSLT 464

Query: 508 XXXXXXXXXXXCETKGLTLEEVNEMYE 534
                       ETKG+++E++++ +E
Sbjct: 465 FLISLSVLIWFPETKGMSIEDIDKFFE 491

>YGL104C (VPS73) [1880] chr7 complement(308714..310174) Putative
           hexose transporter, class B vacuolar sorting protein
           involved in Prc1p vacuolar trafficking pathway, member
           of the hexose transporter family of the major
           facilitator superfamily (MFS) [1461 bp, 486 aa]
          Length = 486

 Score = 85.5 bits (210), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 91/403 (22%), Positives = 166/403 (41%), Gaps = 39/403 (9%)

Query: 115 LSNVRTGLIVAIFNIGCAFGGLTLGRLGDIYGRRLGLMCXXXXXXXXXXXXXATGDKWYQ 174
           L++ + G++ ++F IG   G      L +IYGR+   +                 + +  
Sbjct: 86  LNDEQIGIVTSVFCIGGILGSYFATSLANIYGRKFSSLINCTLNIVGSLIIF-NSNSYRG 144

Query: 175 YFIGRIISGLGVGGIAVLSPTLISETAPKHLRGTCVAFYQLMITLGIFLGYCTNYGTKTY 234
             IGRI+ G+  G + V+ P  I E AP    G   +  Q+ I LG+ L   T       
Sbjct: 145 LIIGRILVGISCGSLIVIIPLFIKEVAPSGWEGLLGSMTQICIRLGVLL---TQGIALPL 201

Query: 235 TNSVQWRVPLGMCFAWAIFMIAGMLLVPESPRFLIEKGRFEEARRSIAKSNKLTVEDPGV 294
           T+S +WR  L   F  A+       +V ESP++L+  GR  +A+ S+ K   +T ++   
Sbjct: 202 TDSYRWRWILFGSFLIAVLNFFMWFIVDESPKWLLAHGRVTDAKLSLCKLRGVTFDE--A 259

Query: 295 SAEVELINAGVEA----------EKLAGSATWGELFSSKGKILQRVIMGVMIQSLQQLTG 344
           + E++     +E+            ++GS +  +    +  +  R ++ V++   QQ  G
Sbjct: 260 AQEIQDWQLQIESGDPLIEPTTTNSISGSNSLWKYLRDRTNVKSRHVITVLLFG-QQFCG 318

Query: 345 NNYFFYYGTTIFQAVGMDDSFQTSIVLGIVNFASTFVGLWTVEKFGRRKCLLWGSASMAS 404
            N    YGT I   +    + + +  + +VN   T +    +    R+  L      M S
Sbjct: 319 INSIVLYGTKIISQLYPQHAIRINFFISMVNVLVTILVSLLIHSLPRKPLL------MTS 372

Query: 405 CFVVFASVGVTRLWPNGQDQPSSKGAGNCMIVXXXXXXXXXXXXWAPIAYVIVSE-SYPL 463
             +V  +  +  +  N           N +IV              P+ ++I+ E S P 
Sbjct: 373 TVLVSVTAFIMGIAMNHNKM-------NLLIVFSFIYMGVFTMGLNPLPFIIMREVSKP- 424

Query: 464 RVKNRAMAISVGS--NWIWGFLIGFFTPFITSAINFYYGYVFM 504
             ++  +A   G+  NW+  F+I +  P I   ++   GYVF+
Sbjct: 425 --QDMVLAQRYGTICNWVGTFIIAYTFPIIHDVLS---GYVFI 462

>Sklu_2375.1 YGR289C, Contig c2375 1376-3217 reverse complement
          Length = 613

 Score = 84.7 bits (208), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 98/473 (20%), Positives = 192/473 (40%), Gaps = 40/473 (8%)

Query: 84  GWDTGTISGFVNMTDFKRRFGNYSQSEGTYYLSNV-RTGLIVAIFN---IGCAFGGLTLG 139
           G+DT  ++    +  F ++FG+++ + G Y +S   +TGL + IF    IG    G+   
Sbjct: 109 GYDTALLASLYALPAFAKKFGSFNAASGIYEISAAWQTGLSMCIFVGEIIGLQLAGVAAD 168

Query: 140 RLG---DIYGRRLGLMCXXXXXXXXXXXXXATGDKWYQYFIGRIISGLGVGGIAVLSPTL 196
           R+G    +    L L C                       +G I+ G+  G    L+ + 
Sbjct: 169 RVGYRWTLITSLLALFCFIFVLFFAPSCAVLA--------VGEILCGIPWGCFQTLTVSY 220

Query: 197 ISETAPKHLRGTCVAFYQLMITLGIFL--GYCTNYGTKTYTNSVQWRVPLGMCFAWAIFM 254
            +E  P  LR     +  +   +G  +  G   N       +++ +++P  + + W   +
Sbjct: 221 ATEVCPLVLRYYLTTYVNICWVIGQIMASGVLKNSQENLADSALAYKLPFALQWIWPFPI 280

Query: 255 IAGMLLVPESPRFLIEKGRFEEARRSIAK---SNKLTVEDPGVSAEVELINAGVEAEK-L 310
             G+   PESP +L++K R +EA RS+ +     + T +D  V A ++ +    E E  +
Sbjct: 281 ALGIYFAPESPWWLVKKNRLKEAERSLKRLITGIEATEKDIVVDAMIKKMKLTTEKEDMM 340

Query: 311 AGSATWGELFSSKGKILQRVIMGVMIQSLQQLTGNNYFFYYGTTIFQAVGMDDS--FQTS 368
             + T+ + F  KG   +R  +  ++   Q   G+     Y T  +Q  G+ DS  F  S
Sbjct: 341 TKNVTYWDCF--KGVDGRRTRIASLVWIAQNACGST-LMGYSTYFYQKAGLSDSFAFNFS 397

Query: 369 IVLGIVNFASTFVGLWTVEKFGRRKCLLWGSASMASCFVVFASVGVTRLWPNGQDQPSSK 428
           I+   + F  TF   +  +++GR      G         V   +G +        + +S 
Sbjct: 398 IIQYCLGFVGTFSSWFFSKRYGRFTIFTTGLGLQTLLLFVIGGLGFS------DSKNASW 451

Query: 429 GAGNCMIVXXXXXXXXXXXXWAPIAYVIVSESYPLRVKNRAMAISVGSNWIWGFLIGFFT 488
             G+ M+               P+ Y I  E    +++ + + ++     I G +   +T
Sbjct: 452 AIGSLMMAFVFVYDVGV----GPVTYCIFPEEPSTKLRTKTVIVARNFYNIMGIINSIWT 507

Query: 489 PFITSAINFYYGY---VFMGCLXXXXXXXXXXXC-ETKGLTLEEVNEMYEEGV 537
           P++ ++  + +G    +F G +             ET G T  E++E++ + +
Sbjct: 508 PYMLNSTEWNWGAKTGLFWGGISLVMLVWAVLDLPETAGRTFGEIDELFAQKI 560

>KLLA0E06743g complement(612941..614944) similar to
           ca|CA5798|IPF4181 Candida albicans putative permease (by
           homology), start by similarity
          Length = 667

 Score = 84.3 bits (207), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 96/385 (24%), Positives = 155/385 (40%), Gaps = 46/385 (11%)

Query: 172 WYQYFIGRIISGLGVGGIAVLSPTLISETAPKHLRGTCVAFYQLMITLGIFLGYCTNY-- 229
           W+  F  R + G G+G  +  +   ++E + K LRG     +Q     GI  GY  +   
Sbjct: 246 WHYLFAMRFLLGFGIGPKSATTSVYLAECSTKKLRGIICMNWQTFTAFGIMWGYVFSLIF 305

Query: 230 ---GTKTYTNSVQWRVPLGMCFAWAIFMIAGMLLVPESPRFLIEKGRFEEARRSIAKSNK 286
              G       + WR+ L      AI ++  +   PESPR+L+ KGR++EA  S      
Sbjct: 306 YRVGRAGIAGGLNWRLMLASAMIPAILVLVQIPFCPESPRWLMGKGRYKEAYES-----T 360

Query: 287 LTVEDPGVSAEVELINAGV---EAEKLAGS--ATWGELFSSKGKILQRVIMGVMIQSLQQ 341
           L + +  + A  +L    V   E   L  S      E+F+ + +    +I   +   +QQ
Sbjct: 361 LQIRNHKILACRDLFYQHVLLMEENSLEMSYWTRLREIFTVR-RNRNALICAFICAFMQQ 419

Query: 342 LTGNNYFFYYGTTIFQAVGMDD--SFQTSIVLGIVNFASTFVGLWTVEKFGRRKCLLWGS 399
               N   YY + IF   G  +  S   S+  G++NF       + +++FGRR  LL   
Sbjct: 420 FCAINVIAYYSSAIFLQSGFTEISSLCASLGFGLINFFFAIPAFFMIDRFGRRFLLL--- 476

Query: 400 ASMASCFVVFASVGVTRLWPNGQDQPSSKGAGNCMIVXXXXXXXXXXXXWAPIAYVIVSE 459
            +      VF  +     W +  D     G  +  I                + +VI  E
Sbjct: 477 -NTFPWLAVFLLITGFSFWID--DTEKRIGVVSMGIYVFSAIYSFGCGV---VPFVIAGE 530

Query: 460 SYPLRVKNRAMAISVGSNWIWGF----------LIGFFTPFITSAINFYYGYVFMGCLXX 509
            +PL V  RA+  S+ +  +WGF          ++  F P    A  FY  +  +G    
Sbjct: 531 VFPLYV--RAIGASLFTIVLWGFNFILSLTWPSMLRAFEP--QGAFGFYAAWNVIGWFLV 586

Query: 510 XXXXXXXXXCETKGLTLEEVNEMYE 534
                     ETK LTLEE++E+++
Sbjct: 587 YFFMP-----ETKQLTLEELDEVFD 606

>AGL277W [4035] [Homologous to NOHBY] complement(185070..187085)
           [2016 bp, 671 aa]
          Length = 671

 Score = 82.0 bits (201), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 96/392 (24%), Positives = 162/392 (41%), Gaps = 37/392 (9%)

Query: 172 WYQYFIGRIISGLGVGGIAVLSPTLISETAPKHLRGTCVAFYQLMITLGIFLGYCTNY-- 229
           W   F  R + G G+G  +      ++E APK LRG     +Q     G+  GY  +   
Sbjct: 252 WRYLFAMRFLLGFGLGIKSATVNVYLAECAPKELRGIVCMNWQAFTAFGVMWGYVASLVF 311

Query: 230 ---GTKTYTNSVQWRVPLGMCFAWAIFMIAGMLLVPESPRFLIEKGRFEEARRSI--AKS 284
              G       + WR+ L      A+F++  +   PESPR+L+ KGR+ EA  ++   + 
Sbjct: 312 YRVGDAGIGGGLNWRLMLASAALPAVFVLFQLPHCPESPRWLMGKGRYPEAYAALLQLRK 371

Query: 285 NKLTVEDPGVSAEVELINAGVEAEKLAGSATWGELFSSKGKILQRVIMGVMIQSLQQLTG 344
           ++L          V L+       +L+      E+F+ + +     +   +   +QQ   
Sbjct: 372 HRLLACRDLFYQHVLLVQE--STLQLSYFTRLKEIFTVR-RNRNAFVAAFICAFMQQFCA 428

Query: 345 NNYFFYYGTTIFQAVGMDD--SFQTSIVLGIVNFASTFVGLWTVEKFGRRKCLLWGSASM 402
            N   YY + IF   G  +  S  +S+  GI+N        + +++FGRR  LL    S 
Sbjct: 429 INVIAYYSSVIFLQAGFSEIASLCSSLGFGIINTVFAIPAYFMIDRFGRRFLLL----ST 484

Query: 403 ASCFVVFASVGVTRLWPNGQDQPSSKGAGNCMIVXXXXXXXXXXXXWAPIAYVIVSESYP 462
                VF  V     W   +D  +S G  +  I                + +V   E +P
Sbjct: 485 LPWLGVFLLVTGFAFWI--KDTKASIGVISFGIYIFSAIYSFGMGV---VPFVYAGEVFP 539

Query: 463 LRVKNRAMAISVGSNWIWG--FLIGFFTPFITSAIN------FYYGYVFMGCLXXXXXXX 514
           L V  RA+  S+ +  +WG  F++    P +  A+       FY  + F+G         
Sbjct: 540 LYV--RAIGSSLFAVVLWGFNFILALTWPSMLRAMKPQGAFGFYAAWNFIGYFLVYFFLP 597

Query: 515 XXXXCETKGLTLEEVNEMYEEGVLPWKSDSWL 546
                ETK LTLEE++E++   ++  ++D +L
Sbjct: 598 -----ETKQLTLEELDEVFSVPLMK-RADYYL 623

>KLLA0E01782g 171319..173037 weakly similar to ca|CA5798|IPF4181
           Candida albicans putative permease (by homology),
           hypothetical start
          Length = 572

 Score = 81.6 bits (200), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 92/367 (25%), Positives = 152/367 (41%), Gaps = 19/367 (5%)

Query: 178 GRIISGLGVGGIAVLSPTLISETAPKHLRGTCVAFYQLMITLGIFLGYCTNYGTKTYTNS 237
            R+  G+G+G  +   P   +E AP   RG  +  +Q  I LG+ LG   N        +
Sbjct: 204 ARLYLGIGMGLCSSTVPIYTAECAPAVSRGAILMLWQTFIALGVCLGSVFNRAFVEIEGN 263

Query: 238 VQWRVPLGMCFAWAIFMIAGMLLVPESPRFLIEKGRFEEARRSIAKSNKLTVEDPGVSAE 297
           + WR+ +G            + + PESPR+LI  G   E+  S+ +     V     S +
Sbjct: 264 LSWRLMIGSSCVAPFITALVVYIPPESPRWLIGNGFVRESLESLIRLRNTEVSG---SRD 320

Query: 298 VELINAGVEAE-KLAGSATWG-ELFSSKGKILQRVIMGVMIQSL--QQLTGNNYFFYYGT 353
             ++   ++ E KLA   +W  E+ S    I  R  + V    +  QQ  G N    Y  
Sbjct: 321 FYILYESLKYEHKLAAKLSWHQEIKSLFSNIRNRFALWVSFLGILGQQYGGVNILVSYTA 380

Query: 354 TIFQAVGMD--DSFQTSIVLGIVNFASTFVGLWTVEKFGRRKCLLWGSASMASCFVVFAS 411
           TI    G+D   +   SI +G   F +TF+    +++FGRR  LL       +C  +F  
Sbjct: 381 TILTNAGIDPVTAIAGSIGIGGGCFLATFLSSQLIDRFGRRTMLLLTLPVEGAC--LFWL 438

Query: 412 VGVTRLWPNGQDQPSSKGAGNCMIVXXXXXXXXXXXXWAPIAYVIVSESYPLRVKNRAMA 471
            G+  +    +DQ         M V              PI++ +V+E+  + V+    A
Sbjct: 439 GGILNI---KEDQARLAAGLAAMYVFVLFYGIGI----GPISFTLVAETPSITVRMAHSA 491

Query: 472 ISVGSNWIWGFLIGFFTPFITSAINFYYGYVFMGCLXXXX-XXXXXXXCETKGLTLEEVN 530
            ++  NW+  F +    P +  ++    G  F G               ETK  TLE+++
Sbjct: 492 FAMSINWLLDFCLTMTWPKMADSMGTSGGLYFYGAFNFLIWVLAYFTIPETKRFTLEQLD 551

Query: 531 EMYEEGV 537
           E+++ GV
Sbjct: 552 EVFKHGV 558

>Scas_632.14
          Length = 553

 Score = 79.3 bits (194), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 65/205 (31%), Positives = 90/205 (43%), Gaps = 15/205 (7%)

Query: 79  GGFVFGWDTGTISGFVNMTDFKRRFGNYSQSEGTYYLSNVRTGLIVAIFNIGCAFGGLTL 138
           GG +FG+DTG ISG +       +  + S+S     L+N     I +I + G   G +  
Sbjct: 49  GGLLFGYDTGVISGVL----LTLKPQDLSRS----VLTNFDKETITSITSFGSFIGSIIA 100

Query: 139 GRLGDIYGRR--LGLMCXXXXXXXXXXXXXATGDKWYQYFIGRIISGLGVGGIAVLSPTL 196
             L D  GRR  L + C              T        +GR I G  VG  A   P  
Sbjct: 101 FPLADRCGRRKTLAICCFIFIIAALWMAGSTT---LLLLVLGRFIVGCAVGVAAQCVPIY 157

Query: 197 ISETAPKHLRGTCVAFYQLMITLGIFLGYCTNYGTKTYTNSVQWRVPLGMCFAWAIFMIA 256
           +SE +P  +RG  +    L IT G  L Y   Y      +S  WR   G+    AI ++ 
Sbjct: 158 LSEISPSSIRGFILTLNSLAITGGQLLSYIAAYFLANVNHS--WRYLFGISSIPAIILML 215

Query: 257 GMLLVPESPRFLIEKGRFEEARRSI 281
            +  +PESPR+LI KG F EA +S+
Sbjct: 216 LLDFIPESPRWLISKGEFSEAHKSL 240

 Score = 59.3 bits (142), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 51/213 (23%), Positives = 90/213 (42%), Gaps = 19/213 (8%)

Query: 328 QRVIMGVMIQSLQQLTGNNYFFYYGTTIFQAVGMDDSFQTSIVLGIVNFASTFVGLWTVE 387
           + +I+G ++   QQ+TG N F YY   IF  + +++    +I++ + NF  TFV L  V+
Sbjct: 347 RALIIGCVLMFFQQITGFNAFMYYAAVIFSKLNLENPLLPAILVALTNFLFTFVALRYVD 406

Query: 388 KFGRRKCLLWGSASMASCFVVFASVGVTRLWPNGQDQPSSKGAGNCMIVXXXXXXXXXXX 447
           K G+R  LL+    M S  ++  S+G  +               N MI+           
Sbjct: 407 KIGKRLMLLYTLVVM-SIGLLLVSIGFDK---------------NNMILILISIVIFVGG 450

Query: 448 XWAPIAYV--IVSESYPLRVKNRAMAISVGSNWIWGFLIGF-FTPFITSAINFYYGYVFM 504
             + +  V     E  PL  +    +    +NW+   ++   +   + S  N     +F 
Sbjct: 451 YASALGTVPWTCVEFLPLNRRAFGSSCISCTNWLTNAIVALSYLSLMDSIGNGNTMLIFA 510

Query: 505 GCLXXXXXXXXXXXCETKGLTLEEVNEMYEEGV 537
           G              E KGL+LEE+ +++E G+
Sbjct: 511 GFTSLAWLFVYFFYPEVKGLSLEEIGKVFEHGI 543

>Kwal_27.11079
          Length = 613

 Score = 79.0 bits (193), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 120/558 (21%), Positives = 218/558 (39%), Gaps = 68/558 (12%)

Query: 22  KDSDSALQLNLQTSTPSNKASRDDF---------DLKPENEHFPEIPQ-KKLSEYILVMC 71
           +D  SAL        PS  A R D          D +  +    ++P  + L +Y     
Sbjct: 48  QDDSSALD------RPSQDAVRSDIIARFLGLSQDARLADGVEKQMPLLQALRQYPKAAL 101

Query: 72  LCLMVAFGGFVFGWDTGTISGFVNMTDFKRRFGNYSQSEGTYYLSNVRTGLIVAIFN--- 128
             ++++    + G+DT  +S    +  F RRFG+Y++  G Y +       +    N   
Sbjct: 102 WSVVLSSALIMEGYDTSLLSSLYALPAFARRFGSYNEVSGIYEVPARWQTALSMCVNVGE 161

Query: 129 -IGCAFGGLTLGRLGDIYGRRLGLMCXXXXXXXXXXXXXATGDKWYQYFIGRIISGLGVG 187
            IG  F G+    LG    RR  +               ATG        G I+ G+  G
Sbjct: 162 IIGLQFAGIAADHLG---YRRTLIASLLAVFAFIFILFFATGCP--MLAAGEILCGIPWG 216

Query: 188 GIAVLSPTLISETAPKHLRGTCVAFYQLMITLGIFL--GYCTNYGTKTYTNSVQWRVPLG 245
               L+    +E  P  LR     F  +   LG  +  G   N       + + +R+P  
Sbjct: 217 CFQTLTVAYATEVCPLALRYYLTTFVNVCWILGQIMAAGVLKNSQENLADSPLAYRIPFA 276

Query: 246 MCFAWAIFMIAGMLLVPESPRFLIEKGRFEEARRSIAK-------SNKLTVEDPGVSAEV 298
           + + W + +  G+ L PESP +L++K R  +A  S+++       + K TV    +   +
Sbjct: 277 LQWVWPLPIALGIYLAPESPWWLVKKERMADAAHSLSRLISGLPPAEKATV----IGTML 332

Query: 299 ELINAGVEAEK-LAGSATWGE-LFSSKGKILQRVIMGVMIQSLQQLTGNN---YFFYYGT 353
           + I    + E  L  +A++ + L  S G+  +       I SL  +T N        Y T
Sbjct: 333 KRIQLTTQKEDILTKNASYRDCLIGSDGRRTR-------IASLTWVTQNACGVAMMTYST 385

Query: 354 TIFQAVGMDDS--FQTSIVLGIVNFASTFVGLWTVEKFGRRKCLLWGSASMASCFVVFAS 411
             +   G+ +S  F  SI+        T +  +  + +GR +    G A      ++  +
Sbjct: 386 YFYTKAGLSESYAFTFSIIQYCFGLIGTILSWFISKHYGRYEIFARGLALQTLLLIIIGA 445

Query: 412 VGVTRLWPNGQDQPSSKG-AGNCMIVXXXXXXXXXXXXWAPIAYVIVSESYPLRVKNRAM 470
            G +       D  ++K  AG  ++V              P+ Y +V E    +++ + +
Sbjct: 446 SGFS-------DSKNAKWVAGTLLLVFVFVYDVGV----GPVTYCLVPEIPSNKLRTKTV 494

Query: 471 AISVGSNWIWGFLIGFFTPFITSAINFYYGY---VFMGCLXXXXXX-XXXXXCETKGLTL 526
            ++     I G +   +TP++ ++  + +G    +F G +             ETKG T 
Sbjct: 495 ILARNCYNIMGIVNAIWTPYMLNSDQWNWGAKTGLFWGAISLVMLIWAYYELPETKGRTF 554

Query: 527 EEVNEMYEEGVLPWKSDS 544
            E++E++ +GV   K +S
Sbjct: 555 GEIDELFSQGVPARKFES 572

>Kwal_14.1625
          Length = 506

 Score = 77.8 bits (190), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 93/422 (22%), Positives = 158/422 (37%), Gaps = 58/422 (13%)

Query: 115 LSNVRTGLIVAIFNIGCAFGGLTLGRLGDIYGRRLGLMCXXXXXXXXXXXXXATGDKWYQ 174
           LS  + GL  +IF IG   G L  G++ D YGR+                     + +  
Sbjct: 78  LSEEQMGLATSIFCIGGLVGSLYAGKVADRYGRKRYSFSNCVIGVIGSLILF-RANSYAS 136

Query: 175 YFIGRIISGLGVGGIAVLSPTLISETAPKHLRGTCVAFYQLMITLGIFLGYCTNYGTKTY 234
             IGR+I G+  G   V++P  I+E +PK LRG+  +  Q+ I +GI L   T      Y
Sbjct: 137 LLIGRLIVGISCGSCIVVTPLFINEISPKELRGSLGSMNQVCINIGILL---TQLLALRY 193

Query: 235 TNSVQWRVPLGMCFAWAIFMIAGMLLVPESPRFLIEKGRFEEAR---------------- 278
            +S +WR  +      A+     +  + ESP +L  +G  + A                 
Sbjct: 194 ADSYRWRWLMLAGAGLALIQFLLLFAIEESPLWLASRGDLDGAENVLSILRGGDRRRSRG 253

Query: 279 ------------RSIAKSNKLTVEDPGVSAEVELINAGVEA---EKLAGSATWGELFSSK 323
                       R    S   T  +   S +  L  + ++A     ++ S  + +   SK
Sbjct: 254 EVEEWLQTRGSSRPGTSSPDSTGRESPASQQSSLPESAIDAASQSDVSVSNYFSDPRYSK 313

Query: 324 GK-ILQRVIMGVMIQSLQQLTGNNYFFYYGTTIFQAVGMDDSFQTSIVLGIVNFASTFVG 382
            +  +  ++MG      QQ  G     +YG  +        +   +  + I+N   T   
Sbjct: 314 SRWAVTAILMG------QQFVGIGSIIFYGVKLISGQLPQYAVLVNFAISILNVVVTLGA 367

Query: 383 LWTVEKFGRRKCLLWGSASMASCFVVFASVGVTRLWPNGQDQPSSKGAGNCMIVXXXXXX 442
              V+ +GR+  L++ SA   S   VF S G+            S  A   ++       
Sbjct: 368 SVLVDHWGRKPLLVF-SAGAISIASVFVSAGIVM----------SNAA--MLVTSTFMFV 414

Query: 443 XXXXXXWAPIAYVIVSESYPLRVKNRAMAISVGSNWIWGFLIGFFTPFITSAINFYYGYV 502
                   PI +++++E  P      A +     NWI   ++G+  P +     F+ GY 
Sbjct: 415 AVFAMGLGPIPFLVIAELSPPEASGIAQSYGTACNWIGNSIVGYGFPIMN---EFFGGYA 471

Query: 503 FM 504
           F+
Sbjct: 472 FL 473

>CAGL0K12716g complement(1260169..1261623) similar to sp|P43562
           Saccharomyces cerevisiae YFL040w, hypothetical start
          Length = 484

 Score = 75.1 bits (183), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 89/427 (20%), Positives = 169/427 (39%), Gaps = 32/427 (7%)

Query: 80  GFVFGWDTGTISGFVNMTDFKRRFGNYSQSE-GTYYLSNVRTGLIVAIFNIGCAFGGLTL 138
           G++ G D  ++  F+N  +F   FG  +  E G    +N   GLI +IF +  A      
Sbjct: 18  GYLMGMDLSSLGVFLNGDEFLSYFGTPTPIEQGLLMGANPLGGLIGSIFYVSLA------ 71

Query: 139 GRLGDIYGRRLGLMCXXXXXXXXXXXXXATGDKWYQYFIGRIISGLGVGGIAVLSPTLIS 198
                +Y  RL  +                  + +   + R + G+ +G +++     I+
Sbjct: 72  KNCARLYSFRLSTIIWLIGCFIGIFVL-----EIWMIAVARFLKGITIGMLSIHITNYIN 126

Query: 199 ETAPKHLRGTCVAFYQLMITLGIFLGYCTNYGTKTYTNSVQWRVPLGMCFAWAIFMIAGM 258
           E  P ++RG  +AF Q+  T  IF  +    G  T+ +   +R+  G+ F  A+ +I   
Sbjct: 127 EVFPSNIRGRTLAFVQVGYTFSIFSMHYYCVGLNTFKSHYAFRLAWGLEFIPAVAVIIAT 186

Query: 259 LLVPESPRFLIEKGRFEEARRSIAKSNKLTVEDPGVSAEV-ELINAGVEAEKLAGSATWG 317
             +PESP +L+     + +++      K   +     A++ + I+   E E  +      
Sbjct: 187 FWIPESPVYLLRNTIPQISQKVDVMKVKHDSDSENDPADISDNIDDIFEFECTSRILCIR 246

Query: 318 ELFSSKGKILQRVIMGVMIQSLQQLTGNNYFFYYGTTIFQAVGMDDS--FQTSIVLGIVN 375
           E+   K +   R++MG ++Q L Q TG N   YY T I +  G+ +      S V   +N
Sbjct: 247 EILKLKTR--NRLLMGTILQVLVQFTGINVILYYITYICEMAGLKEETKLLVSAVPYFIN 304

Query: 376 FASTFVGLWTVEKFGRRKCLLWGSASMASCFVVFASVGVTRLWPNGQDQPSSKG------ 429
              +   L  ++   R+   + GSA +++  +  A +  T     G +    KG      
Sbjct: 305 AVLSCFPLLYLDVVPRKLMTVIGSALLSTIMIAIAILMST----TGHEIEPIKGNKSLIW 360

Query: 430 -----AGNCMIVXXXXXXXXXXXXWAPIAYVIVSESYPLRVKNRAMAISVGSNWIWGFLI 484
                 G  ++              A + ++   E  P+  + + + I +   W+  F I
Sbjct: 361 IVPKVPGLFILCLCFLFVGIYALSIACVPWIYTCELLPVSARAKGLPICMAIGWLMNFCI 420

Query: 485 GFFTPFI 491
               P +
Sbjct: 421 TMTGPLL 427

>Sklu_2080.4 YBR241C, Contig c2080 4658-6229
          Length = 523

 Score = 75.1 bits (183), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 84/430 (19%), Positives = 162/430 (37%), Gaps = 80/430 (18%)

Query: 115 LSNVRTGLIVAIFNIGCAFGGLTLGRLGDIYGRR--------LGLMCXXXXXXXXXXXXX 166
           L + + GL+ +IF++G   G L  G L D YGR+        LG++              
Sbjct: 80  LDDQQIGLVTSIFSLGGLAGSLYAGNLADKYGRKRVSFFNSTLGILGSLLLF-------- 131

Query: 167 ATGDKWYQYFIGRIISGLGVGGIAVLSPTLISETAPKHLRGTCVAFYQLMITLGIFLGYC 226
              + +     GR  +G+  G   V++P LI+E +P   +G   +  Q+ I +GI +   
Sbjct: 132 -RSNSYGSLLFGRFTAGVSCGSSIVITPLLINEISPHEWKGALGSMNQVSINIGILV--- 187

Query: 227 TNYGTKTYTNSVQWRVPLGMCFAWAIFMIAGMLLVPESPRFLIEKGRFEEAR-------- 278
           T      + +S +WR  L      A+     + ++ ESP++L+ +G  ++A         
Sbjct: 188 TQLLALRWADSFRWRWLLFFGAILALLNFLLLFVIDESPKWLLSRGEVDQAESILHGLRG 247

Query: 279 -------------------------------RSIAKSNKLTVEDPGVSAEVELINAGVEA 307
                                          R   ++ K +   P     +   N+ +  
Sbjct: 248 GHRQHSRDEINEWLTLRGDRSRSQQQTPSQTRDSLRTIKPSHVSPPTYDPLPSANSTIST 307

Query: 308 EKLAGS--ATWGELFSSKGKILQRVIMGVMIQSLQQLTGNNYFFYYGTTIFQAVGMDDSF 365
           E+ +    + W  + S K    +R I  +++   QQ  G N   +YG  +   +  D + 
Sbjct: 308 EQSSEEEMSLWQYITSPKYTKSRRAITAILMG--QQFCGINSIIFYGVKVISDLLPDQAI 365

Query: 366 QTSIVLGIVNFASTFVGLWTVEKFGRRKCLLWGSASM--ASCFVVFASVGVTRLWPNGQD 423
             +  + I+N   TF     V+ +GR+  L+  + SM  AS  + +  +    +      
Sbjct: 366 LANFGISILNVVVTFGASPLVDHWGRKPLLITSATSMSLASSLISYGILTSNAV------ 419

Query: 424 QPSSKGAGNCMIVXXXXXXXXXXXXWAPIAYVIVSESYPLRVKNRAMAISVGSNWIWGFL 483
                     ++               PI ++++ E  P+    +A +     NW+  F+
Sbjct: 420 ---------LLVAFTFVYIGVFAVGLGPIPFLVIPELSPVEAVGKAQSYGTTCNWLATFI 470

Query: 484 IGFFTPFITS 493
           IG+  P + S
Sbjct: 471 IGYGFPILNS 480

>Scas_597.5
          Length = 489

 Score = 74.7 bits (182), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 90/401 (22%), Positives = 164/401 (40%), Gaps = 34/401 (8%)

Query: 115 LSNVRTGLIVAIFNIGCAFGGLTLGRLGDIYGRRLGLMCXXXXXXXXXXXXXATGDKWYQ 174
           +++ + G I A F+IG   G    G+L + YGR+  +                  +    
Sbjct: 79  MTDQQLGAITASFSIGGLVGSFVAGKLAEKYGRKY-VSVVNCLIAFLGSFIMFFSNSVLP 137

Query: 175 YFIGRIISGLGVGGIAVLSPTLISETAPKHLRGTCVAFYQLMITLGIFLGYCTNYGTKTY 234
             +GR I G+  G   V++   I++ AP   RG+     QL I LGI L           
Sbjct: 138 MILGRTIVGIAAGVSVVVTSLFINDVAPVDWRGSLGTMNQLSINLGILLTQFAGLKFVRN 197

Query: 235 TNSVQWRVPLGMCFAWAIFMIAGMLLVPESPRFLIEKGRFEEARRSIAKSNKLTVEDPGV 294
            +  +WR  + +    AI  +   + V ESPR+L+ +G    A +++      + +D  V
Sbjct: 198 EDDGKWRWVMFIGMVLAILNLVLWIRVAESPRWLLAQGDVIGAEKALFLLRIGSYQD--V 255

Query: 295 SAEVE--------LINAGVEAEKLAGSATWGELFS-SKGKILQRVIMGVMIQSLQQLTGN 345
             EV+          N   EA +     +  E F  S+ K  +  I  +++   QQ  G 
Sbjct: 256 KQEVQTWKNENNNSSNNDTEANQSTRDISLKEYFKESQFKKARTAITAILVG--QQFCGI 313

Query: 346 NYFFYYGTTIFQAVGMDDSFQTSIVLGIVNFASTFVGLWTVEKFGRRKCLLWGSASMASC 405
           N   +YG  +   +    +   ++ + ++N   TFV    ++KFGR+  L+  ++ MA  
Sbjct: 314 NSIIFYGVKVISQLLPQHAVLINLGISLLNVIFTFVSSTIIDKFGRKPLLITSTSIMAFS 373

Query: 406 FVVFASVGVTRLWPNGQDQPSSKGAGNCMIVXXXXXXXXXXXXWAPIAYVIVSESYPLRV 465
             + +   V +                 ++               PI ++I+ E      
Sbjct: 374 SFIISISIVGKF-------------PIILVSSTYLYIVAFALGVGPIPFLIIGELS--NK 418

Query: 466 KNRAMAISVGS--NWIWGFLIGFFTPFITSAINFYYGYVFM 504
            ++A+A S G+  NWI  F++G+    ++   N++ GYV+M
Sbjct: 419 DDKAVAQSYGTVCNWIATFVVGYTFAVLS---NWFSGYVYM 456

>KLLA0C19481g 1747623..1748795 similar to ca|CA3241|IPF7493 Candida
           albicans putative permease (by homology), hypothetical
           start
          Length = 390

 Score = 73.6 bits (179), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 78/334 (23%), Positives = 139/334 (41%), Gaps = 19/334 (5%)

Query: 223 LGYCTNYGTKTY---TNSVQWRVPLGMCFAWA-IFMIAGMLLVPESPRFLIEKGRFEEAR 278
           L Y  NYGT  +   T+ +QW  P  +    A + ++   +   ESPR+L++ G+ ++A 
Sbjct: 2   LAYFANYGTALHVSNTSRLQWVAPTSIKIVLAGLILVGSFIWCIESPRWLMKMGKDDKAI 61

Query: 279 RSIAKSNKLTVEDPGVSAEVELINAGVEAEKLAGSAT-----WGELFSSKGKILQRVIMG 333
            ++AK   L+   P ++ EV  I   +  EK   S T       E+   K    +  ++ 
Sbjct: 62  INLAKLRNLSETHPFIAGEVADIRYQIIQEKETMSGTGYLDMVKEIIFVKSVRYRFFVIA 121

Query: 334 VMIQSLQQLTGNNYFFYYGTTIFQAVGMD--DSFQTSIVLGIVNFASTFV-GLWTVEKFG 390
            ++Q L Q +G N    Y   +   VG+   D  + + VLG+V F S ++   + ++  G
Sbjct: 122 CLVQILGQWSGANAITIYAPELLSLVGVKGVDKLKMTAVLGVVKFVSAYISAFFFIDFLG 181

Query: 391 RRKCLLWGSASMASCFVVFASVGVTRLWPNGQDQPSSKG---AGNCMIVXXXXXXXXXXX 447
           R+K    G +      + FA            D   +K    A    I            
Sbjct: 182 RKKAAYIGISIQLLTLLYFALFLTIVPQATESDAILTKSQFHASQAAIAALFLSGTGWTM 241

Query: 448 XWAPIAYVIVSESYPLRVKNRAMAISVGSNWIWGFLIGFFTP-FITSAINFYYGYVFMGC 506
            +  I Y++ +E +P+++++ A +  +  ++   F      P  + S  NF   Y F+G 
Sbjct: 242 GFNSIQYLLSAEVFPIKIRSFAQSCIMLLHFSNQFGNSKAVPKMLLSMNNFGAFYFFVGV 301

Query: 507 LXXXXXXXXXXXCETKGLTLEEVNEMYEEGVLPW 540
           L            E  G +LE + E++    LPW
Sbjct: 302 LFISLLWVHFFVPEITGRSLESMEELFS---LPW 332

>YGR289C (MAL11) [2234] chr7 complement(1073968..1075818) Maltose
           permease, a general alpha-glucoside permease, member of
           the hexose transporter family of the major facilitator
           superfamily (MFS) [1851 bp, 616 aa]
          Length = 616

 Score = 71.6 bits (174), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 91/407 (22%), Positives = 169/407 (41%), Gaps = 32/407 (7%)

Query: 15  SGKVGASKDSDSALQLNLQTSTPSNKASRDDFDLKPENEHFPEIPQKKLSEYILVMCLCL 74
           S ++G S + +  +   +  +  +N+A+ ++  +           ++ L +Y       +
Sbjct: 61  SAQLGDSDEDNENVINEMNATDDANEANSEEKSMTL---------KQALLKYPKAALWSI 111

Query: 75  MVAFGGFVFGWDTGTISGFVNMTDFKRRFGNYSQSEGTYYL-SNVRTGLIVAIF---NIG 130
           +V+    + G+DT  +S    +  F+R+FG  +  EG+Y + S  + GL + +     IG
Sbjct: 112 LVSTTLVMEGYDTALLSALYALPVFQRKFGTLN-GEGSYEITSQWQIGLNMCVLCGEMIG 170

Query: 131 CAFGGLTLGRLGDIYG--RRLGLMCXXXXXXXXXXXXXATGDKWYQYFIGRIISGLGVGG 188
                  +  +G+ Y     LGL+                        +G+I+S +  G 
Sbjct: 171 LQITTYMVEFMGNRYTMITALGLLTAYIFILYYCKSLAMIA-------VGQILSAIPWGC 223

Query: 189 IAVLSPTLISETAPKHLRGTCVAFYQLMITLG-IFL-GYCTNYGTKTYTNSVQWRVPLGM 246
              L+ T  SE  P  LR    ++  +    G IF  G   N       + + +++P  +
Sbjct: 224 FQSLAVTYASEVCPLALRYYMTSYSNICWLFGQIFASGIMKNSQENLGNSDLGYKLPFAL 283

Query: 247 CFAWAIFMIAGMLLVPESPRFLIEKGRFEEARRSIAK--SNKLTVEDPGVSAEVELINAG 304
            + W   ++ G+   PESP +L+ K R  EAR+S+++  S K   +D  V   ++ I   
Sbjct: 284 QWIWPAPLMIGIFFAPESPWWLVRKDRVAEARKSLSRILSGKGAEKDIQVDLTLKQIELT 343

Query: 305 VEAEKLAGSATWGELFSS-KGKILQRVIMGVMIQSLQQLTGNNYFFYYGTTIFQAVGM-- 361
           +E E+L  S + G  F+  KG   +R  +  +    Q  +G      Y T  F+  GM  
Sbjct: 344 IEKERLLASKS-GSFFNCFKGVNGRRTRLACLTWVAQNSSG-AVLLGYSTYFFERAGMAT 401

Query: 362 DDSFQTSIVLGIVNFASTFVGLWTVEKFGRRKCLLWGSASMASCFVV 408
           D +F  S++   +  A T        + GR   L +G A    C  +
Sbjct: 402 DKAFTFSLIQYCLGLAGTLCSWVISGRVGRWTILTYGLAFQMVCLFI 448

>Scas_652.12
          Length = 478

 Score = 67.8 bits (164), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 106/480 (22%), Positives = 185/480 (38%), Gaps = 75/480 (15%)

Query: 61  KKLSEYILVMCLCLMVAFGGFVFGWDTGTI---SGFVNMTDFKRRFGNYSQSE------- 110
           K L   ILV CL      G   FG+  G +   S  ++ ++FK    +    E       
Sbjct: 6   KNLVASILVACL------GAIQFGYHLGIMNVPSQVLSCSEFKVPNEDVPYVETWLGKSG 59

Query: 111 --GTYYLSNVRTGLIVAIFNIGCAFGGLTLGRLGDIYGRRLGLMCXXXXXXXXXXXXXAT 168
                 L + + G+  AIF +G   G   +G + ++YGRR+ +                +
Sbjct: 60  FKQCIPLDDEQIGITNAIFCLGGIVGSFFVGTICNMYGRRI-ISLFNCLLSLIGALIIFS 118

Query: 169 GDKWYQYFIGRIISGLGVGGIAVLSPTLISETAPKHLRGTCVAFYQLMITLGIFLGYCTN 228
           G+ +     GR+++G+  G   ++ P  I E  P H +G      Q+MI +GI L   T 
Sbjct: 119 GNSFSTLLWGRLLTGVACGATLIVGPLFIKEVTPPHWKGFLNVTNQVMIKVGILL---TQ 175

Query: 229 YGTKTYTNSVQWRVPLGMCFAWAIFMIAGMLL---VPESPRFLIEKGR------------ 273
                  +S +WR    + F  AI  +  ++L   + +SP++L  +G             
Sbjct: 176 LIGIVLNDSYRWR---WIFFCGAIAALVNLVLWLEIDDSPKWLFSRGDTLGAEMALFNLR 232

Query: 274 ---FEEARRSIAKSNKLTVEDPGVSAEVELINAGVEAEKLAGSATW----GELFSSKGKI 326
              ++EA+  +    +  VE     A VE    G     +  S+ W     EL+    +I
Sbjct: 233 GGLYQEAQEEVQTWQR-EVEQQNSLANVE--PMGEYNVMMGPSSFWQYIHKELYWRPRQI 289

Query: 327 LQRVIMGVMIQSLQQLTGNNYFFYYGTTIFQAVGMDDSFQTSIVLGIVNFASTFVGLWTV 386
           +  ++MG      QQ  G +   +YG  +   V    S + + ++ +     T +    V
Sbjct: 290 ITILLMG------QQFCGISSIVFYGVKVIDQVDPKHSLEINFLIQLTTVFVTIITCIMV 343

Query: 387 EKFGRRKCLLWGSASMASCFVVFASVGVTRLWPNGQDQPSSKGAGNCMIVXXXXXXXXXX 446
               R+  LL  S+ +        ++G+ R              G  + V          
Sbjct: 344 PVMNRKPLLL-ISSVLVVVSSFLLTIGINR------------NDGTLLAVAVFIYIIGFA 390

Query: 447 XXWAPIAYVIVSE-SYPLRVKNRAMAISVGS--NWIWGFLIGFFTPFITSAINFYYGYVF 503
               P+ Y+I+ E S P    ++ MA   G+  NW    +IG+  P +   +N Y  +VF
Sbjct: 391 IGLGPLPYLIMKEISTP---PDQKMAQKYGTVCNWTATMIIGYIFPLLFDIMNGYAYFVF 447

>Kwal_27.11385
          Length = 222

 Score = 47.8 bits (112), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 51/216 (23%), Positives = 97/216 (44%), Gaps = 33/216 (15%)

Query: 335 MIQSLQQLTGNNYFFYYGTTIFQAVGMDDSFQTSIVLGIVNFASTFVG-----LWTVEKF 389
           M+ SL QLTG N   YY +T+   +G     + S+ + +V  A+  +G     LW +++F
Sbjct: 1   MMVSLGQLTGINAIMYYMSTLMGRIGFSK--KRSVAMSMVGGAALLIGTIPAILW-MDRF 57

Query: 390 GRRKCLLWGSASMASCFVVFA----SVGVTRLWPNGQDQPSSKGAGNCMIVXXXXXXXXX 445
           GRR    W     A+  V+F+     VGV  L P   + P+++G    + +         
Sbjct: 58  GRRA---W-----ANTIVLFSLGLVLVGVGYLIPLKSNLPAAEG----VYLTGQILYNMA 105

Query: 446 XXXWAPIAYVIVSESYPLRVKNRAMAISVGSNWIWGFLIGFFTPFITSAINF------YY 499
              ++ + +V+ SES+ L  ++  M       ++W F + +    +  A+ +      +Y
Sbjct: 106 FGSYSALTWVLPSESFSLATRSVGMTCCSTMLYLWSFTVTYNFDRMQKAMTYTGLTLGFY 165

Query: 500 GYVFMGCLXXXXXXXXXXXCETKGLTLEEVNEMYEE 535
           G +    +            ETK  TLEE+++++ +
Sbjct: 166 GGL---AIVIGLPYQLLFMPETKNRTLEEIDDIFSK 198

>KLLA0C19459g 1746987..1747436 some similarities with
           ca|CA3241|IPF7493 Candida albicans putative permease (by
           homology), hypothetical start
          Length = 149

 Score = 40.0 bits (92), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 34/127 (26%), Positives = 58/127 (45%), Gaps = 13/127 (10%)

Query: 22  KDSDSALQLNLQTSTPSNKASRDDFDLKP-ENEHFPEIPQKKLSEYILVMCLCLMVAFGG 80
           +D D A Q+     TP   A +  F  +  +NE  PE+    L   IL+  +       G
Sbjct: 25  QDDDQASQI-----TPKIAAEKKKFRWRVVDNESPPEVYNWTLYMSILIFGIL------G 73

Query: 81  FVFGWDTGTISGFVNMTDFKRRFGNYSQSEGTYYLSNVRTGLIVAIFNIGCAFGGLTLGR 140
              G+D G +SG V    F+ +FG   +++   YL+N+++  I ++  +G   G L    
Sbjct: 74  AARGYDEGNVSGSVAQVSFQNQFGLADKTKSASYLANLKSN-ITSMVQLGSIGGTLIAMY 132

Query: 141 LGDIYGR 147
             + +GR
Sbjct: 133 TVEKFGR 139

>CAGL0B02475g 236029..237771 highly similar to sp|P25297
           Saccharomyces cerevisiae YML123c PHO84, start by
           similarity
          Length = 580

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 92/389 (23%), Positives = 146/389 (37%), Gaps = 77/389 (19%)

Query: 83  FGWD---TGTISGFVNMTDFKRRFG-NYSQSEGTYY-----LSNVRTGLIVAIFNIGCAF 133
           FGWD   T  I+G   +TD    F  N S S  +Y      + N    L+    ++G   
Sbjct: 59  FGWDQVRTILIAGVGFLTDSYDIFAINLSISMMSYVFWQGNMPNSTQTLLKVSTSVGTVI 118

Query: 134 GGLTLGRLGDIYGRR----LGLMCXXXXXXXXXXXXXATGDKWYQYF-IGRIISGLGVGG 188
           G L  G + DI GR+    L L+              + G  +       RI+ G+G+GG
Sbjct: 119 GQLGFGTMADIVGRKKIYGLELIVMIATTILQTTIGRSPGINFPAVLTFYRIVMGIGIGG 178

Query: 189 IAVLSPTLISETAPKHLRGTCV-------AFYQLMITLGIFLGYCTNYGTKTYTNS---- 237
              LS  + SE A    RG  +       A+ Q+   L   +      G   Y NS    
Sbjct: 179 DYPLSSIITSEFATTKWRGAIMGAVFANQAWGQIAGGLVALIVIRAYKGDLIYANSGAEC 238

Query: 238 ---------VQWRVPLGMCFAWAIFMIAGMLLVPESPRFLIEKGRFEEARRSIAK----S 284
                      WR+ +G      I  +   L +PESPR+ ++     +   +I K    +
Sbjct: 239 DYACQKACDQMWRILIGFGAVPGIIGLYFRLTIPESPRYALDVKEEVDLPSNIEKVRATA 298

Query: 285 NKLTVEDPGVSAEVELINAGVEAEKLAGSATWGELFSSKGK-ILQRVIMGVMIQSLQQLT 343
           +   +ED   S+ V      V   K    A+W +  S  GK    ++++G         T
Sbjct: 299 DDEHLEDLERSSTVVEDGIVVPPPK---KASWKDFRSHFGKWKYGKILLG---------T 346

Query: 344 GNNYFF----YYGTT-----IFQAVG----------MDDSFQTSIVLGIVNFASTFVGLW 384
             ++F     +YG +     I Q +G          +DDS   +++L     A +  G W
Sbjct: 347 AGSWFVLDVAFYGLSLNTAIILQTIGYAGSKNVYHKLDDSAVGNLIL---ICAGSLPGYW 403

Query: 385 ----TVEKFGRRKCLLWGSASMASCFVVF 409
               TV+  GR+   + G   + + F V 
Sbjct: 404 ATVFTVDTIGRKPIQMMGFIILTALFCVI 432

>CAGL0M06281g 651932..653560 similar to sp|P38125 Saccharomyces
           cerevisiae YBR180w DTR1, hypothetical start
          Length = 542

 Score = 40.4 bits (93), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 58/263 (22%), Positives = 101/263 (38%), Gaps = 24/263 (9%)

Query: 18  VGASKDSDSALQLNLQTSTPSNKASRDDFDLKPENE-------HFPEIPQKKLSEYILVM 70
           V A+ D+   +   +  S P N    D F+L+ +         +  +IP    + +  V 
Sbjct: 22  VQATDDNADKILQEVDLSDP-NIDKNDTFELRQQVSIKESPLYYLRDIPYSAYTSF-QVS 79

Query: 71  CLCLMVAFGGFVFGWDTGTISGFVNMTDFKRRFGNYSQSEGTYYLSNVRTGLIVAIFNIG 130
            + L+V + GF+     G ++G V +         ++ SE T    N    + +A F+I 
Sbjct: 80  LIFLIVIYNGFL-----GPLAGNVFIPALPLLQKEFNVSETTI---NATVSVFMATFSIS 131

Query: 131 CAFGGLTLGRLGDIYGRRLGLMCXXXXXXXXXXXXXATGDKWYQYFIGRIISGLGVGGIA 190
             F G     L D  GR++  +              +   K       RII       + 
Sbjct: 132 PLFWG----ALADKGGRKILYIISISLMVIINILLASVPKKIGSLIFLRIIQAFASSSVI 187

Query: 191 VLSPTLISETAPKHLRGTCVAFYQLMITLGIFLGYCTNYGTKTYTNSVQWRVPLG-MCFA 249
            L    +++  P   RG  +A++ L   LG  L      G     N+  WR   G +C  
Sbjct: 188 SLGAGTVADLTPPKDRGKAMAYFMLGPNLGPILAPIIA-GLILLDNN-NWRWLFGFLCIV 245

Query: 250 WAIFMIAGMLLVPESPRFLIEKG 272
             + +I  +LL+PE+ R ++  G
Sbjct: 246 SGLGLIMVILLLPETLRCIVGNG 268

>Scas_626.1
          Length = 570

 Score = 38.5 bits (88), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 104/495 (21%), Positives = 165/495 (33%), Gaps = 126/495 (25%)

Query: 128 NIGCAFGGLTLGRLGDIYGRRLGLMCXXXXXXXXXXXXXATGDKWYQYFIG-----RIIS 182
           ++G   G +  G + DI GR+                   TG+     F+      RI+ 
Sbjct: 98  SVGTVIGQVGFGTIADIVGRKKIYGLELIIMIVMSVLQTTTGESRAINFVAVLTFYRIVM 157

Query: 183 GLGVGGIAVLSPTLISETAPKHLRG----------------------TCVAFYQLMITLG 220
           G+G+GG   LS  + SE A    RG                       CVA Y+  +   
Sbjct: 158 GIGIGGDYPLSSIITSEFATTKWRGAIMGAVFANQAWGQIAAGIVALVCVAAYKDQLIGA 217

Query: 221 IFLGYCTNYGTKTYTNSVQWRVPLGMCFAWAIFMIAGM---LLVPESPRFLIEKGRFEEA 277
                C     K       WR+ +G+    A+  +AG+   L +PESPR+ ++       
Sbjct: 218 ETAEMCGPDCMKACDQ--MWRILVGL---GAVPGLAGLYFRLTIPESPRYTLD------- 265

Query: 278 RRSIAKSNKLTVEDPGVSAEVELINAGVEAEKLAGSATWGELFSSKGKILQRVIMGVMIQ 337
                              E     A  + EK   S+T  E  SS   I       +M+Q
Sbjct: 266 ------------------VETNAAQASEDIEKFVTSSTLLEKNSSHSHISPNSQETLMVQ 307

Query: 338 ----SLQQLTGNNYFFYYGTTIFQAVG---MDD------SFQTSIVLGIVNFAST----- 379
               S +    +   + YG  +    G   M D      S  T+++L  + +A +     
Sbjct: 308 PPKASFKDFCRHFGQWRYGKILLGTAGSWFMLDVAFYGLSLNTAVILQAIGYAGSENVYK 367

Query: 380 ---------------------FVGLWTVEKFGRRKCLLWGSASMASCFVVFASVGVTRLW 418
                                +V ++TV+  GR+   L+G   +    V+F  +G     
Sbjct: 368 KLYNSAVGNLILICAGSLPGYWVSVFTVDTIGRKPIQLFGFFILT---VLFCIIGF---- 420

Query: 419 PNGQDQPSSKGAGNCMIVXXXXXXXXXXXXWAP--IAYVIVSESYPLRVKNRAMAISVGS 476
               D+ S KG     IV            + P    +++  E +P R ++ A  IS  S
Sbjct: 421 --AYDKLSDKGLLGLYIV------CQFFQNFGPNVTTFIVPGECFPTRYRSTAHGISAAS 472

Query: 477 NWI--------WGFLIGFFTPFITSAINFYYGYV--FMGCLXXXXXXXXXXXCETKGLTL 526
             I         G LI           N +  +V                   ETK +TL
Sbjct: 473 GKIGAIIAQTALGTLINHNCARDGKKANCWLPHVMEIFALFMLLGIFLTLLIPETKRMTL 532

Query: 527 EEVNEMYEEGVLPWK 541
           E+++E Y + V P K
Sbjct: 533 EDISEKYHDEVDPSK 547

>YPR156C (TPO3) [5571] chr16 complement(837903..839771) Polyamine
           transport protein, member of the multidrug-resistance
           12-spanner (DHA12) family of the major facilitator
           superfamily (MFS-MDR) [1869 bp, 622 aa]
          Length = 622

 Score = 37.7 bits (86), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 61/303 (20%), Positives = 107/303 (35%), Gaps = 36/303 (11%)

Query: 2   STSVTPIDNRSVASGKVGASKDSDSALQLNLQTSTPSNKASRDDF--DLKPENEHF---- 55
           ST+++    R +  G    S + D+    N +     + +  +D   DL PE E      
Sbjct: 106 STAISRTRTRQI-DGASSPSSNEDALESDNNEKGKEGDSSGANDEAPDLDPEIEFVTFVT 164

Query: 56  --PEIPQK-----KLSEYILVMCLCLMVAFGGFVFGWDTGTISGFVNMTDFKRRFGNYSQ 108
             PE P       + S  +L+  L + VA+G        GT+                  
Sbjct: 165 GDPENPHNWPAWIRWSYTVLLSILVICVAYGSACISGGLGTV------------------ 206

Query: 109 SEGTYYLSNVRTGLIVAIFNIGCAFGGLTLGRLGDIYGRRLGLMCXXXXXXXXXXXXXAT 168
            E  Y++      L V++  IG + G L    + D+YGRR+                 A 
Sbjct: 207 -EKKYHVGMEAAILSVSLMVIGFSLGPLIWSPVSDLYGRRVAYFV-SMGLYVIFNIPCAL 264

Query: 169 GDKWYQYFIGRIISGLGVGGIAVLSPTLISETAPKHLRGTCVAFYQLMITLGIFLGYCTN 228
                     R + G+       L    I++  P   RG  +AF+     +G  +G   N
Sbjct: 265 APNLGSLLACRFLCGVWSSSGLCLVGGSIADMFPSETRGKAIAFFAFAPYVGPVVGPLVN 324

Query: 229 YGTKTYTNSVQWRVPLGMCFAWAIFMIAGMLLVPESPRFLIEKGRFEEARRSIAKSNKLT 288
                 T  +     + M FA  +++I+    +PE+   +I K +    R+       +T
Sbjct: 325 GFISVSTGRMDLIFWVNMAFAGVMWIISSA--IPETYAPVILKRKAARLRKETGNPKIMT 382

Query: 289 VED 291
            ++
Sbjct: 383 EQE 385

>Sklu_1959.3 , Contig c1959 3851-5446 reverse complement
          Length = 531

 Score = 37.7 bits (86), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 36/158 (22%), Positives = 52/158 (32%), Gaps = 9/158 (5%)

Query: 134 GGLTLGRLGDIYGRRLGLMCXXXXXXXXXXXXXATGDKWYQYFIGRIISGLGVGGIAVLS 193
           G +  G +GD YGR++  +                   +  + I R   G+ +GGI   S
Sbjct: 126 GAVLFGYIGDRYGRKVSFIINLFFMMVLEIITGFIKHNFKYFLIARAFFGVVLGGIFGNS 185

Query: 194 PTLISETAPKHLRGTCVAFYQLMITLGIFLGYCTNYGTKTYTNSVQWRVPLGMCFAWAIF 253
                +  P         F+Q   TLG  L           T   +WR            
Sbjct: 186 AAQCFDDCPPEAHSFISGFFQQGYTLGYLLAVIFTRALADTTKD-RWRSCFWFAAGITFL 244

Query: 254 MIAGMLLVPESPRFLIEKGRFEEARRSIAKSNKLTVED 291
           +I    L+PE+  FL         R+ I    KL  ED
Sbjct: 245 LIIFRALLPETNAFL--------ERQRIKAEKKLNNED 274

>YDL199C (YDL199C) [675] chr4 complement(101291..103354) Member of
           the hexose transporter family of the major facilitator
           superfamily (MFS) [2064 bp, 687 aa]
          Length = 687

 Score = 37.0 bits (84), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 103/513 (20%), Positives = 191/513 (37%), Gaps = 59/513 (11%)

Query: 9   DNRSVASGKVGA-SKDSDSALQLNLQTSTPSNKASRDDFDLKPENEHF--PEIPQ----- 60
           +N +  S + G+  +DSD+ + L L   TP  + S DD    P  +     EI Q     
Sbjct: 58  NNITAHSSRRGSLYRDSDATVVLPLSEHTP--RLSMDD----PYRQLLQQAEISQLRSKK 111

Query: 61  KKLSEYILVMCLCLMVAFGGFVFGWDTGTISGFVNMTDFKRRFGNYSQSEGTYYLSNVRT 120
           K+ S  +L       V     + G D G ISG V    F++ F         +Y      
Sbjct: 112 KRHSSRVLRTSFISFVVLVSSLSGLDQGLISGNVMTLSFQKYF---------HYPLTSPL 162

Query: 121 GLIVAIFNIGCAFGGL-TLGRLGDIYGRRLGLMCXXXXXXXXXXXXXATGDKWYQYFIGR 179
           G IV+I N+G     L     + +   R+  L                  ++W    +GR
Sbjct: 163 GNIVSIVNLGAFMASLFVYSGILEPCSRKKMLQISTMIYSLGAIVQVLALNQWC-LLLGR 221

Query: 180 IISGLGVGGIAVLSPTLISE---TAPKHLRGTCVAFYQLMITLGIFLGYCTNYGTKTYTN 236
            + G+G+G     S  +I +     P   + T ++   +   +    G   N   +    
Sbjct: 222 FLLGVGMG--FAFSMVIIYQFEFPLPCIRKRTLISIQCVSSVIAYSFGIWINCAFRYL-- 277

Query: 237 SVQWRVPLGMCFAWAIFM-IAGMLLVPESPRFLIEKGRFEEARRSIAKS-NKLTVEDPGV 294
              WR PL    A  I + +    L+ ESP +L+++    EA   I+   +    E+   
Sbjct: 278 GFAWRYPLSTHVALGIILNLMSFYLILESPSWLLKQKNDVEALVLISNVFDDGNFEENQT 337

Query: 295 SAEVELINAGV--EAEKLAGSATWGELFSSKGKILQRVIMGVMIQSLQQLTGNNYFFYYG 352
             +  ++   +  ++     S  +  +      I+ ++++G   Q L +  G + F YY 
Sbjct: 338 QLKFRVLKRDILLKSHLQKNSYPYAYILKDFSSII-KLLIG--FQLLTRTNGVDAFLYYS 394

Query: 353 TTIFQAVGMDDSFQ------TSIVLGIVNFASTFVGLWTVEKFGRRKCLLWGSASMASCF 406
             I Q +G  +          +++  IV  A  +V L  + K   +  +L GS  M  C 
Sbjct: 395 PLILQQMGRGERKSIYLTGLNALIYSIVILA--YVPL-VLRKRKEKTNVLLGSIVM--CA 449

Query: 407 VVFASVGVTRLWPNGQDQPSSKGAGNCMIVXXXXXXXXXXXXWAPIAYVIVSESYPLRVK 466
           ++F ++  T  +P        K     + +            W  I +V+  E  P   +
Sbjct: 450 LLF-TISFTDWFP--------KSTTRYISILFAVFLFTHFISWDSIGWVMTIELLPHLSQ 500

Query: 467 NRAMAISVGSNWIWGFLIGFFTPFITSAINFYY 499
              + +     WI+ + +   TP +   +++ +
Sbjct: 501 APVILLVSNFYWIFKWFVSLITPILIDRLSWKF 533

>Sklu_2304.5 , Contig c2304 8691-10388
          Length = 565

 Score = 36.2 bits (82), Expect = 0.070,   Method: Compositional matrix adjust.
 Identities = 57/253 (22%), Positives = 100/253 (39%), Gaps = 40/253 (15%)

Query: 24  SDSALQLNLQTSTPSNKASRDDFDLKPENEHFPEIPQKKLSEYILVMCLCLMVAFGGFVF 83
           SD    L +   +P+ + +  D   +    H  E+P  K+   +L + +      G F+ 
Sbjct: 2   SDETAALLVPVISPTTETALVDTGEESTTSH-SELPPTKVRITVLALLM------GSFLS 54

Query: 84  GWDTGTISGFVNMTDFKRRFGNYSQSEGTYYLSNVRTGLIVAIFNIGCAFGGLTLGRLGD 143
             DT  ++  +            S  + +  +S + T      + + C+      G+L D
Sbjct: 55  ALDTTIVATLLPTIA--------SDLDASSQMSWIATA-----YLLSCSAFQPLYGKLSD 101

Query: 144 IYGRRLGLMCXXXXXXXXXXXXXA--TGDKWYQYFIGRIISGLGVGGIAVLSPTLISETA 201
           I+GR++ L+              +  T + W     GR ++G+G GG A LS    S+  
Sbjct: 102 IFGRKILLILSNLTFALGCAICGSPWTNNVWV-LSTGRFVAGIGGGGQATLSTITTSDII 160

Query: 202 PKHLRGTCVAFYQLMITLGIFLGYCTNYGT--KTYTNSVQWR------VPLGMCFAWAIF 253
           P   RG     YQ ++ +   LG C +           + WR      VP+ +  A    
Sbjct: 161 PLRKRGV----YQGLVNICFSLG-CASGSVLGAVLQQGIGWRWAFLVQVPMALVCA---L 212

Query: 254 MIAGMLLVP-ESP 265
           MIA +L +P +SP
Sbjct: 213 MIAVVLDLPADSP 225

>Scas_660.3
          Length = 568

 Score = 36.2 bits (82), Expect = 0.071,   Method: Compositional matrix adjust.
 Identities = 28/108 (25%), Positives = 44/108 (40%), Gaps = 4/108 (3%)

Query: 139 GRLGDIYGRRLGLMCXXXXXXXXXXXXXATGDKWYQYFIGRIISGLGVGGIAVLSPTLIS 198
           G+L DI GR+  ++                     Q+ I R I G+G GG+  +S   +S
Sbjct: 96  GKLSDITGRKFAVLTSHFFFGLGCFLT-CFAQNITQFSIARAICGIGAGGVNAMSSITVS 154

Query: 199 ETAPKHLRGTCVAFYQLMITLGIFLGYCTNYGTKTYTNSVQWRVPLGM 246
           +      RG    +  ++  LG  LG         + +SV WRV  G+
Sbjct: 155 DICSTRERGIYQGYANIVFGLGQLLGAPLG---GLFIDSVGWRVIFGV 199

>Scas_692.8
          Length = 625

 Score = 35.8 bits (81), Expect = 0.089,   Method: Compositional matrix adjust.
 Identities = 57/258 (22%), Positives = 98/258 (37%), Gaps = 34/258 (13%)

Query: 74  LMVAFGGFVFGWDTGTISGFVNMTDFKRRFGNYSQSEGTYYLSNVRTGLIVAIFNIGCAF 133
           L+   G     +D   I+  + M  +    GN   S  T  L  V T       ++G   
Sbjct: 101 LIAGVGFLTDSYDIFAINLGITMMSYVHWKGNMPASTAT--LLKVST-------SVGTVI 151

Query: 134 GGLTLGRLGDIYGRRLGLMCXXXXXXXXXXXXXATGDKWYQYFIG-----RIISGLGVGG 188
           G +  G + D+ GR+                   TG      F+      RI+ G+G+GG
Sbjct: 152 GQVGFGTMADVIGRKKIYGMELILMIITTILQCTTGSSPGINFVAVLTFYRILMGIGIGG 211

Query: 189 IAVLSPTLISETAPKHLRGTCV-------AFYQLM---ITLGIFLGYCT-----NYGTKT 233
              LS  + SE +    RG  +       A+ Q++   I L +   Y +     N G + 
Sbjct: 212 DYPLSSIITSEFSTTKWRGAIMGAVFANQAWGQILGGIIALVLVAAYKSSLIDANTGAEC 271

Query: 234 YTNSVQ-----WRVPLGMCFAWAIFMIAGMLLVPESPRFLIEKGRFEEARRSIAKSNKLT 288
               ++     WR+ +G+     +  +   L +PESPR+ ++     ++      ++ + 
Sbjct: 272 GYECMKACDQMWRILIGLGAVPGVIGLYFRLTIPESPRYSLDVDADLDSIEVTKVTDNVM 331

Query: 289 VEDPGVSAEVELINAGVE 306
            E  G SA +E  N  VE
Sbjct: 332 EEKLGDSASLERANTMVE 349

>KLLA0F13684g complement(1267367..1269082) similar to sp|Q04301
           Saccharomyces cerevisiae YMR088c, start by similarity
          Length = 571

 Score = 35.8 bits (81), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 36/147 (24%), Positives = 59/147 (40%), Gaps = 12/147 (8%)

Query: 139 GRLGDIYGRRLGLMCXXXXXXXXXXXXXATGDKWYQYFIGRIISGLGVGGIAVLSPTLIS 198
           G+L D+ GR+  LM              A      ++ I R + G+G GGI+ LS   +S
Sbjct: 96  GKLSDLAGRKTALMVAHSFFLVGCLFT-ALSRNLVEFSIARAVCGMGAGGISALSSISVS 154

Query: 199 ETAPKHLRGTCVAFYQLMITLGIFLG------YCTNYGTKTYTNSVQWRVPLGMCFAWAI 252
           +      RG    +  ++   G  LG         ++G K        +VPL M   +  
Sbjct: 155 DICTPKERGVYQGYANVVFGTGSMLGGPIGGWLMDSFGWKVI---FAGQVPLIMTCMFLG 211

Query: 253 FMIAGMLLVPESPRFLIEKGRFEEARR 279
           +    + L+   PR   E+ R+E  +R
Sbjct: 212 YRNVNIKLLHVPPRH--ERYRWENIKR 236

>AFR322C [3514] [Homologous to ScYGR138C (TPO2) - SH; ScYPR156C
           (TPO3) - SH] (1017695..1019473) [1779 bp, 592 aa]
          Length = 592

 Score = 35.8 bits (81), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 39/164 (23%), Positives = 64/164 (39%), Gaps = 5/164 (3%)

Query: 129 IGCAFGGLTLGRLGDIYGRRLGLMCXXXXXXXXXXXXXATGDKWYQYFIGRIISG-LGVG 187
           +G   G L    L D+YGRR+                 A         + R I G L   
Sbjct: 198 LGYGVGQLVWAPLSDLYGRRITYF-TSLFLYVVFNIPCAVAPNIQTLLVCRFICGVLSSS 256

Query: 188 GIAVLSPTLISETAPKHLRGTCVAFYQLMITLGIFLGYCTNYGTKTYTNSVQWRVPLGMC 247
           G+ ++  +L ++  P  LRG  +AF+      G       N      T  +     + M 
Sbjct: 257 GLCLVGGSL-ADMFPADLRGLTIAFFAFAPYGGPVFAPLINGFIAVRTERLDLIFWVNMA 315

Query: 248 FAWAIFMIAGMLLVPESPRFLIEKGRFEEARRSIAKSNKLTVED 291
            A A++++    LVPE+   +I K R E+ R+     N +T ++
Sbjct: 316 LAGAVWLLVA--LVPETYAPIILKRRAEKLRKLTGNQNIMTEQE 357

>KLLA0F10043g complement(928691..930277) weakly similar to sp|P36035
           Saccharomyces cerevisiae YKL217w JEN1 carboxylic acid
           transporter protein singleton, start by similarity
          Length = 528

 Score = 35.0 bits (79), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 35/145 (24%), Positives = 54/145 (37%), Gaps = 7/145 (4%)

Query: 134 GGLTLGRLGDIYGRRLGLMCXXXXXXXXXXXXXATGDKWYQYFIG-RIISGLGVGGIAVL 192
           G L  G LGD YGR+   +                    +  F+G R I G+ +G +  +
Sbjct: 130 GALIFGYLGDRYGRKYSFVLTMALIIVIQIGTGFVNS--FSAFLGCRAIFGIIMGSVFGV 187

Query: 193 SPTLISETAPKHLRGTCVAFYQLMITLGIFLGYCTNYGTKTYTNSVQ-WRVPLGMCFAWA 251
           +     E AP   +      +Q     G  LG    +      NS   WR          
Sbjct: 188 ASATALENAPNKAKSILSGIFQEGYAFGYLLGVV--FQRAIVDNSPHGWRAIFWFSAGPP 245

Query: 252 IFMIAGMLLVPESPRFLIEKGRFEE 276
           +  IA  L++PES  + +E+ R E+
Sbjct: 246 VLFIAWRLMLPESQHY-VERVRLEK 269

>KLLA0F18106g 1657556..1659325 similar to sgd|S0003951 Saccharomyces
           cerevisiae YLL028w TPO1 polyamine transport protein,
           hypothetical start
          Length = 589

 Score = 35.0 bits (79), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 44/194 (22%), Positives = 75/194 (38%), Gaps = 31/194 (15%)

Query: 37  PSNKASRDDFDLKPENEHFPEIP-----QKKLSEYILVMCLCLMVAFGGFVFGWDTGTIS 91
           P     R  +++  +  + P  P     +KKL   I++   C+ +  G  +F     TIS
Sbjct: 116 PKALPDRAPYEVTFDGPNDPLHPFNWPLKKKLVICIMLGLDCIAITMGSSIFASAVTTIS 175

Query: 92  GFVNMTDFKRRFGNYSQSEGTYYLSNVRTGLIVAIFNIGCAFGGLTLGRLGDIYGRRLGL 151
                                Y ++NV + L + ++ +G A   +    L ++YGR+ G+
Sbjct: 176 E-------------------IYEVANVVSILGITLYVLGFAASPVIYAPLSELYGRQ-GV 215

Query: 152 MCXXXXXXXXXXXXXATGDKWYQYFIGRIISG-LGVGGIAVLSPTLISETAPKHLRGTCV 210
           +              AT +      I R   G +G   +AV+ P   S+      RGT V
Sbjct: 216 LLIASFGFALFQFAVATAENLQTILICRFFGGFIGAAPLAVV-PASFSDMFDNTQRGTAV 274

Query: 211 AFYQLMITLGIFLG 224
                M  LG+F+G
Sbjct: 275 T----MFALGVFVG 284

>Sklu_2121.1 YLL028W, Contig c2121 934-2742
          Length = 602

 Score = 34.7 bits (78), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 39/177 (22%), Positives = 66/177 (37%), Gaps = 13/177 (7%)

Query: 108 QSEGTYYLSNVRTGLIVAIFNIGCAFGGLTLGRLGDIYGRRLGLMCXXXXXXXXXXXXXA 167
           Q    Y++  V   L + +F +G A   +    L ++YGR+ G++              A
Sbjct: 187 QISAIYHVHQVVAILGITLFVLGFAASPVIYAPLSELYGRQ-GVLVISSFGFALFQFAVA 245

Query: 168 TGDKWYQYFIGRIISGLGVGGIAVLSPTLISETAPKHLRGTCVAFYQLMITLG-----IF 222
           T        I R   G        + P   S+      RGT VA + L + +G     +F
Sbjct: 246 TAKDLQTIMICRFFGGFIGAAPLAVVPAAFSDMFDNKSRGTAVALFALGVFVGPILSPVF 305

Query: 223 LGYCTNYGTKTYTNSVQWRVPLGMCFAWAIFMIAGMLLVP-ESPRFLIEKGRFEEAR 278
             Y T + T  +   V         FA  +F++  +       P  L++K +F  A+
Sbjct: 306 GSYITQHTTWRWVEYVTG------IFASVVFVLVAIFFEETHHPSILVKKAKFMRAK 356

>CAGL0I10384g 1016935..1018827 highly similar to sp|P53283
           Saccharomyces cerevisiae YGR138c, start by similarity
          Length = 630

 Score = 34.3 bits (77), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 69/317 (21%), Positives = 122/317 (38%), Gaps = 38/317 (11%)

Query: 1   MSTSVTPIDNRSVA--SGKVGASKDSDSALQLNLQTSTPSNKASRDDFDLKPENEHF--- 55
           +S S T    RSV+  S  + AS +S +  +L  +    S+ +++   +L PE E     
Sbjct: 111 ISKSRTRQIERSVSRRSQNIAASSNSSNKEELEDEEEVSSDMSNQQP-ELDPEIEFVTFV 169

Query: 56  ---PEIPQK-----KLSEYILVMCLCLMVAFGGFVFGWDTGTISGFVNMTDFKRRFGNYS 107
              P  P       + +  +++ CL + VA+G       +  I+G           G ++
Sbjct: 170 TGDPTNPHNWPLWIRWAYTVILSCLVICVAYG-------SACITG-----------GLFT 211

Query: 108 QSEGTYYLSNVRTGLIVAIFNIGCAFGGLTLGRLGDIYGRRLGLMCXXXXXXXXXXXXXA 167
             E  Y++      L  ++  IG + G L    + D+YGRRL                 A
Sbjct: 212 VQE-QYHVGLEAAILSCSLMVIGFSLGPLIWSPVSDLYGRRLAYF-ISMGLYTIFNIPCA 269

Query: 168 TGDKWYQYFIGRIISGLGVGGIAVLSPTLISETAPKHLRGTCVAFYQLMITLGIFLGYCT 227
                    + R + G+       L    I++  P   RG  +AF+      G  +G   
Sbjct: 270 LSPNLGGLLVCRFLCGVFSSSGLCLVGGSIADMFPSETRGRAIAFFAFAPYTGPIIGPLV 329

Query: 228 NYGTKTYTNSVQWRVPLGMCFAWAIFMIAGMLLVPESPRFLIEKGRFEEARRSIAKSNKL 287
           N      T  +     + M FA  +++I     +PE+   +I K R  + R+       +
Sbjct: 330 NGFVSVCTRRMDLIFWINMAFAGVMWIIVA--FIPETYAPVILKWRAAKLRKETGNPKIM 387

Query: 288 TVEDP-GVSAEVELINA 303
           T ++  GVS   E++ A
Sbjct: 388 TEQEAQGVSVN-EMMKA 403

>Kwal_26.6669
          Length = 590

 Score = 33.9 bits (76), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 32/139 (23%), Positives = 53/139 (38%), Gaps = 7/139 (5%)

Query: 122 LIVAIFNIGCAFGGLTLGRLGDIYGRRLGLMCXXXXXXXXXXXXXATGDKWYQYFIGRII 181
           L+   +   CA      G+  D++GR+  L+               +   W+   +GR++
Sbjct: 120 LVATSYVFSCAIFQPLFGKTSDVFGRKPLLISSNLLFFAGCLTCGLSKTIWW-LILGRLV 178

Query: 182 SGLGVGGIAVLSPTLISETAPKHLRGTCVAFYQLMITLGIFLGYCTNYGTKTYTNSVQWR 241
           +G+G GG+  +   +I++  P   R     F  L   LG   G         Y N   WR
Sbjct: 179 TGIGGGGLTSMCTIIINDIVPLRNRAVYQGFGNLFYALGTACGGLVGGLFSEYGNG--WR 236

Query: 242 ----VPLGMCFAWAIFMIA 256
               + L  CF   I +I 
Sbjct: 237 MAFMIQLPFCFLSTISIIV 255

>CAGL0J01375g 127843..129537 similar to sp|Q04301 Saccharomyces
           cerevisiae YMR088c, start by similarity
          Length = 564

 Score = 33.9 bits (76), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 25/108 (23%), Positives = 46/108 (42%), Gaps = 4/108 (3%)

Query: 139 GRLGDIYGRRLGLMCXXXXXXXXXXXXXATGDKWYQYFIGRIISGLGVGGIAVLSPTLIS 198
           G+L D+ GR+  ++                 +   Q+ I R I G+G GGI  +S   +S
Sbjct: 93  GKLSDLTGRKFAVLTAHFFFGLGCLLT-CFANSVTQFAIARAICGVGGGGINAMSSITVS 151

Query: 199 ETAPKHLRGTCVAFYQLMITLGIFLGYCTNYGTKTYTNSVQWRVPLGM 246
           +   +  RG    +  ++  LG  LG         + +++ WR+  G+
Sbjct: 152 DICTQRERGIYQGYANIVFGLGQILGAPIG---GLFIDTLGWRILFGL 196

>Sklu_2253.3 , Contig c2253 3254-4825 reverse complement
          Length = 523

 Score = 33.5 bits (75), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 42/154 (27%), Positives = 59/154 (38%), Gaps = 22/154 (14%)

Query: 134 GGLTLGRLGDIYGRRLG------LMCXXXXXXXXXXXXXATG-DKWYQYFIG-RIISGLG 185
           G L  G LGD YGR++       L+C              TG  K +  F+G R + G+ 
Sbjct: 125 GALIFGYLGDRYGRKIPYCISMLLIC---------IIQIGTGFVKSFPAFLGCRAVFGIV 175

Query: 186 VGGIAVLSPTLISETAPKHLRGTCVAFYQLMITLGIFLGYCTNYGTKTYTNSVQ-WRVPL 244
           +G +  ++     E AP+  +      +Q     G  LG    +      NS   WR   
Sbjct: 176 MGSVFGIASATSLENAPEESKSILSGIFQEGYAFGYLLGVV--FQRAIVDNSSHGWRAMF 233

Query: 245 GMCFAWAIFMIAGMLLVPESPRFLIEKGRFEEAR 278
                  I  IA  LL+PES  +   K   EE R
Sbjct: 234 WFSSGPPILFIAWRLLLPESEAYTRRKA--EEKR 265

>Sklu_1567.2 YPR198W, Contig c1567 1150-2859
          Length = 569

 Score = 33.5 bits (75), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 31/123 (25%), Positives = 46/123 (37%), Gaps = 4/123 (3%)

Query: 119 RTGLIVAIFNIGCAFGGLTLGRLGDIYGRRLGLMCXXXXXXXXXXXXXATGDKWYQYFIG 178
           + G ++  +++  A   L  GR   I+G +  LM              A  +       G
Sbjct: 56  KIGWLITGYSLSNALFTLLWGRFAVIFGSKTTLMVSIIIFEIGSLVI-AVSNSMDMIIGG 114

Query: 179 RIISGLGVGGIAVLSPTLISETAPKHLRGTCVAFYQLMITLGIFLGYCTNYGTKTYTNSV 238
           R+I+G G  GI  L   + +    +H RGT V    L   +   LG    Y     T  V
Sbjct: 115 RVIAGCGASGIQTLVFAIATSLVDEHTRGTIVTLLSLSYAVASALG---PYIGGALTEYV 171

Query: 239 QWR 241
            WR
Sbjct: 172 TWR 174

>YML123C (PHO84) [3849] chr13 complement(24038..25801) High-affinity
           inorganic phosphate/H+ symporter, member of the
           phosphate:H[+] symporter (PHS) family of the major
           facilitator superfamily (MFS) [1764 bp, 587 aa]
          Length = 587

 Score = 33.5 bits (75), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 46/194 (23%), Positives = 73/194 (37%), Gaps = 34/194 (17%)

Query: 128 NIGCAFGGLTLGRLGDIYGRR------LGLMCXXXXXXXXXXXXXATGDKWYQYFIGRII 181
           ++G   G    G L DI GR+      L +M              A        F  RI+
Sbjct: 112 SVGTVIGQFGFGTLADIVGRKRIYGMELIIMIVCTILQTTVAHSPAINFVAVLTFY-RIV 170

Query: 182 SGLGVGGIAVLSPTLISETAPKHLRGTCV-------AFYQL---MITLGIFLGYCTNYGT 231
            G+G+GG   LS  + SE A    RG  +       A+ Q+   +I L +   Y    G 
Sbjct: 171 MGIGIGGDYPLSSIITSEFATTKWRGAIMGAVFANQAWGQISGGIIALILVAAY---KGE 227

Query: 232 KTYTNS-------------VQWRVPLGMCFAWAIFMIAGMLLVPESPRFLIE-KGRFEEA 277
             Y NS               WR+ +G+     +  +   L +PESPR+ ++   + E A
Sbjct: 228 LEYANSGAECDARCQKACDQMWRILIGLGTVLGLACLYFRLTIPESPRYQLDVNAKLELA 287

Query: 278 RRSIAKSNKLTVED 291
             +  +  +  + D
Sbjct: 288 AAAQEQDGEKKIHD 301

>KLLA0E03729g 349784..351613 similar to sgd|S0006360 Saccharomyces
           cerevisiae YPR156c, start by similarity
          Length = 609

 Score = 33.5 bits (75), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 41/194 (21%), Positives = 72/194 (37%), Gaps = 3/194 (1%)

Query: 110 EGTYYLSNVRTGLIVAIFNIGCAFGGLTLGRLGDIYGRRLGLMCXXXXXXXXXXXXXATG 169
           E  +++S     L  ++  IG + G L    + D+YGRR+                 A  
Sbjct: 195 EEKFHVSQEVAILSCSLMVIGFSLGPLIWSPVSDLYGRRVAYF-ISLGLYVIFNIPCALA 253

Query: 170 DKWYQYFIGRIISGLGVGGIAVLSPTLISETAPKHLRGTCVAFYQLMITLGIFLGYCTNY 229
                  + R + G+       L    I++  P   RG  +AF+      G   G   N 
Sbjct: 254 KNIGTLLVCRFLCGVWSSSGLCLVGGSIADMFPAETRGRAIAFFAYAPYCGPVFGPLVNG 313

Query: 230 GTKTYTNSVQWRVPLGMCFAWAIFMIAGMLLVPESPRFLIEKGRFEEARRSIAKSNKLTV 289
                TN +     + M FA  +++I     +PE+   +I K R +  R  +     +T 
Sbjct: 314 FIAISTNRMDLIFWVNMAFAGVMWIIVS--CIPETYAPVILKKRAKRLRIELNNPKIMTE 371

Query: 290 EDPGVSAEVELINA 303
           ++    +  EL+ A
Sbjct: 372 QEAQGMSVSELVRA 385

>CAGL0E03674g complement(343114..344847) highly similar to tr|Q07824
           Saccharomyces cerevisiae YLL028w TPO1, start by
           similarity
          Length = 577

 Score = 33.5 bits (75), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 55/249 (22%), Positives = 92/249 (36%), Gaps = 29/249 (11%)

Query: 35  STPSNKASRDDFDLKPENEHFPEIPQKKLSEYILVMCL-CLMVAFGGFVFGWDTGTISGF 93
           + P        FD   +  H    P +K     +++CL C+ +  G  +F   TG     
Sbjct: 108 TLPEKTQFEVTFDGPNDPLHPFNWPLRKKVMLCIILCLNCISITMGSSIFA--TGI---- 161

Query: 94  VNMTDFKRRFGNYSQSEGTYYLSNVRTGLIVAIFNIGCAFGGLTLGRLGDIYGRRLGLMC 153
                         Q    Y++  V   L + ++ +G A   +    L +IYGRR G++ 
Sbjct: 162 -------------RQICEIYHVIPVVAILGITLYVLGFAASPVIYAPLSEIYGRR-GVLV 207

Query: 154 XXXXXXXXXXXXXATGDKWYQYFIGRIISGLGVGGIAVLSPTLISETAPKHLRGTCVAFY 213
                        AT        I R  +G        + P   ++    ++RG  +  +
Sbjct: 208 ISSFGFALFNFAVATAKDLQTIMICRFFAGFIGAAPLAVVPAAFADMFDTNIRGKAICLF 267

Query: 214 QLMITLGIFLGYCTNYGTKTY-TNSVQWR--VPLGMCFAWAIFMIAGMLLVPESPRFLIE 270
               +LG+F+G        +Y T    WR    +  CFA AIF +A +    ES    I 
Sbjct: 268 ----SLGVFVGPILAPVIGSYITQHTTWRWLEYVIACFASAIF-VAILFFFEESHHPSIL 322

Query: 271 KGRFEEARR 279
            G+ +E R+
Sbjct: 323 VGKAKELRK 331

>YLL028W (TPO1) [3391] chr12 (84803..86563) Polyamine transport
           protein involved in the export of spermidine, member of
           the multidrug-resistance 12-spanner (DHA12) family of
           the major facilitator superfamily (MFS-MDR) [1761 bp,
           586 aa]
          Length = 586

 Score = 33.1 bits (74), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 38/166 (22%), Positives = 71/166 (42%), Gaps = 11/166 (6%)

Query: 113 YYLSNVRTGLIVAIFNIGCAFGGLTLGRLGDIYGRRLGLMCXXXXXXXXXXXXXATGDKW 172
           Y++  V   L + +F +G A   +    L ++YGR+ G++              AT +  
Sbjct: 177 YHVIEVVAILGITLFVLGFAASPVIYAPLSELYGRK-GVLVLSAFGFALFQFAVATAENL 235

Query: 173 YQYFIGRIISGLGVGGIAVLSPTLISETAPKHLRGTCVAFYQLMITLGIFLGYCTNYGTK 232
              FI R   G        + P   ++    ++RG  +A +    +LG+F+G   +    
Sbjct: 236 QTIFICRFFGGFIGAAPMAVVPAAFADMFDTNVRGKAIALF----SLGVFVGPILSPVMG 291

Query: 233 TYT---NSVQWRVPLGMCFAWAIFMIAGMLLVPES--PRFLIEKGR 273
           +Y     + +W   +  CFA A+F +A +L   E+  P  L+ K +
Sbjct: 292 SYIAQRTTWRWLEYVVGCFASAVF-VAIVLFFEETHHPTILVNKAK 336

>YDR119W (YDR119W) [966] chr4 (688221..690527) Member of the
           14-spanner drug:[H+] antiporter (DHA14) family of
           multidrug-resistance (MFS-MDR) proteins in the major
           facilitator superfamily (MFS) [2307 bp, 768 aa]
          Length = 768

 Score = 33.1 bits (74), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 28/145 (19%), Positives = 61/145 (42%), Gaps = 8/145 (5%)

Query: 119 RTGLIVAIFNIGCAFGGLTLGRLGDIYGRRLGLMCXXXXXXXXXXXXXATGDKWYQYFIG 178
           R  L+++ + +  A G L   +L  I   +L L+C              +   ++ +   
Sbjct: 285 RLSLVISAYLLSNAIGQLVFLKLSLISSVKL-LLCIAQFSFILGGYLSWSSAHFWTFIFA 343

Query: 179 RIISGLGVGGIAVLSPTLISETAPKHLRGTCVAFYQLMITLGIFLG-YCTNYGTKTYTNS 237
           R ++G G G +  L  T+++  + K+     ++   +   +G+ +G +  N    ++ + 
Sbjct: 344 RCVTGFGGGSLIALKSTIMNRFSQKNDSRYSLSASMITFAMGVVIGPFMMNLFDSSHGSG 403

Query: 238 VQWR----VPLGMCFAWAIFMIAGM 258
             WR    +P+  C   A  M+A M
Sbjct: 404 --WRNAFLIPVPFCLVNASIMLADM 426

>Kwal_47.18919
          Length = 640

 Score = 32.7 bits (73), Expect = 0.97,   Method: Compositional matrix adjust.
 Identities = 39/193 (20%), Positives = 74/193 (38%), Gaps = 3/193 (1%)

Query: 113 YYLSNVRTGLIVAIFNIGCAFGGLTLGRLGDIYGRRLGLMCXXXXXXXXXXXXXATGDKW 172
           +++S   + L  ++  IG + G L    + D++GRR+                 A     
Sbjct: 228 FHVSQEVSILTCSLMVIGFSLGPLIWSPVSDLFGRRVAYFV-SLGLYVIFNIPCALAPNI 286

Query: 173 YQYFIGRIISGLGVGGIAVLSPTLISETAPKHLRGTCVAFYQLMITLGIFLGYCTNYGTK 232
               + R + G+       L    I++  P   RG  +AF+      G   G   N    
Sbjct: 287 GCLLVCRFLCGVWSSSGLCLVGGSIADMFPPETRGRAIAFFAYAPYCGPVFGPLVNGFIS 346

Query: 233 TYTNSVQWRVPLGMCFAWAIFMIAGMLLVPESPRFLIEKGRFEEARRSIAKSNKLTVEDP 292
             T+ +     + M FA  ++++     +PE+   +I K R  + RR       +T ++ 
Sbjct: 347 VSTHRMDLIFWVNMAFAGVMWLVVA--CIPETFAPVILKRRAAKLRRETGNPKIMTEQEA 404

Query: 293 GVSAEVELINAGV 305
              +  E++NA V
Sbjct: 405 QGLSVGEMVNACV 417

>Scas_713.30
          Length = 630

 Score = 32.3 bits (72), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 40/170 (23%), Positives = 67/170 (39%), Gaps = 30/170 (17%)

Query: 96  MTDFKRRFGNYSQSEGTYYLSNVRTGLIVAIFNIGCAFGGLTLGRLGDIYGRRLGLMCXX 155
           + D  ++FG YS           +TG I A +++  A   L  GR+  I G +   M   
Sbjct: 102 IEDVAKKFGAYS-----------KTGWIFAGYSLPNALLALLWGRIASIIGFK-SCMLAA 149

Query: 156 XXXXXXXXXXXATGDKWYQYFIGRIISGLGVGGIAVLSPTLISETAPKHLRGTCVA---- 211
                         +       GR+I+G+G  GI  L+  + S    +  RG  +A    
Sbjct: 150 IIIFEIGSLISGVANSMNMLIGGRVIAGVGGSGIQSLAFVIGSNLVDERRRGLIIACMSS 209

Query: 212 FYQLMITLGIFLGYCTNYGTKTYTNSVQWR------VPLGMCFAWAIFMI 255
            + +   +G FLG         +T    WR      +P+G   A+A+F++
Sbjct: 210 AFAVASVIGPFLG-------GAFTTHATWRWCFYINLPVGGV-AFALFVV 251

>YJL163C (YJL163C) [2758] chr10 complement(111661..113328) Protein
           that contains ten potential transmembrane segments [1668
           bp, 555 aa]
          Length = 555

 Score = 32.3 bits (72), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 25/80 (31%), Positives = 42/80 (52%), Gaps = 14/80 (17%)

Query: 171 KWYQYFIGRIISGLGVGG---IAVLSPTLIS--ETAPKHLRGT-------CVAFYQLMIT 218
           KW+   +G  IS LG+G    + V+SPTL+   +   +HL  +       C+ F  ++IT
Sbjct: 383 KWHAVELGYFISILGIGRGVVLLVVSPTLLYTLKRIYQHLNHSIDKIDIFCIQFSMIVIT 442

Query: 219 LGIFLGYCTNYGTKTYTNSV 238
           L +F+     +G KT T+ +
Sbjct: 443 LSLFV--MIRFGEKTPTSMI 460

>Sklu_2083.1 YKL217W, Contig c2083 424-2220
          Length = 598

 Score = 31.6 bits (70), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 11/31 (35%), Positives = 21/31 (67%)

Query: 122 LIVAIFNIGCAFGGLTLGRLGDIYGRRLGLM 152
           +I+ + N+G   GG+  G++ ++ GRRL L+
Sbjct: 392 VIITVVNLGAICGGMIFGQIMEVTGRRLALL 422

>Kwal_47.18976
          Length = 534

 Score = 31.2 bits (69), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 39/152 (25%), Positives = 57/152 (37%), Gaps = 11/152 (7%)

Query: 134 GGLTLGRLGDIYGRRLGLMCXXXXXXXXXXXXXATG-DKWYQYFIG-RIISGLGVGGIAV 191
           G +  G LGD YGR++                  TG  K +  F+G R + G+ +G I  
Sbjct: 122 GAIIFGYLGDRYGRKVPYCI---SMVLIVVVQIGTGFVKSFPAFLGCRALFGIVMGSIFG 178

Query: 192 LSPTLISETAPKHLRGTCVAFYQLMITLGIFLGYCTNYGTKTYTNSVQ-WRVPLGMCFAW 250
           ++     E AP+  +      +Q    LG  LG    +      NS   WR         
Sbjct: 179 VASATALEDAPQESKSILSGIFQEGYALGYLLGVV--FKRAIVDNSSHGWRAFFWFSAGP 236

Query: 251 AIFMIAGMLLVPESP---RFLIEKGRFEEARR 279
            +  I   LL+PES    R   E+ R  E+  
Sbjct: 237 PVLFIVWRLLLPESEAYTRRTTEEKRLAESEE 268

>Scas_694.19
          Length = 581

 Score = 31.2 bits (69), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 35/164 (21%), Positives = 63/164 (38%), Gaps = 7/164 (4%)

Query: 108 QSEGTYYLSNVRTGLIVAIFNIGCAFGGLTLGRLGDIYGRRLGLMCXXXXXXXXXXXXXA 167
           Q E  + L   +  + V ++ +         G L D++GRR  ++               
Sbjct: 116 QLEKQFGLDENKVNVTVVVYLLFQGIAPTISGGLADVFGRRPVILIGMLIYVVASIGLAC 175

Query: 168 TGDKWYQYFIGRIISGLGVGGIAVLSPTLISETAPKHLRGTCVAFYQLMITLGIFLGYCT 227
                   F+ RII  +G+     +S  ++ +   KH RGT V     ++ LG   G   
Sbjct: 176 APSYGVIVFL-RIIQSIGISPTIAISSGVVGDFTLKHERGTFVGATSGLVLLGQCFGSLI 234

Query: 228 NYGTKTYTN--SVQWRVPLGMCFAWAIFMIAGMLLVPESPRFLI 269
                   N  ++ W + +G   ++    I   LL+PE+ R L+
Sbjct: 235 GAVLAAAWNWRAIFWFLTIGCGTSF----IIAFLLLPETKRTLV 274

>YGR138C (TPO2) [2094] chr7 complement(763765..765609) Polyamine
           transport protein, member of the multidrug-resistance
           12-spanner (DHA12) family of the major facilitator
           superfamily (MFS-MDR) [1845 bp, 614 aa]
          Length = 614

 Score = 31.2 bits (69), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 51/255 (20%), Positives = 91/255 (35%), Gaps = 25/255 (9%)

Query: 50  PENEH-FPEIPQKKLSEYILVMCLCLMVAFGGFVFGWDTGTISGFVNMTDFKRRFGNYSQ 108
           PEN H +P     + S  +L+  L + VA+G        GT+                  
Sbjct: 158 PENPHNWPS--WVRWSYTVLLSILVICVAYGSACISGGLGTV------------------ 197

Query: 109 SEGTYYLSNVRTGLIVAIFNIGCAFGGLTLGRLGDIYGRRLGLMCXXXXXXXXXXXXXAT 168
            E  Y++      L  ++  IG + G L    + D+YGRR+                 A 
Sbjct: 198 -EKKYHVGMEAAILSCSLMVIGFSLGPLIWSPVSDLYGRRVAYFVSMGLYVIFNIPC-AL 255

Query: 169 GDKWYQYFIGRIISGLGVGGIAVLSPTLISETAPKHLRGTCVAFYQLMITLGIFLGYCTN 228
                     R + G+       L    I++  P   RG  +AF+     +G  +G   N
Sbjct: 256 APNLGCLLACRFLCGVWSSSGLCLVGGSIADMFPSETRGKAIAFFAFAPYVGPVVGPLVN 315

Query: 229 YGTKTYTNSVQWRVPLGMCFAWAIFMIAGMLLVPESPRFLIEKGRFEEARRSIAKSNKLT 288
                 T  +     + M FA  +++I+    +PE+   +I K +    R+       +T
Sbjct: 316 GFISVSTGRMDLIFWVNMAFAGVMWIISSA--IPETYAPVILKRKAARLRKETGNPKIMT 373

Query: 289 VEDPGVSAEVELINA 303
            ++    +  E++ A
Sbjct: 374 EQEAQGVSMSEMMRA 388

>Sklu_2444.12 , Contig c2444 36594-38267 reverse complement
          Length = 557

 Score = 31.2 bits (69), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 33/64 (51%), Gaps = 5/64 (7%)

Query: 81  FVFGWDTGTISGFVNMTDFKRRFGNYSQSEGTYYLSNVRTG-LIVAIFNIGCA-FGGLTL 138
           F   + T  +S   N TDF  +F +Y+ + GT+Y   +  G +I+  FN G A     T+
Sbjct: 172 FEVNYSTSIVS---NNTDFFTQFYDYTFASGTWYQDTIEVGSIIIEKFNFGVAQETNATI 228

Query: 139 GRLG 142
           G LG
Sbjct: 229 GSLG 232

>KLLA0D10615g 903967..905322 similar to sp|P47159 Saccharomyces
           cerevisiae YJR124c singleton, hypothetical start
          Length = 451

 Score = 30.8 bits (68), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 33/63 (52%), Gaps = 6/63 (9%)

Query: 353 TTIFQAVGMDDS----FQTSIVLGIVNFASTFVGLWTVEKFGRRKCLLWGSASMASCFVV 408
           T  F  +G+ D     F +  ++G  +   ++V  W  + +GRR  L +GSA MA   +V
Sbjct: 36  TLFFSEIGISDDEMGWFMSLTLVG--DVCISYVLTWYADSWGRRLVLTYGSAMMALSGIV 93

Query: 409 FAS 411
           FA+
Sbjct: 94  FAT 96

>Scas_713.17
          Length = 572

 Score = 30.8 bits (68), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 49/263 (18%), Positives = 99/263 (37%), Gaps = 28/263 (10%)

Query: 18  VGASKDSDSALQLNLQTSTPSNKASRDDFDLKPENEHFPE----IPQKKL--SEYILVMC 71
           + A  +  S L  N         A+ D    +   +  P     +P  +   SE  +++ 
Sbjct: 26  IDAQSEQSSILSYNKPVHIHETSATADLCKTQSNKKDEPNLDNAVPYSRFGSSEKTILVL 85

Query: 72  LCLMVAFGGFVFGWDTGTISGFVNMTDFKRRFGNYSQSEGTYYLSNVRTGLIVAIFNIGC 131
            C   AF GF       TI+G +        +   S+ E  +++S     + V ++ I  
Sbjct: 86  QC---AFTGFF-----STIAGAI-------YYPVLSEIEEIFHISEESVNITVVVYFIFQ 130

Query: 132 AFGGLTLGRLGDIYGRRLGLMCXXXXXXXXXXXXXATGDKWYQYFIGRIISGLGVGGIAV 191
                 +G L D  GRR  ++C             A    + Q  + R +   G+  +  
Sbjct: 131 GISPSIMGGLADTMGRRPIVLC-SIAVYFCACIGLACCQTYPQIVVLRCLQAAGISPVIA 189

Query: 192 LSPTLISETAPKHLRGTCVAFYQLMITLGIFLGYCTNYG-TKTYT-NSVQWRVPLGMCFA 249
           ++  ++ +   +  RG  V +      +G   G     G + T++  ++ W + +G    
Sbjct: 190 INSGIMGDITTRAERGGFVGYVSGFQVMGSAFGALIGAGISSTWSWRAIFWFLAIGS--- 246

Query: 250 WAIFMIAGMLLVPESPRFLIEKG 272
             I +I   +++PE+ R ++  G
Sbjct: 247 -GICLIISFIILPETKRTIVGNG 268

>CAGL0G03927g complement(372896..374599) highly similar to tr|Q07824
           Saccharomyces cerevisiae YLL028w TPO1 polyamine
           transport protein, hypothetical start
          Length = 567

 Score = 30.4 bits (67), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 38/172 (22%), Positives = 68/172 (39%), Gaps = 11/172 (6%)

Query: 113 YYLSNVRTGLIVAIFNIGCAFGGLTLGRLGDIYGRRLGLMCXXXXXXXXXXXXXATGDKW 172
           Y++  V   L V ++  G A   +    L ++YGRR G++              AT    
Sbjct: 158 YHVIPVVAILGVTLYVFGFAASPVIYAPLSEVYGRR-GVLVISAFGFAVFQFAVATSKDL 216

Query: 173 YQYFIGRIISGLGVGGIAVLSPTLISETAPKHLRGTCVAFYQLMITLGIFLGYCTNYGTK 232
               I R   GL       + P   ++     +RG  +  +    +LG+F+G   +    
Sbjct: 217 QSIMICRFFGGLIGAAPMAVVPAAFADMFDVRVRGKAICLF----SLGVFVGPILSPVMG 272

Query: 233 TYT---NSVQWRVPLGMCFAWAIFMIAGMLLVP-ESPRFLIEKGRFEEARRS 280
           +Y     + +W   +  CFA A+F+   +       P  L++K +  E R+S
Sbjct: 273 SYIAQRTTWRWLEYVTGCFASALFVAVALTFKETHHPTILVQKAK--EMRKS 322

>CAGL0J00363g 27627..29123 highly similar to sp|P38776 Saccharomyces
           cerevisiae YHR048w, hypothetical start
          Length = 498

 Score = 30.4 bits (67), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 28/138 (20%), Positives = 56/138 (40%), Gaps = 31/138 (22%)

Query: 22  KDSDSALQLNLQTSTPSNKASRDDF--------DLKPEN--EHFPEIPQKKLSEYILVMC 71
           KDSDS  Q++ ++ +  +   + +F        D  PEN   H P + +  +S  I +  
Sbjct: 8   KDSDSCNQIDAESKSALSANEQTEFEVSFSEDGDPDPENIARHLPLVRKYYISSLITLTS 67

Query: 72  LCLMVAFGGFVFGWDTGTISGFVNMTDFKRRFGNYSQSEGTYYLSNVRTGLIVAIFNIGC 131
             + +        W   +        +  + F          ++S+  + L + ++  G 
Sbjct: 68  TVITIISSC----WSLAS-------PNIMKHF----------HISHEVSTLGITLYIFGL 106

Query: 132 AFGGLTLGRLGDIYGRRL 149
            FG L L  + ++YGRR+
Sbjct: 107 GFGPLFLSPISELYGRRI 124

>AGR076C [4386] [Homologous to ScYDR119W - SH] (871570..873630)
           [2061 bp, 686 aa]
          Length = 686

 Score = 30.4 bits (67), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 23/90 (25%), Positives = 38/90 (42%), Gaps = 5/90 (5%)

Query: 139 GRLGDIYGRRLGLMCXXXXXXXXXXXXXATGDKWYQYFIGRIISGLGVGGIAVLSPTLIS 198
           G+L DI+GRR  L+               + + W    +GR ++G+G GG+  +     +
Sbjct: 196 GKLSDIFGRRPLLVFSNLVFCLGALICGMSKNLWV-LVLGRFVAGIGGGGLTSMCSITTT 254

Query: 199 ETAPKHLR----GTCVAFYQLMITLGIFLG 224
           +  P   R    G C  F+ L    G  +G
Sbjct: 255 DIVPLRSRALYQGICNVFFGLGTACGGLVG 284

>Kwal_33.14268
          Length = 569

 Score = 30.0 bits (66), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 13/45 (28%), Positives = 26/45 (57%), Gaps = 1/45 (2%)

Query: 240 WRVPLGMCFAWAIFMIAGMLLVPESPRFLIE-KGRFEEARRSIAK 283
           WR+ +G+     +F +   L +PESPR+ ++ + R  +A   ++K
Sbjct: 241 WRILVGLGCVPGVFALYFRLTIPESPRYTLDVENRVNKAAADVSK 285

>Scas_712.56
          Length = 620

 Score = 29.6 bits (65), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 38/188 (20%), Positives = 69/188 (36%), Gaps = 3/188 (1%)

Query: 104 GNYSQSEGTYYLSNVRTGLIVAIFNIGCAFGGLTLGRLGDIYGRRLGLMCXXXXXXXXXX 163
           G +   E  +++S   + L  ++  IG + G L    + D+YGRR+              
Sbjct: 198 GGFGTVEEKFHVSLEASILSCSLMVIGFSVGPLLWSPVSDLYGRRVAYF-FSMGLYVIFN 256

Query: 164 XXXATGDKWYQYFIGRIISGLGVGGIAVLSPTLISETAPKHLRGTCVAFYQLMITLGIFL 223
              A           R + G+       L    I++  P   RG  +AF+      G   
Sbjct: 257 IPCALAPNLGCLLACRFLCGVWSSSGLCLVGGSIADMFPSETRGKAIAFFAYSPYCGPVF 316

Query: 224 GYCTNYGTKTYTNSVQWRVPLGMCFAWAIFMIAGMLLVPESPRFLIEKGRFEEARRSIAK 283
           G   N      T  +     + M FA  +++I+    +PE+   +I K R  + R+    
Sbjct: 317 GPLVNGFISVSTGRMDLIFWVNMAFAGVMWIISSA--IPETYAPVILKRRAAKLRKETGN 374

Query: 284 SNKLTVED 291
              +T ++
Sbjct: 375 PKIMTEQE 382

>Scas_676.25
          Length = 634

 Score = 29.6 bits (65), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 59/288 (20%), Positives = 99/288 (34%), Gaps = 40/288 (13%)

Query: 21  SKDSDSALQLNLQTSTPSNKASRDDFDLKPENEHFPEI------------PQK-----KL 63
           S  S S L   L+T+   +  S    + +P+N   PEI            P       + 
Sbjct: 132 SPSSQSFLH-KLRTTQTQHSVSTQTGEDEPDNHLDPEIEFVTFVTNDPANPHNWPLWIRW 190

Query: 64  SEYILVMCLCLMVAFGGFVFGWDTGTISGFVNMTDFKRRFGNYSQSEGTYYLSNVRTGLI 123
           +  IL+  L + VA+G        GTI                   E  +++S     L 
Sbjct: 191 TYTILLSTLVICVAYGSACVTGGFGTI-------------------EKKFHVSLEAAILS 231

Query: 124 VAIFNIGCAFGGLTLGRLGDIYGRRLGLMCXXXXXXXXXXXXXATGDKWYQYFIGRIISG 183
            ++  IG + G L    + D+YGRR+                 A           R + G
Sbjct: 232 CSLMVIGFSVGPLLWSPVSDLYGRRVAYF-FSMGLYVIFNIPCAIAPNLGCLLACRFLCG 290

Query: 184 LGVGGIAVLSPTLISETAPKHLRGTCVAFYQLMITLGIFLGYCTNYGTKTYTNSVQWRVP 243
           +       L    I++  P   RG  +AF+      G   G   N      T  +     
Sbjct: 291 VWSSSGLCLVGGSIADMFPSETRGKAIAFFAYSPYCGPVFGPLVNGFISVSTGRMDLIFW 350

Query: 244 LGMCFAWAIFMIAGMLLVPESPRFLIEKGRFEEARRSIAKSNKLTVED 291
           + M FA  +++I+    +PE+   +I K R  + R+       +T ++
Sbjct: 351 VNMAFAGVMWIISSA--IPETYAPVILKRRAAKLRKETGNPKIMTEQE 396

>Sklu_2183.3 YCR098C, Contig c2183 6694-8208
          Length = 504

 Score = 29.3 bits (64), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 12/46 (26%), Positives = 25/46 (54%)

Query: 353 TTIFQAVGMDDSFQTSIVLGIVNFASTFVGLWTVEKFGRRKCLLWG 398
           + I     + +  + +++LGI+     FVG W  ++ GR+  L++G
Sbjct: 280 SVINNTTDLKEICEWNLLLGIIAIPGCFVGAWLCDRIGRKYTLMFG 325

>KLLA0F01727g complement(162226..163440) similar to sp|P38344
           Saccharomyces cerevisiae YBR267w, start by similarity
          Length = 404

 Score = 29.3 bits (64), Expect = 9.3,   Method: Compositional matrix adjust.
 Identities = 21/67 (31%), Positives = 34/67 (50%), Gaps = 6/67 (8%)

Query: 4   SVTPIDNRSVASGKVGASKD-----SDSALQLNLQTSTPSNKASRDDFDLKPENEHFPEI 58
            +T  + R +   K+ A K      +  ++  N+Q STP NKAS DD +++ E E   E+
Sbjct: 72  QMTKKEMRRLEKEKLLAKKQQLLQLAKESMLKNMQDSTPVNKAS-DDPEVQVEAEQKDEV 130

Query: 59  PQKKLSE 65
            + K  E
Sbjct: 131 AKSKAEE 137

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.323    0.138    0.432 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 16,888,939
Number of extensions: 669241
Number of successful extensions: 2234
Number of sequences better than 10.0: 211
Number of HSP's gapped: 1891
Number of HSP's successfully gapped: 222
Length of query: 572
Length of database: 16,596,109
Length adjustment: 107
Effective length of query: 465
Effective length of database: 12,891,983
Effective search space: 5994772095
Effective search space used: 5994772095
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 64 (29.3 bits)