Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Sklu_2363.232332316730.0
YPR011C32632612911e-180
CAGL0J01661g32732912791e-179
Kwal_14.221031530811401e-157
AGL047C31631510481e-143
KLLA0D04290g1881867601e-102
KLLA0D04312g1031004331e-53
YHR002W (LEU5)3573083922e-44
Scas_717.203563083895e-44
CAGL0K02915g3423103763e-42
CAGL0J05522g5193203821e-41
AGL065C3353043605e-40
Kwal_23.30425423103698e-40
KLLA0E18788g3813133565e-39
YNL083W5453213646e-39
KLLA0C11363g5173213592e-38
Sklu_2374.75133173574e-38
Scas_578.3*5243113513e-37
Kwal_26.79723583043391e-36
AER419W4933203302e-34
Scas_718.243373123213e-34
CAGL0F04213g3063023184e-34
YBR085W (AAC3)3072833081e-32
YMR056C (AAC1)3092993011e-31
Scas_667.43083062992e-31
AER184W3052982983e-31
YBL030C (PET9)3182952975e-31
Kwal_27.124813043022966e-31
KLLA0D15015g3172932932e-30
YEL006W3353182933e-30
Kwal_55.208683802902883e-29
CAGL0J02002g3613162822e-28
KLLA0E12353g3053072747e-28
Scas_602.88852942785e-27
ADL009W3793182725e-27
YPR021C (AGC1)9022872681e-25
Sklu_2431.53703182611e-25
YIL006W3732892603e-25
ADL049W9122882653e-25
Kwal_23.39653072942546e-25
Sklu_2359.69022922627e-25
Sklu_2334.23192842477e-24
Kwal_27.120813693152452e-23
Scas_716.293163002414e-23
KLLA0E13453g9062872485e-23
Kwal_47.173218812922468e-23
Kwal_33.140503142912399e-23
Scas_709.93652942401e-22
CAGL0K02365g9192922451e-22
YJR095W (SFC1)3222862381e-22
CAGL0M09020g3482642373e-22
AEL253W3653132349e-22
KLLA0D14036g4313422359e-22
YJL133W (MRS3)3142882302e-21
CAGL0K08250g2972832282e-21
YIL134W (FLX1)3113012273e-21
Scas_721.273743222294e-21
Kwal_23.47313142922249e-21
YKR052C (MRS4)3042952221e-20
KLLA0E23705g3682742242e-20
CAGL0L05742g3052892204e-20
YGR096W (TPC1)3143062204e-20
CAGL0G08910g2892902176e-20
CAGL0G03135g3073022179e-20
ACR260W3112962161e-19
Kwal_47.182163333022162e-19
CAGL0K11616g3202962152e-19
Scas_645.93912802172e-19
Scas_582.73292842133e-19
YGR257C (MTM1)3662782144e-19
Scas_379.23012862106e-19
Scas_691.43342892117e-19
AAR036W3173042109e-19
KLLA0E15532g3262572101e-18
Scas_640.253062902081e-18
Kwal_26.86692962892028e-18
CAGL0M05225g3812722058e-18
Scas_662.123083002029e-18
AFR131C3442722031e-17
KLLA0F04697g3073011992e-17
Scas_718.53242931993e-17
Sklu_2037.23102901941e-16
KLLA0D07073g2972861922e-16
KLLA0F03212g3052801913e-16
Sklu_2430.103243381923e-16
YKL120W (OAC1)3243001904e-16
YBR192W (RIM2)3772731906e-16
Kwal_26.76533252951889e-16
Kwal_23.43543432771881e-15
AGR383W2932831852e-15
KLLA0A09383g3662941862e-15
AGL311C3622881853e-15
AER366W2932671833e-15
Kwal_55.213383232741826e-15
YOR222W (ODC2)3072901817e-15
CAGL0K12210g3112901817e-15
Scas_667.223062861808e-15
Scas_632.92922901808e-15
Sklu_1275.13112841781e-14
Sklu_1149.22963281762e-14
KLLA0E08877g2943021745e-14
KLLA0C13431g3281921755e-14
YOR130C (ORT1)2922921737e-14
Kwal_26.79672973241711e-13
KLLA0E02772g2842921701e-13
CAGL0D01606g3052811701e-13
Scas_721.1293232991702e-13
YBR291C (CTP1)2992831692e-13
YMR166C3681971703e-13
Scas_589.103161801683e-13
YJR077C (MIR1)3112841674e-13
KLLA0E18810g3773011685e-13
AFR147C3152441675e-13
Scas_669.63731811676e-13
CAGL0L02079g2973031658e-13
CAGL0F00231g3072811658e-13
AFR146W2812891649e-13
Scas_489.42972971649e-13
Sklu_1926.23053251641e-12
CAGL0F07711g3681451651e-12
ADL264C3291721641e-12
ACR109W2992841612e-12
CAGL0K10362g3012971613e-12
CAGL0H03839g2822611594e-12
Kwal_27.114192983021594e-12
CAGL0H10538g2972831585e-12
CAGL0G01166g2952591585e-12
YNL003C (PET8)2842541577e-12
CAGL0B04543g3171721587e-12
AFL196W3612961589e-12
YPR058W (YMC1)3072861579e-12
YLR348C (DIC1)2982641579e-12
KLLA0D09889g3641701571e-11
Scas_697.473281781571e-11
CAGL0F08305g3742751562e-11
YPL134C (ODC1)3102931542e-11
YBR104W (YMC2)3292981542e-11
Kwal_55.213353172831542e-11
Kwal_0.2322741831514e-11
KLLA0F17864g3072871516e-11
Scas_328.12272281486e-11
YOR100C (CRC1)3271751508e-11
Scas_673.173142811499e-11
Sklu_1119.13072871491e-10
Kwal_27.125993042791491e-10
AAL014C2712521481e-10
Sklu_2398.43092881491e-10
Sklu_2115.42992991481e-10
Scas_558.22892561471e-10
Sklu_2432.52881881462e-10
CAGL0J04114g3032841462e-10
Kwal_56.230113032901435e-10
Kwal_47.192282811341427e-10
Kwal_23.35293951621421e-09
Sklu_2435.23442611401e-09
KLLA0E09680g3073281401e-09
Kwal_33.154463053201392e-09
KLLA0B12826g3193011382e-09
KLLA0B08503g3032881383e-09
Kwal_33.129883032851355e-09
Kwal_33.155973052871355e-09
Sklu_2075.33453201348e-09
AFR253W3441371349e-09
Kwal_23.29133202971331e-08
Kwal_55.211063283011331e-08
KLLA0E02750g3042421331e-08
ABL023W3092901312e-08
KLLA0D04950g2742011302e-08
Sklu_2127.52782921302e-08
ADR036C3402531294e-08
AER450C3082881284e-08
Scas_714.183051371269e-08
KLLA0B14454g3052921251e-07
YPR128C (ANT1)3282941242e-07
Scas_702.103022271223e-07
Sklu_2433.84201771206e-07
Kwal_23.57573072861188e-07
KLLA0B11319g3552511181e-06
Scas_687.15*3282301171e-06
Scas_715.453052941171e-06
CAGL0C02013g3293141171e-06
KLLA0A00979g3431371171e-06
AGL064W2963201152e-06
YDL198C (YHM1)3001811133e-06
Sklu_2260.53022871117e-06
Sklu_2442.82752551099e-06
Scas_562.123001801082e-05
YER053C3001431072e-05
CAGL0D04774g322671037e-05
Scas_696.93121341029e-05
YDL119C3072161011e-04
Sklu_2117.22981811002e-04
YFR045W285296982e-04
CAGL0B03883g30680983e-04
KLLA0F13464g300181973e-04
AFR542W310139965e-04
Scas_705.9323275965e-04
Kwal_27.11626299181948e-04
CAGL0K07436g307134930.001
YMR241W (YHM2)314165930.001
Kwal_34.15907312139920.001
Scas_613.24177190890.002
CAGL0J09790g300234890.004
Sklu_2194.3312165890.004
AGR191W298234870.006
KLLA0F08547g308153850.010
Scas_671.1*123127780.027
Sklu_2436.1849491710.64
AER193W26545700.71
Sklu_2127.432374671.9
Scas_560.11*75367662.7
KLLA0F26477g87164663.0
Scas_433.11167152628.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Sklu_2363.2
         (323 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Sklu_2363.2 YPR011C, Contig c2363 11969-12940                         649   0.0  
YPR011C (YPR011C) [5447] chr16 complement(583057..584037) Protei...   501   e-180
CAGL0J01661g 154646..155629 highly similar to tr|Q12251 Saccharo...   497   e-179
Kwal_14.2210                                                          443   e-157
AGL047C [4264] [Homologous to ScYPR011C - NSH] (616853..617803) ...   408   e-143
KLLA0D04290g 366536..367102 similar to sgd|S0006215 Saccharomyce...   297   e-102
KLLA0D04312g 367160..367471 highly similar to sgd|S0006215 Sacch...   171   1e-53
YHR002W (LEU5) [2287] chr8 (108806..109879) Protein with similar...   155   2e-44
Scas_717.20                                                           154   5e-44
CAGL0K02915g 259026..260054 highly similar to sp|P38702 Saccharo...   149   3e-42
CAGL0J05522g complement(524930..526489) highly similar to sp|P48...   151   1e-41
AGL065C [4246] [Homologous to ScYHR002W (LEU5) - SH] (585963..58...   143   5e-40
Kwal_23.3042                                                          146   8e-40
KLLA0E18788g complement(1661093..1662238) similar to sp|P38702 S...   141   5e-39
YNL083W (YNL083W) [4507] chr14 (471377..473014) Member of the mi...   144   6e-39
KLLA0C11363g complement(975442..976995) similar to sp|P48233 Sac...   142   2e-38
Sklu_2374.7 YNL083W, Contig c2374 13874-15415 reverse complement      142   4e-38
Scas_578.3*                                                           139   3e-37
Kwal_26.7972                                                          135   1e-36
AER419W [2919] [Homologous to ScYNL083W - SH] complement(1442595...   131   2e-34
Scas_718.24                                                           128   3e-34
CAGL0F04213g 419473..420393 highly similar to sp|P18239 Saccharo...   127   4e-34
YBR085W (AAC3) [275] chr2 (415940..416863) ADP/ATP transporter p...   123   1e-32
YMR056C (AAC1) [4016] chr13 complement(387314..388243) ADP/ATP c...   120   1e-31
Scas_667.4                                                            119   2e-31
AER184W [2686] [Homologous to ScYBL030C (PET9) - SH; ScYBR085W (...   119   3e-31
YBL030C (PET9) [164] chr2 complement(163006..163962) ADP/ATP car...   119   5e-31
Kwal_27.12481                                                         118   6e-31
KLLA0D15015g 1267803..1268756 similar to sp|P53257 Saccharomyces...   117   2e-30
YEL006W (YEL006W) [1417] chr5 (144326..145333) Member of the mit...   117   3e-30
Kwal_55.20868                                                         115   3e-29
CAGL0J02002g 198226..199311 similar to sp|P40556 Saccharomyces c...   113   2e-28
KLLA0E12353g complement(1092303..1093220) gi|1351895|sp|P49382|A...   110   7e-28
Scas_602.8                                                            111   5e-27
ADL009W [1733] [Homologous to ScYIL006W - SH; ScYEL006W - SH] co...   109   5e-27
YPR021C (AGC1) [5455] chr16 complement(600644..603352) Member of...   107   1e-25
Sklu_2431.5 YBR192W, Contig c2431 8526-9638                           105   1e-25
YIL006W (YIL006W) [2659] chr9 (344059..345180) Member of the mit...   104   3e-25
ADL049W [1692] [Homologous to ScYPR021C - SH] complement(598135....   106   3e-25
Kwal_23.3965                                                          102   6e-25
Sklu_2359.6 YPR021C, Contig c2359 14617-17325                         105   7e-25
Sklu_2334.2 YJR095W, Contig c2334 6303-7262 reverse complement        100   7e-24
Kwal_27.12081                                                          99   2e-23
Scas_716.29                                                            97   4e-23
KLLA0E13453g complement(1184806..1187526) similar to sgd|S000622...   100   5e-23
Kwal_47.17321                                                          99   8e-23
Kwal_33.14050                                                          97   9e-23
Scas_709.9                                                             97   1e-22
CAGL0K02365g 212702..215461 highly similar to tr|Q12482 Saccharo...    99   1e-22
YJR095W (SFC1) [2987] chr10 (609690..610658) Mitochondrial membr...    96   1e-22
CAGL0M09020g complement(896312..897358) highly similar to sp|P33...    96   3e-22
AEL253W [2253] [Homologous to ScYBR192W (RIM2) - SH] complement(...    95   9e-22
KLLA0D14036g complement(1203522..1204817) some similarities with...    95   9e-22
YJL133W (MRS3) [2785] chr10 (160537..161481) Member of the mitoc...    93   2e-21
CAGL0K08250g complement(820185..821078) highly similar to sp|P23...    92   2e-21
YIL134W (FLX1) [2542] chr9 (97395..98330) Protein involved in tr...    92   3e-21
Scas_721.27                                                            93   4e-21
Kwal_23.4731                                                           91   9e-21
YKR052C (MRS4) [3303] chr11 complement(532192..533106) Member of...    90   1e-20
KLLA0E23705g complement(2099965..2101071) highly similar to sp|P...    91   2e-20
CAGL0L05742g complement(630844..631761) similar to sp|P10566 Sac...    89   4e-20
YGR096W (TPC1) [2056] chr7 (676623..677567) Mitochondrial thiami...    89   4e-20
CAGL0G08910g complement(853693..854562) similar to sp|P40464 Sac...    88   6e-20
CAGL0G03135g 290834..291757 similar to sp|P53257 Saccharomyces c...    88   9e-20
ACR260W [1307] [Homologous to ScYJL133W (MRS3) - SH; ScYKR052C (...    88   1e-19
Kwal_47.18216                                                          88   2e-19
CAGL0K11616g complement(1121834..1122796) highly similar to sp|P...    87   2e-19
Scas_645.9                                                             88   2e-19
Scas_582.7                                                             87   3e-19
YGR257C (MTM1) [2204] chr7 complement(1006210..1007310) Member o...    87   4e-19
Scas_379.2                                                             86   6e-19
Scas_691.4                                                             86   7e-19
AAR036W [222] [Homologous to ScYGR096W - SH] complement(406887.....    86   9e-19
KLLA0E15532g complement(1383230..1384210) similar to sp|P23500 S...    86   1e-18
Scas_640.25                                                            85   1e-18
Kwal_26.8669                                                           82   8e-18
CAGL0M05225g 563163..564308 highly similar to sp|P38127 Saccharo...    84   8e-18
Scas_662.12                                                            82   9e-18
AFR131C [3323] [Homologous to ScYGR257C - SH] (672999..674033) [...    83   1e-17
KLLA0F04697g complement(461126..462049) similar to sp|P40464 Sac...    81   2e-17
Scas_718.5                                                             81   3e-17
Sklu_2037.2 YIL134W, Contig c2037 1645-2577 reverse complement         79   1e-16
KLLA0D07073g 606857..607750 similar to sp|Q03028 Saccharomyces c...    79   2e-16
KLLA0F03212g 302915..303832 highly similar to sp|P33303 Saccharo...    78   3e-16
Sklu_2430.10 YKL120W, Contig c2430 18856-19830                         79   3e-16
YKL120W (OAC1) [3145] chr11 (216990..217964) Mitochondrial oxalo...    78   4e-16
YBR192W (RIM2) [375] chr2 (607609..608742) Member of the mitocho...    78   6e-16
Kwal_26.7653                                                           77   9e-16
Kwal_23.4354                                                           77   1e-15
AGR383W [4694] [Homologous to ScYDL119C - SH] complement(1436769...    76   2e-15
KLLA0A09383g complement(818752..819852) similar to sp|P53320 Sac...    76   2e-15
AGL311C [4001] [Homologous to ScYJR095W (SFC1) - SH] (119645..12...    76   3e-15
AER366W [2867] [Homologous to ScYIL134W (FLX1) - SH] complement(...    75   3e-15
Kwal_55.21338                                                          75   6e-15
YOR222W (ODC2) [5014] chr15 (758330..759253) 2-Oxodicarboxylate ...    74   7e-15
CAGL0K12210g 1193771..1194706 similar to sp|P38087 Saccharomyces...    74   7e-15
Scas_667.22                                                            74   8e-15
Scas_632.9                                                             74   8e-15
Sklu_1275.1 , Contig c1275 314-1249                                    73   1e-14
Sklu_1149.2 YBR291C, Contig c1149 2019-2909 reverse complement         72   2e-14
KLLA0E08877g complement(791157..792041) similar to sgd|S0002277 ...    72   5e-14
KLLA0C13431g 1145919..1146905 similar to sgd|S0005626 Saccharomy...    72   5e-14
YOR130C (ORT1) [4932] chr15 complement(569929..570807) Ornithine...    71   7e-14
Kwal_26.7967                                                           70   1e-13
KLLA0E02772g complement(261895..262749) similar to sp|Q12375 Sac...    70   1e-13
CAGL0D01606g complement(169066..169983) highly similar to sp|P32...    70   1e-13
Scas_721.129                                                           70   2e-13
YBR291C (CTP1) [469] chr2 complement(783631..784530) Mitochondri...    70   2e-13
YMR166C (YMR166C) [4121] chr13 complement(593366..594472) Member...    70   3e-13
Scas_589.10                                                            69   3e-13
YJR077C (MIR1) [2970] chr10 complement(577169..578104) Phosphate...    69   4e-13
KLLA0E18810g 1663220..1664353 some similarities with sp|P38152 S...    69   5e-13
AFR147C [3339] [Homologous to NOHBY] (703270..704217) [948 bp, 3...    69   5e-13
Scas_669.6                                                             69   6e-13
CAGL0L02079g 243467..244360 highly similar to sp|P38152 Saccharo...    68   8e-13
CAGL0F00231g 29705..30628 highly similar to sp|P23641 Saccharomy...    68   8e-13
AFR146W [3338] [Homologous to ScYOR130C (ORT1) - SH] complement(...    68   9e-13
Scas_489.4                                                             68   9e-13
Sklu_1926.2 YPR058W, Contig c1926 347-1264 reverse complement          68   1e-12
CAGL0F07711g complement(751794..752900) similar to sp|Q03829 Sac...    68   1e-12
ADL264C [1477] [Homologous to ScYOR100C (CRC1) - SH] (241532..24...    68   1e-12
ACR109W [1156] [Homologous to ScYOR222W (ODC2) - SH; ScYPL134C (...    67   2e-12
CAGL0K10362g complement(1009155..1010060) similar to sp|Q12375 S...    67   3e-12
CAGL0H03839g 359987..360835 highly similar to sp|P38921 Saccharo...    66   4e-12
Kwal_27.11419                                                          66   4e-12
CAGL0H10538g 1027739..1028632 highly similar to tr|Q07534 Saccha...    65   5e-12
CAGL0G01166g complement(111298..112185) highly similar to tr|Q06...    65   5e-12
YNL003C (PET8) [4582] chr14 complement(624974..625828) Protein o...    65   7e-12
CAGL0B04543g 441599..442552 highly similar to tr|Q12289 Saccharo...    65   7e-12
AFL196W [2999] [Homologous to ScYMR166C - SH] complement(66955.....    65   9e-12
YPR058W (YMC1) [5488] chr16 (673746..674669) Member of the mitoc...    65   9e-12
YLR348C (DIC1) [3731] chr12 complement(826976..827872) Mitochond...    65   9e-12
KLLA0D09889g complement(834904..835998) similar to sp|Q03829 Sac...    65   1e-11
Scas_697.47                                                            65   1e-11
CAGL0F08305g complement(827705..828829) similar to sp|P53320 Sac...    65   2e-11
YPL134C (ODC1) [5311] chr16 complement(298570..299502) 2-Oxodica...    64   2e-11
YBR104W (YMC2) [293] chr2 (449624..450613) Member of the mitocho...    64   2e-11
Kwal_55.21335                                                          64   2e-11
Kwal_0.232                                                             63   4e-11
KLLA0F17864g complement(1634241..1635164) similar to sp|P32331 S...    63   6e-11
Scas_328.1                                                             62   6e-11
YOR100C (CRC1) [4905] chr15 complement(513295..514278) Mitochond...    62   8e-11
Scas_673.17                                                            62   9e-11
Sklu_1119.1 YJR077C, Contig c1119 366-1289                             62   1e-10
Kwal_27.12599                                                          62   1e-10
AAL014C [173] [Homologous to ScYNL003C (PET8) - SH] (317388..318...    62   1e-10
Sklu_2398.4 , Contig c2398 9476-10405                                  62   1e-10
Sklu_2115.4 YDL119C, Contig c2115 2906-3805                            62   1e-10
Scas_558.2                                                             61   1e-10
Sklu_2432.5 YLR348C, Contig c2432 10310-11176 reverse complement       61   2e-10
CAGL0J04114g complement(384321..385232) similar to sp|Q99297 Sac...    61   2e-10
Kwal_56.23011                                                          60   5e-10
Kwal_47.19228                                                          59   7e-10
Kwal_23.3529                                                           59   1e-09
Sklu_2435.2 YPR128C, Contig c2435 2489-3523 reverse complement         59   1e-09
KLLA0E09680g complement(860245..861168) similar to ca|CA5146|CaY...    59   1e-09
Kwal_33.15446                                                          58   2e-09
KLLA0B12826g 1121106..1122065 similar to sp|P32332 Saccharomyces...    58   2e-09
KLLA0B08503g complement(753498..754409) similar to sp|P32331 Sac...    58   3e-09
Kwal_33.12988                                                          57   5e-09
Kwal_33.15597                                                          57   5e-09
Sklu_2075.3 , Contig c2075 6414-7451 reverse complement                56   8e-09
AFR253W [3445] [Homologous to ScYFR045W - SH] complement(892939....    56   9e-09
Kwal_23.2913                                                           56   1e-08
Kwal_55.21106                                                          56   1e-08
KLLA0E02750g 260854..261768 similar to ca|CA6127|IPF149 Candida ...    56   1e-08
ABL023W [569] [Homologous to ScYKL120W (OAC1) - SH] complement(3...    55   2e-08
KLLA0D04950g 424550..425374 similar to sp|P38921 Saccharomyces c...    55   2e-08
Sklu_2127.5 YOR130C, Contig c2127 7354-8190 reverse complement         55   2e-08
ADR036C [1777] [Homologous to ScYPR128C (ANT1) - SH] (771097..77...    54   4e-08
AER450C [2950] [Homologous to ScYJR077C (MIR1) - SH] (1500683..1...    54   4e-08
Scas_714.18                                                            53   9e-08
KLLA0B14454g complement(1268709..1269626) highly similar to sp|P...    53   1e-07
YPR128C (ANT1) [5547] chr16 complement(791212..792198) Peroxisom...    52   2e-07
Scas_702.10                                                            52   3e-07
Sklu_2433.8 YFR045W, Contig c2433 11995-13257 reverse complement       51   6e-07
Kwal_23.5757                                                           50   8e-07
KLLA0B11319g 988293..989360 similar to sgd|S0006332 Saccharomyce...    50   1e-06
Scas_687.15*                                                           50   1e-06
Scas_715.45                                                            50   1e-06
CAGL0C02013g complement(209930..210919) weakly similar to sp|P38...    50   1e-06
KLLA0A00979g complement(92561..93592) weakly similar to sp|P3815...    50   1e-06
AGL064W [4247] [Homologous to ScYBR291C (CTP1) - SH] complement(...    49   2e-06
YDL198C (GGC1) [676] chr4 complement(103650..104552) Member of t...    48   3e-06
Sklu_2260.5 YER053C, Contig c2260 6981-7889 reverse complement         47   7e-06
Sklu_2442.8 YNL003C, Contig c2442 12309-13136                          47   9e-06
Scas_562.12                                                            46   2e-05
YER053C (PIC2) [1481] chr5 complement(258736..259638) Member of ...    46   2e-05
CAGL0D04774g complement(467712..468680) similar to tr|Q06497 Sac...    44   7e-05
Scas_696.9                                                             44   9e-05
YDL119C (YDL119C) [751] chr4 complement(246689..247612) Member o...    44   1e-04
Sklu_2117.2 YDL198C, Contig c2117 3737-4633                            43   2e-04
YFR045W (YFR045W) [1727] chr6 (242129..242986) Member of the mit...    42   2e-04
CAGL0B03883g 383602..384522 weakly similar to sp|P32331 Saccharo...    42   3e-04
KLLA0F13464g 1246646..1247548 highly similar to sp|P38988 Saccha...    42   3e-04
AFR542W [3734] [Homologous to ScYMR241W (YHM2) - SH] complement(...    42   5e-04
Scas_705.9                                                             42   5e-04
Kwal_27.11626                                                          41   8e-04
CAGL0K07436g complement(734496..735419) highly similar to sp|Q04...    40   0.001
YMR241W (YHM2) [4197] chr13 (751960..752904) Suppressor of abf1 ...    40   0.001
Kwal_34.15907                                                          40   0.001
Scas_613.24                                                            39   0.002
CAGL0J09790g complement(957759..958661) highly similar to sp|P38...    39   0.004
Sklu_2194.3 YMR241W, Contig c2194 5245-6183                            39   0.004
AGR191W [4502] [Homologous to ScYDL198C (YHM1) - SH] complement(...    38   0.006
KLLA0F08547g 796328..797254 similar to sp|Q04013 Saccharomyces c...    37   0.010
Scas_671.1*                                                            35   0.027
Sklu_2436.18 YDR470C, Contig c2436 37947-39431 reverse complement      32   0.64 
AER193W [2695] [Homologous to ScYCR009C (RVS161) - SH] complemen...    32   0.71 
Sklu_2127.4 , Contig c2127 6322-7293                                   30   1.9  
Scas_560.11*                                                           30   2.7  
KLLA0F26477g complement(2453526..2456141) similar to sp|P37296 S...    30   3.0  
Scas_433.1                                                             28   8.8  

>Sklu_2363.2 YPR011C, Contig c2363 11969-12940
          Length = 323

 Score =  649 bits (1673), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 315/323 (97%), Positives = 315/323 (97%)

Query: 1   MSELAQVLPQPSYVKSILKNDSNVAFXXXXXXXXVSRTVVSPFERVKILLQVQNSTTAYN 60
           MSELAQVLPQPSYVKSILKNDSNVAF        VSRTVVSPFERVKILLQVQNSTTAYN
Sbjct: 1   MSELAQVLPQPSYVKSILKNDSNVAFLAGGLAGAVSRTVVSPFERVKILLQVQNSTTAYN 60

Query: 61  QGIVGAVRQVYREEGTPGLFRGNGLNCIRIFPYSAVQFVVYEACKKHFFHVDGSKGREQL 120
           QGIVGAVRQVYREEGTPGLFRGNGLNCIRIFPYSAVQFVVYEACKKHFFHVDGSKGREQL
Sbjct: 61  QGIVGAVRQVYREEGTPGLFRGNGLNCIRIFPYSAVQFVVYEACKKHFFHVDGSKGREQL 120

Query: 121 QNWQRLFSGALCGGCSVLATYPLDLVRTRLSIQTANLTKLSKSRAHNISKPPGVWDLLCR 180
           QNWQRLFSGALCGGCSVLATYPLDLVRTRLSIQTANLTKLSKSRAHNISKPPGVWDLLCR
Sbjct: 121 QNWQRLFSGALCGGCSVLATYPLDLVRTRLSIQTANLTKLSKSRAHNISKPPGVWDLLCR 180

Query: 181 TYKEEGGIKGLYRGVWPTSLGVVPYVALNFAVYEQFKEFMPEGTDNTLANFYKLSIGALS 240
           TYKEEGGIKGLYRGVWPTSLGVVPYVALNFAVYEQFKEFMPEGTDNTLANFYKLSIGALS
Sbjct: 181 TYKEEGGIKGLYRGVWPTSLGVVPYVALNFAVYEQFKEFMPEGTDNTLANFYKLSIGALS 240

Query: 241 GGVAQTVTYPFDLLRRRFQVLAMGGNELGFRYKSVMDALITIGKTEGFRGYYKGLTANLF 300
           GGVAQTVTYPFDLLRRRFQVLAMGGNELGFRYKSVMDALITIGKTEGFRGYYKGLTANLF
Sbjct: 241 GGVAQTVTYPFDLLRRRFQVLAMGGNELGFRYKSVMDALITIGKTEGFRGYYKGLTANLF 300

Query: 301 KVIPSTAVSWLVYEVVCDLMHVW 323
           KVIPSTAVSWLVYEVVCDLMHVW
Sbjct: 301 KVIPSTAVSWLVYEVVCDLMHVW 323

>YPR011C (YPR011C) [5447] chr16 complement(583057..584037) Protein
           with similarity to human Grave's disease carrier protein
           and to bovine homolog of Grave's disease protein, member
           of the mitochondrial carrier family (MCF) of membrane
           transporters [981 bp, 326 aa]
          Length = 326

 Score =  501 bits (1291), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 240/326 (73%), Positives = 276/326 (84%), Gaps = 3/326 (0%)

Query: 1   MSELAQVLPQPSYVKSILKNDSNVAFXXXXXXXXVSRTVVSPFERVKILLQVQNSTTAYN 60
           M+E+  VL QP+ +K  LK DSN+AF        VSRTVVSPFERVKILLQVQ+STT+YN
Sbjct: 1   MAEVLTVLEQPNSIKDFLKQDSNIAFLAGGVAGAVSRTVVSPFERVKILLQVQSSTTSYN 60

Query: 61  QGIVGAVRQVYREEGTPGLFRGNGLNCIRIFPYSAVQFVVYEACKKHFFHVDGSKGREQL 120
           +GI  ++RQVY EEGT GLFRGNGLNCIRIFPYSAVQFVVYEACKK  FHV+G+ G+EQL
Sbjct: 61  RGIFSSIRQVYHEEGTKGLFRGNGLNCIRIFPYSAVQFVVYEACKKKLFHVNGNNGQEQL 120

Query: 121 QNWQRLFSGALCGGCSVLATYPLDLVRTRLSIQTANLTKLSKSRAHNISKPPGVWDLLCR 180
            N QRLFSGALCGGCSV+ATYPLDL++TRLSIQTANL+ L++S+A +ISKPPG+W LL  
Sbjct: 121 TNTQRLFSGALCGGCSVVATYPLDLIKTRLSIQTANLSSLNRSKAKSISKPPGIWQLLSE 180

Query: 181 TYKEEGGIKGLYRGVWPTSLGVVPYVALNFAVYEQFKEFMPEGTD---NTLANFYKLSIG 237
           TY+ EGG++GLYRGVWPTSLGVVPYVALNFAVYEQ +EF    +D   +  +N YKL+IG
Sbjct: 181 TYRLEGGLRGLYRGVWPTSLGVVPYVALNFAVYEQLREFGVNSSDAQPSWKSNLYKLTIG 240

Query: 238 ALSGGVAQTVTYPFDLLRRRFQVLAMGGNELGFRYKSVMDALITIGKTEGFRGYYKGLTA 297
           A+SGGVAQT+TYPFDLLRRRFQVLAMGGNELGFRY SV DAL+TIG+ EG  GYYKGL A
Sbjct: 241 AISGGVAQTITYPFDLLRRRFQVLAMGGNELGFRYTSVWDALVTIGRAEGVSGYYKGLAA 300

Query: 298 NLFKVIPSTAVSWLVYEVVCDLMHVW 323
           NLFKV+PSTAVSWLVYEVVCD +  W
Sbjct: 301 NLFKVVPSTAVSWLVYEVVCDSVRNW 326

>CAGL0J01661g 154646..155629 highly similar to tr|Q12251
           Saccharomyces cerevisiae YPR011c, start by similarity
          Length = 327

 Score =  497 bits (1279), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 242/329 (73%), Positives = 273/329 (82%), Gaps = 8/329 (2%)

Query: 1   MSELAQVLP---QPSYVKSILKNDSNVAFXXXXXXXXVSRTVVSPFERVKILLQVQNSTT 57
           MSE+  +LP   + + +K+ LK D+NVAF        +SRTVVSPFERVKILLQVQ+STT
Sbjct: 1   MSEV--ILPAIEEENQLKNFLKQDTNVAFLAGGIAGAISRTVVSPFERVKILLQVQSSTT 58

Query: 58  AYNQGIVGAVRQVYREEGTPGLFRGNGLNCIRIFPYSAVQFVVYEACKKHFFHVDGSKGR 117
           AYN+G+  A+ QVY+EE   GLFRGNGLNCIR+FPYSAVQFVV+E CKKH FHVD     
Sbjct: 59  AYNKGLFDAIGQVYKEENIKGLFRGNGLNCIRVFPYSAVQFVVFEGCKKHIFHVDTKGKG 118

Query: 118 EQLQNWQRLFSGALCGGCSVLATYPLDLVRTRLSIQTANLTKLSKSRAHNISKPPGVWDL 177
           EQL NWQRLFSGALCGGCSV+ATYPLDLVRTRLS+QTANL+KLSKSRA +I+KPPGVW L
Sbjct: 119 EQLNNWQRLFSGALCGGCSVVATYPLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKL 178

Query: 178 LCRTYKEEGGIKGLYRGVWPTSLGVVPYVALNFAVYEQFKEFMP---EGTDNTLANFYKL 234
           L + Y EEGGI GLYRGVWPTSLG+VPYVALNFAVYEQ KEFMP    G  +   + YKL
Sbjct: 179 LSKAYAEEGGIMGLYRGVWPTSLGIVPYVALNFAVYEQLKEFMPSDENGNSSMRDSLYKL 238

Query: 235 SIGALSGGVAQTVTYPFDLLRRRFQVLAMGGNELGFRYKSVMDALITIGKTEGFRGYYKG 294
           S+GA+SGGVAQT+TYPFDLLRRRFQVLAMGGNELGF Y SV DAL+TIGKTEGF+GYYKG
Sbjct: 239 SMGAISGGVAQTITYPFDLLRRRFQVLAMGGNELGFHYNSVWDALVTIGKTEGFKGYYKG 298

Query: 295 LTANLFKVIPSTAVSWLVYEVVCDLMHVW 323
           LTANLFKV+PSTAVSWLVYE+  D M  W
Sbjct: 299 LTANLFKVVPSTAVSWLVYELTWDYMKRW 327

>Kwal_14.2210
          Length = 315

 Score =  443 bits (1140), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 222/308 (72%), Positives = 254/308 (82%), Gaps = 3/308 (0%)

Query: 15  KSILKNDSNVAFXXXXXXXXVSRTVVSPFERVKILLQVQNSTTAYNQGIVGAVRQVYREE 74
           +  LK+D+ +AF        VSRTVVSPFERVKILLQVQ+ST AYN G+  AV+QVY EE
Sbjct: 10  RCALKSDAGIAFCAGGIAGAVSRTVVSPFERVKILLQVQSSTHAYNHGLFRAVKQVYLEE 69

Query: 75  GTPGLFRGNGLNCIRIFPYSAVQFVVYEACKKHFFHVDGSKGREQLQNWQRLFSGALCGG 134
           G PGL RGNGLNCIRIFPYSAVQF+VYE CKK +F  +       + NW RL SGALCGG
Sbjct: 70  GVPGLLRGNGLNCIRIFPYSAVQFLVYEFCKKQWFQQNPDT---VVLNWHRLVSGALCGG 126

Query: 135 CSVLATYPLDLVRTRLSIQTANLTKLSKSRAHNISKPPGVWDLLCRTYKEEGGIKGLYRG 194
           CSVLATYPLDLVRTRLSIQTANL +L K++A + +KPPGVW+LL +TY +EGGI GLYRG
Sbjct: 127 CSVLATYPLDLVRTRLSIQTANLARLHKAKAASAAKPPGVWELLRKTYTQEGGIFGLYRG 186

Query: 195 VWPTSLGVVPYVALNFAVYEQFKEFMPEGTDNTLANFYKLSIGALSGGVAQTVTYPFDLL 254
           VWPTS+GVVPYVALNFAVYEQ +E++P   D   A+ YKLSIGA+SGGVAQT+TYPFDLL
Sbjct: 187 VWPTSIGVVPYVALNFAVYEQLREYIPASFDPASASLYKLSIGAISGGVAQTITYPFDLL 246

Query: 255 RRRFQVLAMGGNELGFRYKSVMDALITIGKTEGFRGYYKGLTANLFKVIPSTAVSWLVYE 314
           RRRFQVLAMG +ELGF YKSV DALITIG+TEGF+GYYKGLTANLFKV+PSTAVSW+VYE
Sbjct: 247 RRRFQVLAMGQSELGFHYKSVPDALITIGRTEGFKGYYKGLTANLFKVVPSTAVSWVVYE 306

Query: 315 VVCDLMHV 322
            V D M +
Sbjct: 307 TVRDYMQL 314

>AGL047C [4264] [Homologous to ScYPR011C - NSH] (616853..617803)
           [951 bp, 316 aa]
          Length = 316

 Score =  408 bits (1048), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 207/315 (65%), Positives = 249/315 (79%), Gaps = 2/315 (0%)

Query: 8   LPQP-SYVKSILKNDSNVAFXXXXXXXXVSRTVVSPFERVKILLQVQNSTTAYNQGIVGA 66
           + QP +Y++++ KND  +AF        VSRTVVSP ERVKILLQVQ+STTAYN G+V A
Sbjct: 1   MGQPENYIQTVYKNDGFIAFVAGGVGGAVSRTVVSPVERVKILLQVQSSTTAYNGGLVHA 60

Query: 67  VRQVYREEGTPGLFRGNGLNCIRIFPYSAVQFVVYEACKKHFFHVDGSKGREQLQNWQRL 126
           V+QVY+EEG  GLFRGNG+NC+RIFPYSAVQ+ VYE CK   FHV G  G EQL++W+RL
Sbjct: 61  VKQVYKEEGVKGLFRGNGINCLRIFPYSAVQYAVYEFCKTRVFHV-GQSGHEQLRSWERL 119

Query: 127 FSGALCGGCSVLATYPLDLVRTRLSIQTANLTKLSKSRAHNISKPPGVWDLLCRTYKEEG 186
             GAL GG SVL TYPLDLVRTRLSIQTANL KL +S+AH+I +PPG+ +LL R ++EEG
Sbjct: 120 VGGALGGGASVLVTYPLDLVRTRLSIQTANLAKLHRSKAHDIRRPPGIVELLRRIFREEG 179

Query: 187 GIKGLYRGVWPTSLGVVPYVALNFAVYEQFKEFMPEGTDNTLANFYKLSIGALSGGVAQT 246
           G++G YRGV+PTSLGVVP+VALNFA+YE+ K  +P   D       KL+IGA+SGG+AQT
Sbjct: 180 GLRGWYRGVYPTSLGVVPFVALNFALYERLKALIPHDYDAGSVAAAKLAIGAVSGGIAQT 239

Query: 247 VTYPFDLLRRRFQVLAMGGNELGFRYKSVMDALITIGKTEGFRGYYKGLTANLFKVIPST 306
           V YPFDLLRRRFQVL MG +ELGFRY SV DAL TIG+ EG RGYYKGLTANL KV+P+ 
Sbjct: 240 VVYPFDLLRRRFQVLTMGQSELGFRYASVADALWTIGRQEGLRGYYKGLTANLVKVVPAM 299

Query: 307 AVSWLVYEVVCDLMH 321
           AV W VYE++ + MH
Sbjct: 300 AVQWFVYELISENMH 314

>KLLA0D04290g 366536..367102 similar to sgd|S0006215 Saccharomyces
           cerevisiae YPR011c, hypothetical start
          Length = 188

 Score =  297 bits (760), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 139/186 (74%), Positives = 161/186 (86%)

Query: 14  VKSILKNDSNVAFXXXXXXXXVSRTVVSPFERVKILLQVQNSTTAYNQGIVGAVRQVYRE 73
           +K + K +S++AF        VSRTVVSPFERVKILLQVQ+ST+AYN GI+ AV QVY+E
Sbjct: 3   LKQLAKQESSIAFIAGGVAGAVSRTVVSPFERVKILLQVQSSTSAYNHGIINAVGQVYKE 62

Query: 74  EGTPGLFRGNGLNCIRIFPYSAVQFVVYEACKKHFFHVDGSKGREQLQNWQRLFSGALCG 133
           EG  GLFRGNGLNC+RIFPYSAVQFVVYE CKKH FHVDG+ G+EQL NWQRL +GALCG
Sbjct: 63  EGVAGLFRGNGLNCVRIFPYSAVQFVVYEWCKKHIFHVDGTVGKEQLLNWQRLSAGALCG 122

Query: 134 GCSVLATYPLDLVRTRLSIQTANLTKLSKSRAHNISKPPGVWDLLCRTYKEEGGIKGLYR 193
           G SVLATYPLDLVRTRLSIQTANL KLSKS+A +I+KPPGVW+LL +T+KEEGGI+GLYR
Sbjct: 123 GMSVLATYPLDLVRTRLSIQTANLAKLSKSKAKDIAKPPGVWELLVKTFKEEGGIRGLYR 182

Query: 194 GVWPTS 199
           G++PTS
Sbjct: 183 GIYPTS 188

 Score = 71.6 bits (174), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 57/182 (31%), Positives = 87/182 (47%), Gaps = 24/182 (13%)

Query: 126 LFSGALCGGCSVLATYPLDLVRTRLSIQTANLTKLSKSRAHNISKPPGVWDLLCRTYKEE 185
             +G + G  S     P + V+  L +Q       S + A+N     G+ + + + YKEE
Sbjct: 15  FIAGGVAGAVSRTVVSPFERVKILLQVQ-------SSTSAYN----HGIINAVGQVYKEE 63

Query: 186 GGIKGLYRGVWPTSLGVVPYVALNFAVYEQFKE--FMPEGT--DNTLANFYKLSIGALSG 241
           G + GL+RG     + + PY A+ F VYE  K+  F  +GT     L N+ +LS GAL G
Sbjct: 64  G-VAGLFRGNGLNCVRIFPYSAVQFVVYEWCKKHIFHVDGTVGKEQLLNWQRLSAGALCG 122

Query: 242 GVAQTVTYPFDLLRRRFQVLAMGGNELG-------FRYKSVMDALITIGKTE-GFRGYYK 293
           G++   TYP DL+R R  +      +L         +   V + L+   K E G RG Y+
Sbjct: 123 GMSVLATYPLDLVRTRLSIQTANLAKLSKSKAKDIAKPPGVWELLVKTFKEEGGIRGLYR 182

Query: 294 GL 295
           G+
Sbjct: 183 GI 184

 Score = 39.7 bits (91), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/78 (28%), Positives = 42/78 (53%), Gaps = 4/78 (5%)

Query: 237 GALSGGVAQTVTYPFDLLRRRFQVLAMGGNELGFRYKSVMDALITIGKTEGFRGYYKGLT 296
           G ++G V++TV  PF+    R ++L    +        +++A+  + K EG  G ++G  
Sbjct: 18  GGVAGAVSRTVVSPFE----RVKILLQVQSSTSAYNHGIINAVGQVYKEEGVAGLFRGNG 73

Query: 297 ANLFKVIPSTAVSWLVYE 314
            N  ++ P +AV ++VYE
Sbjct: 74  LNCVRIFPYSAVQFVVYE 91

>KLLA0D04312g 367160..367471 highly similar to sgd|S0006215
           Saccharomyces cerevisiae YPR011c, hypothetical start
          Length = 103

 Score =  171 bits (433), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 83/100 (83%), Positives = 90/100 (90%)

Query: 224 TDNTLANFYKLSIGALSGGVAQTVTYPFDLLRRRFQVLAMGGNELGFRYKSVMDALITIG 283
           TD  LAN YKL++GA+SGGVAQT+ YPFDLLRRRFQVLAMGGNELGFRYKSV DALITIG
Sbjct: 4   TDPNLANLYKLAMGAISGGVAQTLVYPFDLLRRRFQVLAMGGNELGFRYKSVSDALITIG 63

Query: 284 KTEGFRGYYKGLTANLFKVIPSTAVSWLVYEVVCDLMHVW 323
           KTEG +GYYKGLTANLFKVIPSTAVSWLVYEV+ + M  W
Sbjct: 64  KTEGPKGYYKGLTANLFKVIPSTAVSWLVYEVIREAMVEW 103

 Score = 46.6 bits (109), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 34/104 (32%), Positives = 49/104 (47%), Gaps = 8/104 (7%)

Query: 119 QLQNWQRLFSGALCGGCSVLATYPLDLVRTRLSIQTANLTKLSKSRAHNISKPPGVWDLL 178
            L N  +L  GA+ GG +    YP DL+R R  +      +L   R  ++S      D L
Sbjct: 7   NLANLYKLAMGAISGGVAQTLVYPFDLLRRRFQVLAMGGNELG-FRYKSVS------DAL 59

Query: 179 CRTYKEEGGIKGLYRGVWPTSLGVVPYVALNFAVYEQFKEFMPE 222
               K EG  KG Y+G+      V+P  A+++ VYE  +E M E
Sbjct: 60  ITIGKTEGP-KGYYKGLTANLFKVIPSTAVSWLVYEVIREAMVE 102

 Score = 36.6 bits (83), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 20/76 (26%), Positives = 40/76 (52%), Gaps = 4/76 (5%)

Query: 35  VSRTVVSPFE----RVKILLQVQNSTTAYNQGIVGAVRQVYREEGTPGLFRGNGLNCIRI 90
           V++T+V PF+    R ++L    N      + +  A+  + + EG  G ++G   N  ++
Sbjct: 23  VAQTLVYPFDLLRRRFQVLAMGGNELGFRYKSVSDALITIGKTEGPKGYYKGLTANLFKV 82

Query: 91  FPYSAVQFVVYEACKK 106
            P +AV ++VYE  ++
Sbjct: 83  IPSTAVSWLVYEVIRE 98

>YHR002W (LEU5) [2287] chr8 (108806..109879) Protein with similarity
           to Grave's disease protein, member of the mitochondrial
           carrier (MCF) family of membrane transporters [1074 bp,
           357 aa]
          Length = 357

 Score =  155 bits (392), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 100/308 (32%), Positives = 151/308 (49%), Gaps = 34/308 (11%)

Query: 36  SRTVVSPFERVKILLQVQNST-TAYNQGIVG---AVRQVYREEGTPGLFRGNGLNCIRIF 91
           ++T+++P +R+KIL Q  N   T Y   ++G   A + ++  +G  G F+G+    +RIF
Sbjct: 47  AKTLIAPLDRIKILFQTSNPHYTKYTGSLIGLVEAAKHIWINDGVRGFFQGHSATLLRIF 106

Query: 92  PYSAVQFVVYEACKKHFFHVDGSKGREQLQNWQRLFSGALCGGCSVLATYPLDLVRTRLS 151
           PY+AV+FV YE  +           +E   +W+RL SG+L G CSV  TYPLDLVR RL+
Sbjct: 107 PYAAVKFVAYEQIRNTLI-----PSKEFESHWRRLVSGSLAGLCSVFITYPLDLVRVRLA 161

Query: 152 IQTANLTKLSKSRAHNISKPPGVWDLLCRTYKEEGGIK--GLYRGVWPTSLGVVPYVALN 209
            +T +           I K P    L+   Y           YRG  PT LG++PY  ++
Sbjct: 162 YETEHKRVKLGRIIKKIYKEPASATLIKNDYIPNWFCHWCNFYRGYVPTVLGMIPYAGVS 221

Query: 210 FAVYEQFKE------FMPEGT-----DNTLANFYK-----------LSIGALSGGVAQTV 247
           F  ++   +      F P        D+ L    K           L  G L+G  +QT 
Sbjct: 222 FFAHDLLHDVLKSPFFAPYSVLELSEDDELERVQKKQRRPLRTWAELISGGLAGMASQTA 281

Query: 248 TYPFDLLRRRFQVLAMGGNEL-GFRYKSVMDALITIGKTEGFRGYYKGLTANLFKVIPST 306
            YPF+++RRR QV A+    +   +++S+ +    I K  G RG++ GL+    KV P  
Sbjct: 282 AYPFEIIRRRLQVSALSPKTMYDHKFQSISEIAHIIFKERGVRGFFVGLSIGYIKVTPMV 341

Query: 307 AVSWLVYE 314
           A S+ VYE
Sbjct: 342 ACSFFVYE 349

 Score = 59.3 bits (142), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 46/204 (22%), Positives = 89/204 (43%), Gaps = 19/204 (9%)

Query: 127 FSGALCGGCSVLATYPLDLVRTRLSIQTANLTKLSKSRAHNISKPPGVWDLLCRTYKEEG 186
            +G + G C+     PLD ++        + TK + S    +     +W           
Sbjct: 38  LAGGISGSCAKTLIAPLDRIKILFQTSNPHYTKYTGSLIGLVEAAKHIWI--------ND 89

Query: 187 GIKGLYRGVWPTSLGVVPYVALNFAVYEQFKEFMPEGTDNTLANFYKLSIGALSGGVAQT 246
           G++G ++G   T L + PY A+ F  YEQ +  +    +   +++ +L  G+L+G  +  
Sbjct: 90  GVRGFFQGHSATLLRIFPYAAVKFVAYEQIRNTLIPSKEFE-SHWRRLVSGSLAGLCSVF 148

Query: 247 VTYPFDLLRRRFQVLAMGGN-ELGFRYKSVMD--ALITIGKTE-------GFRGYYKGLT 296
           +TYP DL+R R          +LG   K +    A  T+ K +        +  +Y+G  
Sbjct: 149 ITYPLDLVRVRLAYETEHKRVKLGRIIKKIYKEPASATLIKNDYIPNWFCHWCNFYRGYV 208

Query: 297 ANLFKVIPSTAVSWLVYEVVCDLM 320
             +  +IP   VS+  ++++ D++
Sbjct: 209 PTVLGMIPYAGVSFFAHDLLHDVL 232

 Score = 57.0 bits (136), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 47/213 (22%), Positives = 86/213 (40%), Gaps = 43/213 (20%)

Query: 39  VVSPFERVKILLQVQNSTTAYNQGIVGAVRQVYREEGTPGL----------------FRG 82
           +  P + V++ L  +        G +  ++++Y+E  +  L                +RG
Sbjct: 149 ITYPLDLVRVRLAYETEHKRVKLGRI--IKKIYKEPASATLIKNDYIPNWFCHWCNFYRG 206

Query: 83  NGLNCIRIFPYSAVQF----VVYEACKKHFFHVDG--------------SKGREQLQNWQ 124
                + + PY+ V F    ++++  K  FF                   K R  L+ W 
Sbjct: 207 YVPTVLGMIPYAGVSFFAHDLLHDVLKSPFFAPYSVLELSEDDELERVQKKQRRPLRTWA 266

Query: 125 RLFSGALCGGCSVLATYPLDLVRTRLSIQTANLTKLSKSRAHNISKPPGVWDLLCRTYKE 184
            L SG L G  S  A YP +++R RL +   +   +   +  +IS+       +     +
Sbjct: 267 ELISGGLAGMASQTAAYPFEIIRRRLQVSALSPKTMYDHKFQSISE-------IAHIIFK 319

Query: 185 EGGIKGLYRGVWPTSLGVVPYVALNFAVYEQFK 217
           E G++G + G+    + V P VA +F VYE+ K
Sbjct: 320 ERGVRGFFVGLSIGYIKVTPMVACSFFVYERMK 352

 Score = 40.0 bits (92), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 38/78 (48%), Gaps = 5/78 (6%)

Query: 36  SRTVVSPFERVKILLQVQ--NSTTAYN---QGIVGAVRQVYREEGTPGLFRGNGLNCIRI 90
           S+T   PFE ++  LQV   +  T Y+   Q I      +++E G  G F G  +  I++
Sbjct: 278 SQTAAYPFEIIRRRLQVSALSPKTMYDHKFQSISEIAHIIFKERGVRGFFVGLSIGYIKV 337

Query: 91  FPYSAVQFVVYEACKKHF 108
            P  A  F VYE  K +F
Sbjct: 338 TPMVACSFFVYERMKWNF 355

>Scas_717.20
          Length = 356

 Score =  154 bits (389), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 96/308 (31%), Positives = 152/308 (49%), Gaps = 34/308 (11%)

Query: 36  SRTVVSPFERVKILLQVQNST-TAYNQGIVG---AVRQVYREEGTPGLFRGNGLNCIRIF 91
           ++T+++P +R+KIL Q  N   T Y   +VG   A + ++  +G  G F+G+ +  +RIF
Sbjct: 46  AKTLIAPLDRIKILFQTSNPHYTKYAGSLVGLKEAAKHIWLNDGIRGFFQGHSVTLMRIF 105

Query: 92  PYSAVQFVVYEACKKHFFHVDGSKGREQLQNWQRLFSGALCGGCSVLATYPLDLVRTRLS 151
           PY+AV+FV YE  +           +E   +W+RL SG+L G CSV  TYPLDL+R RL+
Sbjct: 106 PYAAVKFVAYEQIRNTLI-----PSKEYESHWRRLMSGSLAGLCSVFTTYPLDLIRVRLA 160

Query: 152 IQTANLTKLSKSRAHNISKPPGVWDLLCRTYKEE--GGIKGLYRGVWPTSLGVVPYVALN 209
             T +           I K P    L  + Y           YRG  PT LG++PY  ++
Sbjct: 161 YVTEHKRISLLGLVKTIYKEPASTTLEAKGYIPNWFAHWCNFYRGYTPTVLGMIPYAGVS 220

Query: 210 FAVYEQFKEFMP----------------------EGTDNTLANFYKLSIGALSGGVAQTV 247
           F  ++   + +                       +     L  + +L  G L+G  +QT 
Sbjct: 221 FFAHDLLHDVLKHPILAPYSVLALSESEQEERHFKHQRLPLRTWAELLSGGLAGMASQTA 280

Query: 248 TYPFDLLRRRFQVLAMGGNEL-GFRYKSVMDALITIGKTEGFRGYYKGLTANLFKVIPST 306
            YPF+++RRR QV  +  +++   R++S+ +    I K  G+RG++ GL+    KV P  
Sbjct: 281 AYPFEIIRRRLQVSTLSVSQMYDHRFQSISEIAKIIYKERGWRGFFVGLSIGYIKVTPMV 340

Query: 307 AVSWLVYE 314
           A S+ VYE
Sbjct: 341 ACSFFVYE 348

 Score = 64.7 bits (156), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 39/126 (30%), Positives = 63/126 (50%), Gaps = 12/126 (9%)

Query: 92  PYSAVQFVVYEACKKHFFHVDGSKGREQLQNWQRLFSGALCGGCSVLATYPLDLVRTRLS 151
           PYS +     E  ++HF H      R  L+ W  L SG L G  S  A YP +++R RL 
Sbjct: 238 PYSVLALSESEQEERHFKH-----QRLPLRTWAELLSGGLAGMASQTAAYPFEIIRRRLQ 292

Query: 152 IQTANLTKLSKSRAHNISKPPGVWDLLCRTYKEEGGIKGLYRGVWPTSLGVVPYVALNFA 211
           + T +++++   R  +IS+       + +   +E G +G + G+    + V P VA +F 
Sbjct: 293 VSTLSVSQMYDHRFQSISE-------IAKIIYKERGWRGFFVGLSIGYIKVTPMVACSFF 345

Query: 212 VYEQFK 217
           VYE+ K
Sbjct: 346 VYERMK 351

 Score = 58.5 bits (140), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 45/204 (22%), Positives = 87/204 (42%), Gaps = 19/204 (9%)

Query: 127 FSGALCGGCSVLATYPLDLVRTRLSIQTANLTKLSKSRAHNISKPPGVWDLLCRTYKEEG 186
            +G + G C+     PLD ++        + TK + S          +W           
Sbjct: 37  LAGGISGSCAKTLIAPLDRIKILFQTSNPHYTKYAGSLVGLKEAAKHIW--------LND 88

Query: 187 GIKGLYRGVWPTSLGVVPYVALNFAVYEQFKEFMPEGTDNTLANFYKLSIGALSGGVAQT 246
           GI+G ++G   T + + PY A+ F  YEQ +  +    +   +++ +L  G+L+G  +  
Sbjct: 89  GIRGFFQGHSVTLMRIFPYAAVKFVAYEQIRNTLIPSKEYE-SHWRRLMSGSLAGLCSVF 147

Query: 247 VTYPFDLLRRRFQVLAMGG--NELGFRYKSVMDALITIGKTEGFR--------GYYKGLT 296
            TYP DL+R R   +      + LG       +   T  + +G+          +Y+G T
Sbjct: 148 TTYPLDLIRVRLAYVTEHKRISLLGLVKTIYKEPASTTLEAKGYIPNWFAHWCNFYRGYT 207

Query: 297 ANLFKVIPSTAVSWLVYEVVCDLM 320
             +  +IP   VS+  ++++ D++
Sbjct: 208 PTVLGMIPYAGVSFFAHDLLHDVL 231

 Score = 41.2 bits (95), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 38/78 (48%), Gaps = 5/78 (6%)

Query: 36  SRTVVSPFERVKILLQVQNSTTA--YN---QGIVGAVRQVYREEGTPGLFRGNGLNCIRI 90
           S+T   PFE ++  LQV   + +  Y+   Q I    + +Y+E G  G F G  +  I++
Sbjct: 277 SQTAAYPFEIIRRRLQVSTLSVSQMYDHRFQSISEIAKIIYKERGWRGFFVGLSIGYIKV 336

Query: 91  FPYSAVQFVVYEACKKHF 108
            P  A  F VYE  K H 
Sbjct: 337 TPMVACSFFVYERMKWHL 354

>CAGL0K02915g 259026..260054 highly similar to sp|P38702
           Saccharomyces cerevisiae YHR002w LEU5, hypothetical
           start
          Length = 342

 Score =  149 bits (376), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 95/310 (30%), Positives = 152/310 (49%), Gaps = 38/310 (12%)

Query: 36  SRTVVSPFERVKILLQVQNST-TAYNQGIVG---AVRQVYREEGTPGLFRGNGLNCIRIF 91
           ++T+++P +R+KIL Q  N   + Y   +VG   A + ++  +G  G F+G+ +  +RIF
Sbjct: 32  AKTLIAPLDRIKILFQTSNPHYSKYAGSLVGLYEAAKHIWINDGIRGFFQGHSVTLLRIF 91

Query: 92  PYSAVQFVVYEACKKHFFHVDGSKGREQLQNWQRLFSGALCGGCSVLATYPLDLVRTRLS 151
           PY+AV+FV YE  +           RE   +W+RL SG+L G CSV  TYPLDL R RL+
Sbjct: 92  PYAAVKFVAYEQIRSILI-----PSREYESHWRRLASGSLAGLCSVFITYPLDLTRVRLA 146

Query: 152 IQTAN----LTKLSKSRAHNISKPPGVWDLLCRTYKEEGGIKGLYRGVWPTSLGVVPYVA 207
             T +    L  + K+  H  +       LL   +         YRG  PT LG++PY  
Sbjct: 147 YVTEHKRVKLRDIVKTIYHEPASEGLTSHLLVPKWFAHWC--NFYRGYVPTVLGMIPYAG 204

Query: 208 LNFAVYEQFKEFMPEG----------------------TDNTLANFYKLSIGALSGGVAQ 245
           ++F  ++   + M                             L  + +L  G LSG ++Q
Sbjct: 205 VSFFAHDLIHDIMKSSLMAPYAVKQLSSQEELERKKLRQKTPLRTWAELVAGGLSGILSQ 264

Query: 246 TVTYPFDLLRRRFQVLAMGGNEL-GFRYKSVMDALITIGKTEGFRGYYKGLTANLFKVIP 304
           T  YP +++RRR QV  +   ++   +++S+      I + +G+RG++ GL+    KV P
Sbjct: 265 TAAYPLEIIRRRLQVSTLSPRKMYDHKFQSISSIARIIYQEKGWRGFFVGLSIGYIKVTP 324

Query: 305 STAVSWLVYE 314
             A S+ VYE
Sbjct: 325 MVACSFFVYE 334

 Score = 63.5 bits (153), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 45/207 (21%), Positives = 87/207 (42%), Gaps = 25/207 (12%)

Query: 127 FSGALCGGCSVLATYPLDLVRTRLSIQTANLTKLSKSRAHNISKPPGVWDLLCRTYKEEG 186
            +G + G C+     PLD ++        + +K + S          +W           
Sbjct: 23  LAGGVSGSCAKTLIAPLDRIKILFQTSNPHYSKYAGSLVGLYEAAKHIWI--------ND 74

Query: 187 GIKGLYRGVWPTSLGVVPYVALNFAVYEQFKEFMPEGTDNTLANFYKLSIGALSGGVAQT 246
           GI+G ++G   T L + PY A+ F  YEQ +  +    +   +++ +L+ G+L+G  +  
Sbjct: 75  GIRGFFQGHSVTLLRIFPYAAVKFVAYEQIRSILIPSREYE-SHWRRLASGSLAGLCSVF 133

Query: 247 VTYPFDLLRRRFQVLAMGGNELGFRYKSVMDALITIGKTEGFRG-------------YYK 293
           +TYP DL R R   LA        + + ++  +     +EG                +Y+
Sbjct: 134 ITYPLDLTRVR---LAYVTEHKRVKLRDIVKTIYHEPASEGLTSHLLVPKWFAHWCNFYR 190

Query: 294 GLTANLFKVIPSTAVSWLVYEVVCDLM 320
           G    +  +IP   VS+  ++++ D+M
Sbjct: 191 GYVPTVLGMIPYAGVSFFAHDLIHDIM 217

 Score = 56.6 bits (135), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 46/185 (24%), Positives = 79/185 (42%), Gaps = 41/185 (22%)

Query: 67  VRQVYREEGTPGL----------------FRGNGLNCIRIFPYSAVQF----VVYEACKK 106
           V+ +Y E  + GL                +RG     + + PY+ V F    ++++  K 
Sbjct: 160 VKTIYHEPASEGLTSHLLVPKWFAHWCNFYRGYVPTVLGMIPYAGVSFFAHDLIHDIMKS 219

Query: 107 HFF------------HVDGSKGREQ--LQNWQRLFSGALCGGCSVLATYPLDLVRTRLSI 152
                           ++  K R++  L+ W  L +G L G  S  A YPL+++R RL +
Sbjct: 220 SLMAPYAVKQLSSQEELERKKLRQKTPLRTWAELVAGGLSGILSQTAAYPLEIIRRRLQV 279

Query: 153 QTANLTKLSKSRAHNISKPPGVWDLLCRTYKEEGGIKGLYRGVWPTSLGVVPYVALNFAV 212
            T +  K+   +  +IS        + R   +E G +G + G+    + V P VA +F V
Sbjct: 280 STLSPRKMYDHKFQSISS-------IARIIYQEKGWRGFFVGLSIGYIKVTPMVACSFFV 332

Query: 213 YEQFK 217
           YE+ K
Sbjct: 333 YERMK 337

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 26/79 (32%), Positives = 38/79 (48%), Gaps = 5/79 (6%)

Query: 35  VSRTVVSPFERVKILLQVQNST--TAYN---QGIVGAVRQVYREEGTPGLFRGNGLNCIR 89
           +S+T   P E ++  LQV   +    Y+   Q I    R +Y+E+G  G F G  +  I+
Sbjct: 262 LSQTAAYPLEIIRRRLQVSTLSPRKMYDHKFQSISSIARIIYQEKGWRGFFVGLSIGYIK 321

Query: 90  IFPYSAVQFVVYEACKKHF 108
           + P  A  F VYE  K H 
Sbjct: 322 VTPMVACSFFVYERMKWHL 340

>CAGL0J05522g complement(524930..526489) highly similar to sp|P48233
           Saccharomyces cerevisiae YNL083w, hypothetical start
          Length = 519

 Score =  151 bits (382), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 102/320 (31%), Positives = 153/320 (47%), Gaps = 47/320 (14%)

Query: 35  VSRTVVSPFERVKILLQVQN--STTAYNQG------------------IVGAVRQVYREE 74
           +SRT  +PF+R+K+ L  +   S+T  N                    +V A+  +YR+ 
Sbjct: 213 ISRTCTAPFDRLKVFLIARTDLSSTLLNSTEDVLAKNPHAKPNKLRSPLVKAIISLYRQG 272

Query: 75  GTPGLFRGNGLNCIRIFPYSAVQFVVYEACKKHFFHVDGSKGREQLQNWQRLFSGALCGG 134
           G    + GNGLN +++FP S+++F  +E  KK    V+  K  + L       +G L G 
Sbjct: 273 GIKSFYVGNGLNALKVFPESSIKFGSFEITKKLMTKVENCKDTKDLSKLSTFIAGGLAGV 332

Query: 135 CSVLATYPLDLVRTRLSIQTANLTKLSKSRAHNISKPPGVWDLLCRTYKE---EGGIKGL 191
           C+  + YP+D ++ R+  Q A L    K R            L+ +T KE   EGG+K  
Sbjct: 333 CAQFSVYPIDTLKFRM--QCAPLNAELKGRK-----------LMIQTAKEMYTEGGLKLF 379

Query: 192 YRGVWPTSLGVVPYVALNFAVYEQFKEFM---------PEGTDNTLANFYKLSIGALSGG 242
           YRGV    LG+ PY AL+   +   K++           +  D  L+N   L +GA SG 
Sbjct: 380 YRGVTVGVLGIFPYAALDLGTFSMLKKWYISSKAKKLNKKEEDVELSNLVVLPMGAFSGT 439

Query: 243 VAQTVTYPFDLLRRRFQVLAMGGNELGFRYKSVMDALITIGKTEGFRGYYKGLTANLFKV 302
              TV YP +LLR R Q  A G     +RY    D L+   + EG+ G +KGL   L KV
Sbjct: 440 FGATVVYPINLLRTRLQ--AQGTFAHPYRYDGFRDVLLKTIQREGYPGLFKGLVPTLAKV 497

Query: 303 IPSTAVSWLVYEVVCDLMHV 322
            P+ ++S+L YE +  LM +
Sbjct: 498 CPAVSISYLCYENLKKLMKL 517

 Score = 37.0 bits (84), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 31/131 (23%), Positives = 58/131 (44%), Gaps = 20/131 (15%)

Query: 210 FAVYEQFKEFMPEGTDNTLANFYK----LSIGALSGGVAQTVTYPFD------------- 252
           F ++ +  +   EG    + +F K       G +SG +++T T PFD             
Sbjct: 176 FYLFNEDVDLSSEGDMTLINDFIKGFGFFIAGGISGVISRTCTAPFDRLKVFLIARTDLS 235

Query: 253 --LLRRRFQVLAMGGNELGFRYKS-VMDALITIGKTEGFRGYYKGLTANLFKVIPSTAVS 309
             LL     VLA   +    + +S ++ A+I++ +  G + +Y G   N  KV P +++ 
Sbjct: 236 STLLNSTEDVLAKNPHAKPNKLRSPLVKAIISLYRQGGIKSFYVGNGLNALKVFPESSIK 295

Query: 310 WLVYEVVCDLM 320
           +  +E+   LM
Sbjct: 296 FGSFEITKKLM 306

>AGL065C [4246] [Homologous to ScYHR002W (LEU5) - SH]
           (585963..586970) [1008 bp, 335 aa]
          Length = 335

 Score =  143 bits (360), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 101/304 (33%), Positives = 158/304 (51%), Gaps = 34/304 (11%)

Query: 36  SRTVVSPFERVKILLQVQNSTTAYNQGIVG----AVRQVYREEGTPGLFRGNGLNCIRIF 91
           ++T+V+P +R+KIL Q  N   A   G +G    A + +   +G  G F+G+    +RIF
Sbjct: 33  AKTLVAPLDRIKILFQTSNPQFAQFAGSMGGLVRASKYIMAHDGPRGFFQGHSATLLRIF 92

Query: 92  PYSAVQFVVYEACKKHFFHVDGSKGREQLQNWQRLFSGALCGGCSVLATYPLDLVRTRLS 151
           PY+A++F+ YE  +     V     R +  +W+RL SG+L G CSV  TYPLDLVR RL+
Sbjct: 93  PYAAIKFIAYEQIRS----VVIPTWRHE-SHWRRLLSGSLAGLCSVFVTYPLDLVRVRLA 147

Query: 152 IQTA-NLTKLSKSRAHNISKPPGVWDLLCRTYKEE--GGIKGLYRGVWPTSLGVVPYVAL 208
             T  +  K+ K  A   ++ P   + L + Y  +        YRG  PT +G++PY  +
Sbjct: 148 YVTERHDAKVRKIMACIYNERPS--EALRKWYIPQWFAHWSNFYRGYTPTVIGMIPYAGV 205

Query: 209 NFAVY------------EQFKEFMPEGT---DNT--LANFYKLSIGALSGGVAQTVTYPF 251
           +F  +            E +    P G+   D T  L  + +L  G L+G  +QT  YPF
Sbjct: 206 SFFAHDLCQDIFRHPMLEPYSVLSPGGSSAYDRTVPLKTWAQLVAGGLAGMASQTAAYPF 265

Query: 252 DLLRRRFQVLAMGGNELGFRYKSVMDALITIGKTE-GFRGYYKGLTANLFKVIPSTAVSW 310
           +++RRR QV A+   +   R+   ++ +  I  TE G+RG++ GL+    KV P  A S+
Sbjct: 266 EIIRRRLQVSAI--TDPTRRHFVGINEIAKIIYTEGGWRGFFVGLSIGYIKVTPMVACSF 323

Query: 311 LVYE 314
            +YE
Sbjct: 324 FIYE 327

 Score = 60.1 bits (144), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 41/155 (26%), Positives = 72/155 (46%), Gaps = 22/155 (14%)

Query: 79  LFRGNGLNCIRIFPYSAVQFVVYEACKKHFFHV----------DGSKGREQ---LQNWQR 125
            +RG     I + PY+ V F  ++ C+  F H            GS   ++   L+ W +
Sbjct: 188 FYRGYTPTVIGMIPYAGVSFFAHDLCQDIFRHPMLEPYSVLSPGGSSAYDRTVPLKTWAQ 247

Query: 126 LFSGALCGGCSVLATYPLDLVRTRLSIQTANLTKLSKSRAHNISKPPGVWDLLCRTYKEE 185
           L +G L G  S  A YP +++R RL  Q + +T  ++     I++       + +    E
Sbjct: 248 LVAGGLAGMASQTAAYPFEIIRRRL--QVSAITDPTRRHFVGINE-------IAKIIYTE 298

Query: 186 GGIKGLYRGVWPTSLGVVPYVALNFAVYEQFKEFM 220
           GG +G + G+    + V P VA +F +YE+ K ++
Sbjct: 299 GGWRGFFVGLSIGYIKVTPMVACSFFIYERTKWYL 333

 Score = 58.5 bits (140), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 52/209 (24%), Positives = 89/209 (42%), Gaps = 30/209 (14%)

Query: 127 FSGALCGGCSVLATYPLDLVRTRLSIQTANLTKLSKSRAHNISKPPGVWDLLCRTYK--- 183
            +G + G C+     PLD  R ++  QT+N            ++  G    L R  K   
Sbjct: 24  LAGGIAGSCAKTLVAPLD--RIKILFQTSN---------PQFAQFAGSMGGLVRASKYIM 72

Query: 184 EEGGIKGLYRGVWPTSLGVVPYVALNFAVYEQFKEFMPEGTDNTLANFYKLSIGALSGGV 243
              G +G ++G   T L + PY A+ F  YEQ +  +   T    +++ +L  G+L+G  
Sbjct: 73  AHDGPRGFFQGHSATLLRIFPYAAIKFIAYEQIRSVVIP-TWRHESHWRRLLSGSLAGLC 131

Query: 244 AQTVTYPFDLLRRRFQVLAMGGNELGFRYKSVMDALITIGKTEGFR------------GY 291
           +  VTYP DL+R R   LA        + + +M  +     +E  R             +
Sbjct: 132 SVFVTYPLDLVRVR---LAYVTERHDAKVRKIMACIYNERPSEALRKWYIPQWFAHWSNF 188

Query: 292 YKGLTANLFKVIPSTAVSWLVYEVVCDLM 320
           Y+G T  +  +IP   VS+  +++  D+ 
Sbjct: 189 YRGYTPTVIGMIPYAGVSFFAHDLCQDIF 217

 Score = 38.5 bits (88), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 24/73 (32%), Positives = 34/73 (46%), Gaps = 3/73 (4%)

Query: 36  SRTVVSPFERVKILLQVQNSTTAYNQGIVGA---VRQVYREEGTPGLFRGNGLNCIRIFP 92
           S+T   PFE ++  LQV   T    +  VG     + +Y E G  G F G  +  I++ P
Sbjct: 258 SQTAAYPFEIIRRRLQVSAITDPTRRHFVGINEIAKIIYTEGGWRGFFVGLSIGYIKVTP 317

Query: 93  YSAVQFVVYEACK 105
             A  F +YE  K
Sbjct: 318 MVACSFFIYERTK 330

>Kwal_23.3042
          Length = 542

 Score =  146 bits (369), Expect = 8e-40,   Method: Compositional matrix adjust.
 Identities = 94/310 (30%), Positives = 151/310 (48%), Gaps = 43/310 (13%)

Query: 35  VSRTVVSPFERVKILLQVQNSTTA--------------------YNQGIVGAVRQVYREE 74
           VSRT  +PF+R+K+ L  +   ++                        +V A   +YR+ 
Sbjct: 237 VSRTCTAPFDRIKVFLIARTDLSSTFLKSKDIILEKNPNADLSKIKSPLVKAATTLYRQG 296

Query: 75  GTPGLFRGNGLNCIRIFPYSAVQFVVYEACKKHFFHVDGSKGREQLQNWQRLFSGALCGG 134
           G    + GNGLN +++FP SA++F  +E  K+    ++G +    L  +    +G L G 
Sbjct: 297 GIRAFYVGNGLNAMKVFPESAIKFGSFELAKRLMAQLEGVQDTAGLSRFSTYLAGGLGGV 356

Query: 135 CSVLATYPLDLVRTRLSIQTANLTKLSKSRAHNISKPPGVWDLLCRTYKEEGGIKGLYRG 194
            + L+ YP+D ++ R  +Q A L   SK R   IS    ++        +EGG++  YRG
Sbjct: 357 MAQLSVYPIDTLKYR--VQCAPLNTESKGRQLLISTAKDMY--------KEGGLRIFYRG 406

Query: 195 VWPTSLGVVPYVALNFAVYEQFKEF----------MPEGTDNTLANFYKLSIGALSGGVA 244
           +    +G+ PY A++   +   K++          +PE    T++N + L +GA SG V 
Sbjct: 407 ITVGIMGIFPYAAMDLGTFSALKKWYIARQARLTGLPE-DQVTMSNMFVLLMGAFSGTVG 465

Query: 245 QTVTYPFDLLRRRFQVLAMGGNELGFRYKSVMDALITIGKTEGFRGYYKGLTANLFKVIP 304
            T  YP +LLR R Q  A G      RY    D L+   + EG++G +KGL  NL KV P
Sbjct: 466 ATAVYPVNLLRTRLQ--AQGTFAHPHRYNGFRDVLLKTVQREGYQGLFKGLVPNLAKVCP 523

Query: 305 STAVSWLVYE 314
           + ++S+L YE
Sbjct: 524 AVSISYLCYE 533

 Score = 69.7 bits (169), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 51/188 (27%), Positives = 87/188 (46%), Gaps = 17/188 (9%)

Query: 40  VSPFERVKILLQVQ--NSTTAYNQGIVGAVRQVYREEGTPGLFRGNGLNCIRIFPYSAVQ 97
           V P + +K  +Q    N+ +   Q ++   + +Y+E G    +RG  +  + IFPY+A+ 
Sbjct: 362 VYPIDTLKYRVQCAPLNTESKGRQLLISTAKDMYKEGGLRIFYRGITVGIMGIFPYAAMD 421

Query: 98  FVVYEACKKHFFHVDGS-----KGREQLQNWQRLFSGALCGGCSVLATYPLDLVRTRLSI 152
              + A KK +           + +  + N   L  GA  G     A YP++L+RTRL  
Sbjct: 422 LGTFSALKKWYIARQARLTGLPEDQVTMSNMFVLLMGAFSGTVGATAVYPVNLLRTRLQA 481

Query: 153 QTANLTKLSKSRAHNISKPPGVWDLLCRTYKEEGGIKGLYRGVWPTSLGVVPYVALNFAV 212
           Q       +    +N     G  D+L +T + EG  +GL++G+ P    V P V++++  
Sbjct: 482 QGT----FAHPHRYN-----GFRDVLLKTVQREG-YQGLFKGLVPNLAKVCPAVSISYLC 531

Query: 213 YEQFKEFM 220
           YE  K  M
Sbjct: 532 YENLKRGM 539

 Score = 35.4 bits (80), Expect = 0.058,   Method: Compositional matrix adjust.
 Identities = 28/100 (28%), Positives = 45/100 (45%), Gaps = 16/100 (16%)

Query: 237 GALSGGVAQTVTYPFD---------------LLRRRFQVLAMGGNELGFRYKS-VMDALI 280
           G +SG V++T T PFD                L+ +  +L    N    + KS ++ A  
Sbjct: 231 GGVSGVVSRTCTAPFDRIKVFLIARTDLSSTFLKSKDIILEKNPNADLSKIKSPLVKAAT 290

Query: 281 TIGKTEGFRGYYKGLTANLFKVIPSTAVSWLVYEVVCDLM 320
           T+ +  G R +Y G   N  KV P +A+ +  +E+   LM
Sbjct: 291 TLYRQGGIRAFYVGNGLNAMKVFPESAIKFGSFELAKRLM 330

>KLLA0E18788g complement(1661093..1662238) similar to sp|P38702
           Saccharomyces cerevisiae YHR002w, start by similarity
          Length = 381

 Score =  141 bits (356), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 92/313 (29%), Positives = 149/313 (47%), Gaps = 40/313 (12%)

Query: 36  SRTVVSPFERVKILLQVQNST----TAYNQGIVGAVRQVYREEGTPGLFRGNGLNCIRIF 91
           ++T+++P +R+KIL Q  N          QG++ A   ++  +   G+F+G+    +RIF
Sbjct: 67  AKTLIAPLDRIKILFQTSNPHYVKYAGSFQGLLNAGVHIWSRDRLRGVFQGHSATLLRIF 126

Query: 92  PYSAVQFVVYEACKKHFFHVDGSKGREQLQNWQRLFSGALCGGCSVLATYPLDLVRTRLS 151
           PY+AV+F+ YE  +           +E   +++RL SG+L G CSV  TYPLDL+R RL+
Sbjct: 127 PYAAVKFIAYEQIRNVII-----PSKEYETHFRRLCSGSLAGLCSVFCTYPLDLIRVRLA 181

Query: 152 IQTANLTKLSKSRAHNISKPPGVWDLLCRTYKEEGGIK--GLYRGVWPTSLGVVPYVALN 209
             T +           I   P    L  + Y  +   +    YRG  PT +G++PY  ++
Sbjct: 182 YVTEHHKVRVWPLVKQIYSEPASEALSSKAYVPKWFAQWCNFYRGYIPTVIGMIPYAGVS 241

Query: 210 FAVYEQFKEFMPE----------------------------GTDNTLANFYKLSIGALSG 241
           F  ++ F + +                              G    L  + +L  G L+G
Sbjct: 242 FFAHDLFHDILRHPVIAPYSVLRVDDLDADDLKVDVQTTRTGKRIPLNTWAELLAGGLAG 301

Query: 242 GVAQTVTYPFDLLRRRFQVLAMGGNELGFRYKSVMDALITIGKTEGFRGYYKGLTANLFK 301
             +QT  YPF+++RRR QV A+  N L  ++ S+ +    I    G+RG++ GL+    K
Sbjct: 302 MASQTAAYPFEIIRRRLQVGAV-TNPLEHKFTSMSEMAKIIFHERGWRGFFVGLSIGYIK 360

Query: 302 VIPSTAVSWLVYE 314
           V P  A S+ VYE
Sbjct: 361 VTPMVACSFFVYE 373

 Score = 53.5 bits (127), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 45/208 (21%), Positives = 85/208 (40%), Gaps = 27/208 (12%)

Query: 127 FSGALCGGCSVLATYPLDLVRTRLSIQTANLTKLSKSRAHNISKPPGVWDLLCRTYKEEG 186
            +G + G C+     PLD ++        +  K + S    ++    +W           
Sbjct: 58  LAGGVAGSCAKTLIAPLDRIKILFQTSNPHYVKYAGSFQGLLNAGVHIW--------SRD 109

Query: 187 GIKGLYRGVWPTSLGVVPYVALNFAVYEQFKE-FMPEGTDNTLANFYKLSIGALSGGVAQ 245
            ++G+++G   T L + PY A+ F  YEQ +   +P     T  +F +L  G+L+G  + 
Sbjct: 110 RLRGVFQGHSATLLRIFPYAAVKFIAYEQIRNVIIPSKEYET--HFRRLCSGSLAGLCSV 167

Query: 246 TVTYPFDLLRRRFQVLAMGGNELGFRYKSVMDALITIGKTEGFRG-------------YY 292
             TYP DL+R R   LA        R   ++  + +   +E                 +Y
Sbjct: 168 FCTYPLDLIRVR---LAYVTEHHKVRVWPLVKQIYSEPASEALSSKAYVPKWFAQWCNFY 224

Query: 293 KGLTANLFKVIPSTAVSWLVYEVVCDLM 320
           +G    +  +IP   VS+  +++  D++
Sbjct: 225 RGYIPTVIGMIPYAGVSFFAHDLFHDIL 252

 Score = 48.1 bits (113), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 31/104 (29%), Positives = 50/104 (48%), Gaps = 9/104 (8%)

Query: 117 REQLQNWQRLFSGALCGGCSVLATYPLDLVRTRLSIQTANLTKLSKSRAHNISKPPGVWD 176
           R  L  W  L +G L G  S  A YP +++R RL  Q   +T   + +  ++S+      
Sbjct: 285 RIPLNTWAELLAGGLAGMASQTAAYPFEIIRRRL--QVGAVTNPLEHKFTSMSE------ 336

Query: 177 LLCRTYKEEGGIKGLYRGVWPTSLGVVPYVALNFAVYEQFKEFM 220
            + +    E G +G + G+    + V P VA +F VYE+ K +M
Sbjct: 337 -MAKIIFHERGWRGFFVGLSIGYIKVTPMVACSFFVYERMKWYM 379

 Score = 35.0 bits (79), Expect = 0.072,   Method: Compositional matrix adjust.
 Identities = 22/73 (30%), Positives = 31/73 (42%), Gaps = 3/73 (4%)

Query: 36  SRTVVSPFERVKILLQVQNSTTAYNQGIVGA---VRQVYREEGTPGLFRGNGLNCIRIFP 92
           S+T   PFE ++  LQV   T              + ++ E G  G F G  +  I++ P
Sbjct: 304 SQTAAYPFEIIRRRLQVGAVTNPLEHKFTSMSEMAKIIFHERGWRGFFVGLSIGYIKVTP 363

Query: 93  YSAVQFVVYEACK 105
             A  F VYE  K
Sbjct: 364 MVACSFFVYERMK 376

>YNL083W (YNL083W) [4507] chr14 (471377..473014) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters [1638 bp, 545 aa]
          Length = 545

 Score =  144 bits (364), Expect = 6e-39,   Method: Compositional matrix adjust.
 Identities = 99/321 (30%), Positives = 159/321 (49%), Gaps = 49/321 (15%)

Query: 35  VSRTVVSPFERVK-----------ILLQVQNSTTAYNQG---------IVGAVRQVYREE 74
           +SRT  +PF+R+K           ILL  +    A N           +  AV+ +YR+ 
Sbjct: 240 ISRTCTAPFDRLKVFLIARTDLSSILLNSKTDLLAKNPNADINKISSPLAKAVKSLYRQG 299

Query: 75  GTPGLFRGNGLNCIRIFPYSAVQFVVYEACKKHFFHVDGSKGREQLQNWQRLFSGALCGG 134
           G    + GNGLN I++FP S+++F  +E  KK    ++G +  + L  +    +G L G 
Sbjct: 300 GIKAFYVGNGLNVIKVFPESSIKFGSFEVTKKIMTKLEGCRDTKDLSKFSTYIAGGLAGM 359

Query: 135 CSVLATYPLDLVRTRLSIQTANLTKLSKSRAHNISKPPGVWDLLCRTYKE---EGGIKGL 191
            +  + YP+D ++ R  +Q A L   +K + +N         LL +T K+   EGG++  
Sbjct: 360 AAQFSVYPIDTLKFR--VQCAPLD--TKLKGNN---------LLFQTAKDMFREGGLRLF 406

Query: 192 YRGVWPTSLGVVPYVALNFAVYEQFKEF----------MPEGTDNTLANFYKLSIGALSG 241
           YRGV    +G+ PY AL+   +   K++          +P+    TL+N   L +GA SG
Sbjct: 407 YRGVTVGIVGIFPYAALDLGTFSALKKWYIAKQAKTLNLPQDQ-VTLSNLVVLPMGAFSG 465

Query: 242 GVAQTVTYPFDLLRRRFQVLAMGGNELGFRYKSVMDALITIGKTEGFRGYYKGLTANLFK 301
            V  +V YP +LLR R Q  A G     + Y    D L+   + EG++G +KGL   L K
Sbjct: 466 TVGASVVYPINLLRTRLQ--AQGTYAHPYVYNGFKDVLLKTLEREGYQGLFKGLVPTLAK 523

Query: 302 VIPSTAVSWLVYEVVCDLMHV 322
           V P+ ++S+L YE +   M++
Sbjct: 524 VCPAVSISYLCYENLKKFMNL 544

 Score = 33.9 bits (76), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 24/100 (24%), Positives = 46/100 (46%), Gaps = 16/100 (16%)

Query: 237 GALSGGVAQTVTYPFD---------------LLRRRFQVLAMGGN-ELGFRYKSVMDALI 280
           G +SG +++T T PFD               LL  +  +LA   N ++      +  A+ 
Sbjct: 234 GGISGVISRTCTAPFDRLKVFLIARTDLSSILLNSKTDLLAKNPNADINKISSPLAKAVK 293

Query: 281 TIGKTEGFRGYYKGLTANLFKVIPSTAVSWLVYEVVCDLM 320
           ++ +  G + +Y G   N+ KV P +++ +  +EV   +M
Sbjct: 294 SLYRQGGIKAFYVGNGLNVIKVFPESSIKFGSFEVTKKIM 333

>KLLA0C11363g complement(975442..976995) similar to sp|P48233
           Saccharomyces cerevisiae YNL083w singleton, start by
           similarity
          Length = 517

 Score =  142 bits (359), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 98/321 (30%), Positives = 154/321 (47%), Gaps = 49/321 (15%)

Query: 35  VSRTVVSPFERVKI-----------LLQVQNSTTAYNQG---------IVGAVRQVYREE 74
           VSRT  +PF+R+K+           LL  +++  A N           ++ A   +YR+ 
Sbjct: 212 VSRTCTAPFDRIKVFLIARTDLSSTLLNSKDTLLAKNPNADLSKIKSPLIKAATTLYRQG 271

Query: 75  GTPGLFRGNGLNCIRIFPYSAVQFVVYEACKKHFFHVDGSKGREQLQNWQRLFSGALCGG 134
           G    + GNGLN +++FP SA++F  +E  K+    ++  K   +L       +G L G 
Sbjct: 272 GLRAFYVGNGLNVVKVFPESAIKFGSFEMAKRIMARLENVKDTSELSRLSTYIAGGLGGV 331

Query: 135 CSVLATYPLDLVRTRLSIQTANLTKLSKSRAHNISKPPGVWDLLCRTYKE---EGGIKGL 191
            +  + YP+D ++ R+     N T L KS             +L +T KE   +GGI+  
Sbjct: 332 AAQFSVYPIDTLKYRIQCAPLN-TNLKKS------------SILLQTAKEMYQQGGIRLF 378

Query: 192 YRGVWPTSLGVVPYVALNFAVYEQFKEF----------MPEGTDNTLANFYKLSIGALSG 241
           YRGV    +G+ PY AL+   +   K++          +PE  +  ++N   L +GA SG
Sbjct: 379 YRGVHIGVMGIFPYAALDLGTFSALKKWYIKKEAKKTGLPE-DEVIISNLIVLPMGAFSG 437

Query: 242 GVAQTVTYPFDLLRRRFQVLAMGGNELGFRYKSVMDALITIGKTEGFRGYYKGLTANLFK 301
            V  T+ YP +LLR R Q  A G       Y    D L    + EG++G +KGL  NL K
Sbjct: 438 TVGATLVYPINLLRTRLQ--AQGTYAHPHTYNGFSDVLKKTIQREGYQGLFKGLVPNLAK 495

Query: 302 VIPSTAVSWLVYEVVCDLMHV 322
           V P+ ++S+L YE +  LM +
Sbjct: 496 VCPAVSISYLCYENLKRLMKL 516

>Sklu_2374.7 YNL083W, Contig c2374 13874-15415 reverse complement
          Length = 513

 Score =  142 bits (357), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 97/317 (30%), Positives = 148/317 (46%), Gaps = 41/317 (12%)

Query: 35  VSRTVVSPFERVKILLQVQN--STTAYNQG------------------IVGAVRQVYREE 74
           +SRT  +PF+R+K+ L  +   S+T  N                    ++ A   +YR+ 
Sbjct: 208 ISRTCTAPFDRIKVFLIARTDLSSTLLNSKDKVLMKNPNADISKIKSPLIKAATTLYRQG 267

Query: 75  GTPGLFRGNGLNCIRIFPYSAVQFVVYEACKKHFFHVDGSKGREQLQNWQRLFSGALCGG 134
           G    + GNGLN I++FP SA++F  +E  K+   H++G     +L  +    +G + G 
Sbjct: 268 GIRAFYVGNGLNVIKVFPESAMKFGSFELAKQLMAHLEGVHHTSELSKFSTYIAGGMGGV 327

Query: 135 CSVLATYPLDLVRTRLSIQTANLTKLSKSRAHNISKPPGVWDLLCRTYKEEGGIKGLYRG 194
            +  + YP+D ++ R  +Q A L    K     IS          R    +GG+K  YRG
Sbjct: 328 VAQFSVYPIDTLKYR--VQCAPLDTALKGNELLIST--------ARQMYRDGGLKLFYRG 377

Query: 195 VWPTSLGVVPYVALNFAVYEQFKEFMPEGTDN---------TLANFYKLSIGALSGGVAQ 245
           V    +G+ PY AL+   +   K++                T++NF  L +GA SG V  
Sbjct: 378 VTVGVMGIFPYAALDLGTFSALKKWYIARQAKMTGVPVDQVTISNFIVLPMGAFSGTVGA 437

Query: 246 TVTYPFDLLRRRFQVLAMGGNELGFRYKSVMDALITIGKTEGFRGYYKGLTANLFKVIPS 305
           TV YP +LLR R Q  A G       Y    D L    + EG++G +KGL  NL KV P+
Sbjct: 438 TVVYPINLLRTRLQ--AQGTYAHPHTYTGFRDVLWKTVQREGYQGLFKGLVPNLAKVCPA 495

Query: 306 TAVSWLVYEVVCDLMHV 322
            ++S+L YE    LM +
Sbjct: 496 VSISYLCYENFKRLMKL 512

 Score = 37.4 bits (85), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 29/100 (29%), Positives = 46/100 (46%), Gaps = 16/100 (16%)

Query: 237 GALSGGVAQTVTYPFD---------------LLRRRFQVLAMGGNELGFRYKS-VMDALI 280
           G  SG +++T T PFD               LL  + +VL    N    + KS ++ A  
Sbjct: 202 GGCSGVISRTCTAPFDRIKVFLIARTDLSSTLLNSKDKVLMKNPNADISKIKSPLIKAAT 261

Query: 281 TIGKTEGFRGYYKGLTANLFKVIPSTAVSWLVYEVVCDLM 320
           T+ +  G R +Y G   N+ KV P +A+ +  +E+   LM
Sbjct: 262 TLYRQGGIRAFYVGNGLNVIKVFPESAMKFGSFELAKQLM 301

>Scas_578.3*
          Length = 524

 Score =  139 bits (351), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 101/311 (32%), Positives = 148/311 (47%), Gaps = 47/311 (15%)

Query: 35  VSRTVVSPFERVKILLQVQN--STTAYN-------QG---------IVGAVRQVYREEGT 76
           +SRT  +P +R+K+ L  +   S+T  N       QG         I+ A+R +YR+ G 
Sbjct: 221 ISRTCTAPLDRIKVFLIARTDLSSTLLNPKMHLRIQGLNLAKIRSPIIKAIRSLYRQGGL 280

Query: 77  PGLFRGNGLNCIRIFPYSAVQFVVYEACKKHFFHVDGSKGREQLQNWQRLFSGALCGGCS 136
              + GNGL+  +I P S+++F  +E  K+   ++ G K    L   Q   +G + G  +
Sbjct: 281 RAFYVGNGLSVFKICPESSIKFGTFELAKRLMANLSGDKLVNDLSKLQTYVAGGIAGVMA 340

Query: 137 VLATYPLDLVRTRLSIQTANLTKLSKSRAHNISKPPGVWDLLCRTYKE---EGGIKGLYR 193
            ++ YP+D ++ R  IQ A L    K  A           LL  T KE   EGGI+  YR
Sbjct: 341 QISIYPIDTLKFR--IQCAPLEGNLKGNA-----------LLISTAKEMYKEGGIRVFYR 387

Query: 194 GVWPTSLGVVPYVALNFAVYEQFKEF----------MPEGTDNTLANFYKLSIGALSGGV 243
           GV   +LG+ PY AL+   +   K++          +PE  D  L+    L +GA SG V
Sbjct: 388 GVLLGALGIFPYAALDLGTFSALKKWYIKRQSKKLNIPE-KDVMLSYLLVLPMGAFSGTV 446

Query: 244 AQTVTYPFDLLRRRFQVLAMGGNELGFRYKSVMDALITIGKTEGFRGYYKGLTANLFKVI 303
             T  YP +LLR R Q  A G     + Y    D  +   K EG  G+YKGL   L KV 
Sbjct: 447 GATAVYPINLLRTRLQ--AQGTYAHPYTYTGFRDVFMQTLKREGVPGFYKGLVPTLVKVC 504

Query: 304 PSTAVSWLVYE 314
           P+ ++ +L YE
Sbjct: 505 PAVSIGYLCYE 515

 Score = 72.4 bits (176), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 51/166 (30%), Positives = 78/166 (46%), Gaps = 15/166 (9%)

Query: 60  NQGIVGAVRQVYREEGTPGLFRGNGLNCIRIFPYSAVQFVVYEACKKHFFHVDGSK---- 115
           N  ++   +++Y+E G    +RG  L  + IFPY+A+    + A KK +      K    
Sbjct: 366 NALLISTAKEMYKEGGIRVFYRGVLLGALGIFPYAALDLGTFSALKKWYIKRQSKKLNIP 425

Query: 116 -GREQLQNWQRLFSGALCGGCSVLATYPLDLVRTRLSIQTANLTKLSKSRAHNISKPPGV 174
                L     L  GA  G     A YP++L+RTRL  Q         + AH  +   G 
Sbjct: 426 EKDVMLSYLLVLPMGAFSGTVGATAVYPINLLRTRLQAQG--------TYAHPYTYT-GF 476

Query: 175 WDLLCRTYKEEGGIKGLYRGVWPTSLGVVPYVALNFAVYEQFKEFM 220
            D+  +T K EG + G Y+G+ PT + V P V++ +  YE+FK  M
Sbjct: 477 RDVFMQTLKREG-VPGFYKGLVPTLVKVCPAVSIGYLCYEKFKAAM 521

 Score = 35.4 bits (80), Expect = 0.059,   Method: Compositional matrix adjust.
 Identities = 29/130 (22%), Positives = 56/130 (43%), Gaps = 20/130 (15%)

Query: 210 FAVYEQFKEFMPEGTDNTLANFYK----LSIGALSGGVAQTVTYPFD------------- 252
           F ++ +  +   EG    + +F K       G LSG +++T T P D             
Sbjct: 184 FYLFNEDVDLSSEGDMTLINDFIKGFGYFIAGGLSGVISRTCTAPLDRIKVFLIARTDLS 243

Query: 253 --LLRRRFQVLAMGGNELGFRYKSVMDALITIGKTEGFRGYYKGLTANLFKVIPSTAVSW 310
             LL  +  +   G N    R   ++ A+ ++ +  G R +Y G   ++FK+ P +++ +
Sbjct: 244 STLLNPKMHLRIQGLNLAKIR-SPIIKAIRSLYRQGGLRAFYVGNGLSVFKICPESSIKF 302

Query: 311 LVYEVVCDLM 320
             +E+   LM
Sbjct: 303 GTFELAKRLM 312

>Kwal_26.7972
          Length = 358

 Score =  135 bits (339), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 86/304 (28%), Positives = 144/304 (47%), Gaps = 34/304 (11%)

Query: 36  SRTVVSPFERVKILLQVQNST----TAYNQGIVGAVRQVYREEGTPGLFRGNGLNCIRIF 91
           ++T+++P +R+KIL Q  N      +    G++ A   +   +G  G ++G+    IRIF
Sbjct: 41  AKTLIAPLDRIKILFQTSNPHYLKYSGSTMGLIRAGAHINAHDGIRGFYQGHSATLIRIF 100

Query: 92  PYSAVQFVVYEACKKHFFHVDGSKGREQLQNWQRLFSGALCGGCSVLATYPLDLVRTRLS 151
           PY+A++F+ YE   +HF        +E   + +RL SG++ G CSV  TYPLDL+R RL+
Sbjct: 101 PYAAIKFIAYEQI-RHFM----IPSKEYETHARRLASGSMAGLCSVFMTYPLDLIRVRLA 155

Query: 152 IQTANLTKLSKSRAHNISKPPGVWDLLCRTYKEE--GGIKGLYRGVWPTSLGVVPYVALN 209
             T             I        L  ++Y           YRG  PT LG++PY  ++
Sbjct: 156 YVTDRSRIKMLPVIKQIYTERASESLTSKSYVPRWFAHWCNFYRGFTPTVLGMIPYAGVS 215

Query: 210 FAVYEQFKEFMPEG----------------------TDNTLANFYKLSIGALSGGVAQTV 247
           F  ++   + +  G                      +   L  + +L  G L+G  +QT 
Sbjct: 216 FFAHDLCGDILRSGALSPYSVLPISDEELTIRSKKQSSRPLKTWAELVAGGLAGMASQTA 275

Query: 248 TYPFDLLRRRFQVLAMGGNELGFRYKSVMDALITIGKTEGFRGYYKGLTANLFKVIPSTA 307
           +YPF+++RRR QV  +    +   ++++ D +  I K  G+RG++ GL+    KV P  A
Sbjct: 276 SYPFEIIRRRLQVSVVSPTSI-HNFQTIPDMIRIIYKERGWRGFFVGLSIGYIKVTPMVA 334

Query: 308 VSWL 311
            S+ 
Sbjct: 335 CSFF 338

 Score = 65.9 bits (159), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 51/208 (24%), Positives = 87/208 (41%), Gaps = 27/208 (12%)

Query: 127 FSGALCGGCSVLATYPLDLVRTRLSIQTANLTKLSKSRAHNISKPPGVWDLLCRTYKEEG 186
            +G + G C+     PLD ++        +  K S S    I     +            
Sbjct: 32  LAGGIAGSCAKTLIAPLDRIKILFQTSNPHYLKYSGSTMGLIRAGAHI--------NAHD 83

Query: 187 GIKGLYRGVWPTSLGVVPYVALNFAVYEQFKEFM-PEGTDNTLANFYKLSIGALSGGVAQ 245
           GI+G Y+G   T + + PY A+ F  YEQ + FM P     T A   +L+ G+++G  + 
Sbjct: 84  GIRGFYQGHSATLIRIFPYAAIKFIAYEQIRHFMIPSKEYETHAR--RLASGSMAGLCSV 141

Query: 246 TVTYPFDLLRRRFQVLAMGGNELGFRYKSVMDALITIGKTEGFRG-------------YY 292
            +TYP DL+R R   LA   +    +   V+  + T   +E                 +Y
Sbjct: 142 FMTYPLDLIRVR---LAYVTDRSRIKMLPVIKQIYTERASESLTSKSYVPRWFAHWCNFY 198

Query: 293 KGLTANLFKVIPSTAVSWLVYEVVCDLM 320
           +G T  +  +IP   VS+  +++  D++
Sbjct: 199 RGFTPTVLGMIPYAGVSFFAHDLCGDIL 226

>AER419W [2919] [Homologous to ScYNL083W - SH]
           complement(1442595..1444076) [1482 bp, 493 aa]
          Length = 493

 Score =  131 bits (330), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 99/320 (30%), Positives = 144/320 (45%), Gaps = 47/320 (14%)

Query: 35  VSRTVVSPFERVKILLQVQNSTTA--------------------YNQGIVGAVRQVYREE 74
           VSRT  +PF+R+K+ L  +   ++                        +V A   +YR+ 
Sbjct: 188 VSRTCTAPFDRIKVFLIARTDLSSPLLHTPEQLLHHNPRADPAKIRSPLVKAATSLYRQG 247

Query: 75  GTPGLFRGNGLNCIRIFPYSAVQFVVYEACKKHFFHVDGSKGREQLQNWQRLFSGALCGG 134
           G    + GNGLN I++FP SA++F  +E  K+    ++G     +L       +G L G 
Sbjct: 248 GLRAFYLGNGLNVIKVFPESAMKFGSFELAKRVLAGLEGCGETGELSRLSTYVAGGLGGI 307

Query: 135 CSVLATYPLDLVRTRLSIQTANLTKLSKSRAHNISKPPGVWDLLCRTYKE---EGGIKGL 191
            +  + YP+D ++ R  IQ A L     +R   +        LL +T K+   EGG++  
Sbjct: 308 MAQFSVYPIDTLKFR--IQCAPL----DTRCRGLP-------LLIKTAKDMYREGGLRLF 354

Query: 192 YRGVWPTSLGVVPYVALNFAVYEQFKEFMPEGTDNTL---------ANFYKLSIGALSGG 242
           YRG+    LGV PY AL+   +   K +      N L         +N   L +GA SG 
Sbjct: 355 YRGLGVGILGVFPYAALDLGTFSALKRWYITRRANALGISENEVVMSNLVVLPMGAFSGT 414

Query: 243 VAQTVTYPFDLLRRRFQVLAMGGNELGFRYKSVMDALITIGKTEGFRGYYKGLTANLFKV 302
           V  TV YP +LLR R Q  A G      RY    D      + EG  G YKGL   L KV
Sbjct: 415 VGATVVYPINLLRTRLQ--AQGTYAHPHRYDGFQDVFRKTVQREGLPGLYKGLVPTLAKV 472

Query: 303 IPSTAVSWLVYEVVCDLMHV 322
            P+ A+S+L YE +   M +
Sbjct: 473 CPAVAISYLCYENLKRAMRL 492

>Scas_718.24
          Length = 337

 Score =  128 bits (321), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 101/312 (32%), Positives = 148/312 (47%), Gaps = 32/312 (10%)

Query: 10  QPSYVKSILKNDSNVA--FXXXXXXXXVSRTVVSPFERVKILLQVQNS-------TTAYN 60
           Q + + S  K  SN A  F        V++T  SP ERVK+L+Q QN         T Y 
Sbjct: 28  QSNTIMSTEKPQSNFAIDFLMGGVSAAVAKTAASPIERVKLLIQNQNEMLKQGTLDTKY- 86

Query: 61  QGIVGAVRQVYREEGTPGLFRGNGLNCIRIFPYSAVQFVVYEACKKHFFHVDGSKGREQL 120
           +GIV   R+  ++EG    +RGN  N IR FP  A+ F   +  K  F    G K  +  
Sbjct: 87  KGIVDCFRRTAQQEGIISFWRGNTANVIRYFPTQALNFAFKDKIKLMF----GFKKEDGY 142

Query: 121 QNW--QRLFSGALCGGCSVLATYPLDLVRTRLSIQTANLTKLSKSRAHNISKPPGVWDLL 178
             W    L SG   GG S+L  Y LD  RTRL+  + + +K   SR  N     G+ D+ 
Sbjct: 143 GKWFAGNLASGGAAGGLSLLFVYSLDFARTRLAADSKS-SKKGGSRQFN-----GLIDVY 196

Query: 179 CRTYKEEGGIKGLYRGVWPTSLGVVPYVALNFAVYEQFKEFMPEGT--DNTLANFYKLSI 236
            +T K + G+ GLYRG  P+ +G++ Y  L F +Y+  K  +  G+   + LA+F    +
Sbjct: 197 KKTLKSD-GVAGLYRGFLPSVVGIIVYRGLYFGLYDSIKPVLLTGSLEGSFLASFL---L 252

Query: 237 GALSGGVAQTVTYPFDLLRRRFQVLAMGGNELGFRYKSVMDALITIGKTEGFRGYYKGLT 296
           G +    A T +YP D +RR+  ++   G  +  +YK   D    I   EG    +KG  
Sbjct: 253 GWVVTTGASTCSYPLDTVRRK--MMMTSGQAV--KYKGAFDCFKKIVAAEGVASLFKGCG 308

Query: 297 ANLFKVIPSTAV 308
           AN+ + +    V
Sbjct: 309 ANILRGVAGAGV 320

 Score = 37.4 bits (85), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 21/79 (26%), Positives = 43/79 (54%), Gaps = 6/79 (7%)

Query: 236 IGALSGGVAQTVTYPFD----LLRRRFQVLAMGGNELGFRYKSVMDALITIGKTEGFRGY 291
           +G +S  VA+T   P +    L++ + ++L  G   L  +YK ++D      + EG   +
Sbjct: 48  MGGVSAAVAKTAASPIERVKLLIQNQNEMLKQG--TLDTKYKGIVDCFRRTAQQEGIISF 105

Query: 292 YKGLTANLFKVIPSTAVSW 310
           ++G TAN+ +  P+ A+++
Sbjct: 106 WRGNTANVIRYFPTQALNF 124

>CAGL0F04213g 419473..420393 highly similar to sp|P18239
           Saccharomyces cerevisiae YBL030c AAC2 ADP/ATP carrier
           protein, hypothetical start
          Length = 306

 Score =  127 bits (318), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 99/302 (32%), Positives = 143/302 (47%), Gaps = 30/302 (9%)

Query: 19  KNDSNVA--FXXXXXXXXVSRTVVSPFERVKILLQVQN------STTAYNQGIVGAVRQV 70
           K  SN A  F        V++T  SP ERVK+L+Q Q+      S     +GIV   ++ 
Sbjct: 6   KPQSNFAIDFLMGGVSAAVAKTAASPIERVKLLIQNQDEMIKQGSLDHRYKGIVDCFQRT 65

Query: 71  YREEGTPGLFRGNGLNCIRIFPYSAVQFVVYEACKKHFFHVDGSKGREQLQNW--QRLFS 128
            R+EG    +RGN  N IR FP  A+ F   +  K  F    G K  E    W    L S
Sbjct: 66  ARQEGIISFWRGNTANVIRYFPTQALNFAFKDQIKAMF----GFKKEEGYAKWFAGNLAS 121

Query: 129 GALCGGCSVLATYPLDLVRTRLSIQTANLTKLSKSRAHNISKPPGVWDLLCRTYKEEGGI 188
           G + GG S++  Y LD  RTRL+   A  +K    R  N     G+ D+  +T   + G+
Sbjct: 122 GGIAGGLSLMFVYSLDYARTRLAAD-AKSSKKGGERQFN-----GLVDVYKKTIASD-GV 174

Query: 189 KGLYRGVWPTSLGVVPYVALNFAVYEQFKEFMPEGT--DNTLANFYKLSIGALSGGVAQT 246
            GLYRG  P+ +G+V Y  L F +Y+  K  +  G+   + +A+F    +G +    A T
Sbjct: 175 AGLYRGFLPSVIGIVVYRGLYFGLYDSCKPLLLTGSLEGSFIASFL---LGWVVTTGAST 231

Query: 247 VTYPFDLLRRRFQVLAMGGNELGFRYKSVMDALITIGKTEGFRGYYKGLTANLFKVIPST 306
            +YP D +RRR  ++   G  +  +YK  MD L  I   EG    +KG  AN+ + +   
Sbjct: 232 ASYPLDTVRRR--MMMTSGQAV--KYKGAMDCLQKIVAAEGVSSLFKGCGANILRGVAGA 287

Query: 307 AV 308
            V
Sbjct: 288 GV 289

 Score = 38.5 bits (88), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 21/79 (26%), Positives = 43/79 (54%), Gaps = 6/79 (7%)

Query: 236 IGALSGGVAQTVTYPFD----LLRRRFQVLAMGGNELGFRYKSVMDALITIGKTEGFRGY 291
           +G +S  VA+T   P +    L++ + +++  G   L  RYK ++D      + EG   +
Sbjct: 17  MGGVSAAVAKTAASPIERVKLLIQNQDEMIKQG--SLDHRYKGIVDCFQRTARQEGIISF 74

Query: 292 YKGLTANLFKVIPSTAVSW 310
           ++G TAN+ +  P+ A+++
Sbjct: 75  WRGNTANVIRYFPTQALNF 93

>YBR085W (AAC3) [275] chr2 (415940..416863) ADP/ATP transporter
           protein, member of the mitochondrial carrier family
           (MCF) of membrane transporters [924 bp, 307 aa]
          Length = 307

 Score =  123 bits (308), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 91/283 (32%), Positives = 134/283 (47%), Gaps = 26/283 (9%)

Query: 35  VSRTVVSPFERVKILLQVQNSTTAYN------QGIVGAVRQVYREEGTPGLFRGNGLNCI 88
           +++T  SP ERVKIL+Q Q+             GIV   ++  ++EG    +RGN  N I
Sbjct: 25  IAKTAASPIERVKILIQNQDEMIKQGTLDKKYSGIVDCFKRTAKQEGLISFWRGNTANVI 84

Query: 89  RIFPYSAVQFVVYEACKKHFFHVDGSKGREQLQNW--QRLFSGALCGGCSVLATYPLDLV 146
           R FP  A+ F   +  K  F    G K  E    W    L SG   G  S+L  Y LD  
Sbjct: 85  RYFPTQALNFAFKDKIKLMF----GFKKEEGYGKWFAGNLASGGAAGALSLLFVYSLDFA 140

Query: 147 RTRLSIQTANLTKLSKSRAHNISKPPGVWDLLCRTYKEEGGIKGLYRGVWPTSLGVVPYV 206
           RTRL+   A  +K   +R  N     G+ D+  +T K +G I GLYRG  P+ +G+V Y 
Sbjct: 141 RTRLAAD-AKSSKKGGARQFN-----GLTDVYKKTLKSDG-IAGLYRGFMPSVVGIVVYR 193

Query: 207 ALNFAVYEQFKEFMPEGT-DNTLANFYKLSIGALSGGVAQTVTYPFDLLRRRFQVLAMGG 265
            L F +++  K  +  G+ D +    + L     +G  A T +YP D +RRR  + +  G
Sbjct: 194 GLYFGMFDSLKPLVLTGSLDGSFLASFLLGWVVTTG--ASTCSYPLDTVRRRMMMTS--G 249

Query: 266 NELGFRYKSVMDALITIGKTEGFRGYYKGLTANLFKVIPSTAV 308
             +  +Y   +D L  I  +EG    +KG  AN+ + +    V
Sbjct: 250 QAV--KYNGAIDCLKKIVASEGVGSLFKGCGANILRSVAGAGV 290

 Score = 35.0 bits (79), Expect = 0.065,   Method: Compositional matrix adjust.
 Identities = 19/79 (24%), Positives = 42/79 (53%), Gaps = 6/79 (7%)

Query: 236 IGALSGGVAQTVTYPFD----LLRRRFQVLAMGGNELGFRYKSVMDALITIGKTEGFRGY 291
           +G +S  +A+T   P +    L++ + +++  G   L  +Y  ++D      K EG   +
Sbjct: 18  MGGVSAAIAKTAASPIERVKILIQNQDEMIKQG--TLDKKYSGIVDCFKRTAKQEGLISF 75

Query: 292 YKGLTANLFKVIPSTAVSW 310
           ++G TAN+ +  P+ A+++
Sbjct: 76  WRGNTANVIRYFPTQALNF 94

>YMR056C (AAC1) [4016] chr13 complement(387314..388243) ADP/ATP
           carrier protein of the mitochondrial carrier family
           (MCF) of membrane transporters [930 bp, 309 aa]
          Length = 309

 Score =  120 bits (301), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 91/299 (30%), Positives = 143/299 (47%), Gaps = 33/299 (11%)

Query: 23  NVAFXXXXXXXXVSRTVVSPFERVKILLQ------VQNSTTAYNQGIVGAVRQVYREEGT 76
            V F        +++T  +P ERVK+L+Q       Q S     +GI+   ++    EG 
Sbjct: 14  GVDFLMGGVSAAIAKTGAAPIERVKLLMQNQEEMLKQGSLDTRYKGILDCFKRTATHEGI 73

Query: 77  PGLFRGNGLNCIRIFPYSAVQFVVYEACKKHFFHVDGSKGREQLQNW--QRLFSGALCGG 134
              +RGN  N +R FP  A+ F   +  K    +    + R+    W    LFSG   GG
Sbjct: 74  VSFWRGNTANVLRYFPTQALNFAFKDKIKSLLSY---DRERDGYAKWFAGNLFSGGAAGG 130

Query: 135 CSVLATYPLDLVRTRLSIQTANLTKLSKSRAHNISKPPGVWDLLCRTYKEEGGIKGLYRG 194
            S+L  Y LD  RTRL+   A  +K +  R  N     G+ D+  +T K +G + GLYRG
Sbjct: 131 LSLLFVYSLDYARTRLAAD-ARGSKSTSQRQFN-----GLLDVYKKTLKTDG-LLGLYRG 183

Query: 195 VWPTSLGVVPYVALNFAVYEQFKEFMPEGT--DNTLANF---YKLSIGALSGGVAQTVTY 249
             P+ LG++ Y  L F +Y+ FK  +  G    + +A+F   + +++G      A T +Y
Sbjct: 184 FVPSVLGIIVYRGLYFGLYDSFKPVLLTGALEGSFVASFLLGWVITMG------ASTASY 237

Query: 250 PFDLLRRRFQVLAMGGNELGFRYKSVMDALITIGKTEGFRGYYKGLTANLFKVIPSTAV 308
           P D +RRR  ++   G  +  +Y   +D L  I + EG    +KG  AN+F+ + +  V
Sbjct: 238 PLDTVRRR--MMMTSGQTI--KYDGALDCLRKIVQKEGAYSLFKGCGANIFRGVAAAGV 292

 Score = 44.7 bits (104), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 48/190 (25%), Positives = 82/190 (43%), Gaps = 10/190 (5%)

Query: 131 LCGGCS--VLATYPLDLVRTRLSIQTANLTKLSKSRAHNISKPPGVWDLLCRTYKEEGGI 188
           L GG S  +  T    + R +L +Q  N  ++ K  + + ++  G+ D   RT   EG I
Sbjct: 18  LMGGVSAAIAKTGAAPIERVKLLMQ--NQEEMLKQGSLD-TRYKGILDCFKRTATHEG-I 73

Query: 189 KGLYRGVWPTSLGVVPYVALNFAVYEQFKEFMP-EGTDNTLANFY--KLSIGALSGGVAQ 245
              +RG     L   P  ALNFA  ++ K  +  +   +  A ++   L  G  +GG++ 
Sbjct: 74  VSFWRGNTANVLRYFPTQALNFAFKDKIKSLLSYDRERDGYAKWFAGNLFSGGAAGGLSL 133

Query: 246 TVTYPFDLLRRRFQVLAMGGNELGFR-YKSVMDALITIGKTEGFRGYYKGLTANLFKVIP 304
              Y  D  R R    A G      R +  ++D      KT+G  G Y+G   ++  +I 
Sbjct: 134 LFVYSLDYARTRLAADARGSKSTSQRQFNGLLDVYKKTLKTDGLLGLYRGFVPSVLGIIV 193

Query: 305 STAVSWLVYE 314
              + + +Y+
Sbjct: 194 YRGLYFGLYD 203

 Score = 37.7 bits (86), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 22/89 (24%), Positives = 46/89 (51%), Gaps = 6/89 (6%)

Query: 236 IGALSGGVAQTVTYPFD----LLRRRFQVLAMGGNELGFRYKSVMDALITIGKTEGFRGY 291
           +G +S  +A+T   P +    L++ + ++L  G   L  RYK ++D        EG   +
Sbjct: 19  MGGVSAAIAKTGAAPIERVKLLMQNQEEMLKQG--SLDTRYKGILDCFKRTATHEGIVSF 76

Query: 292 YKGLTANLFKVIPSTAVSWLVYEVVCDLM 320
           ++G TAN+ +  P+ A+++   + +  L+
Sbjct: 77  WRGNTANVLRYFPTQALNFAFKDKIKSLL 105

>Scas_667.4
          Length = 308

 Score =  119 bits (299), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 95/306 (31%), Positives = 143/306 (46%), Gaps = 30/306 (9%)

Query: 15  KSILKNDSNVA--FXXXXXXXXVSRTVVSPFERVKILLQVQN------STTAYNQGIVGA 66
           K  +K +SN A  F        V++T  SP ERVK+L+Q Q+      S  +  +GI+  
Sbjct: 4   KEEVKKESNFAIDFLMGGVSAAVAKTAASPIERVKLLIQNQDEMIKQGSLDSKYKGIIEC 63

Query: 67  VRQVYREEGTPGLFRGNGLNCIRIFPYSAVQFVVYEACKKHFFHVDGSKGREQLQNW--Q 124
            ++  + EG    +RGN  N IR FP  A+ F   +  K  F    G K  E    W   
Sbjct: 64  FQRTAKTEGIIAFWRGNTANVIRYFPTQALNFAFKDKIKAMF----GFKKEEGYGKWFAG 119

Query: 125 RLFSGALCGGCSVLATYPLDLVRTRLSIQTANLTKLSKSRAHNISKPPGVWDLLCRTYKE 184
            L SG   GG S+L  Y LD  RTRL+   A  +K   SR +      G+ D+  +T   
Sbjct: 120 NLASGGAAGGLSLLFVYSLDYARTRLAAD-AKSSKKGGSRQYK-----GLIDVYKQTLAT 173

Query: 185 EGGIKGLYRGVWPTSLGVVPYVALNFAVYEQFKEFMPEGT--DNTLANFYKLSIGALSGG 242
           + G+ GLYRG  P+ +G++ Y  L F +Y+  K  +  G+   + LA+F    +G +   
Sbjct: 174 D-GMAGLYRGFLPSVVGIIVYRGLYFGLYDSLKPAVLTGSLEGSFLASFL---LGWIVTT 229

Query: 243 VAQTVTYPFDLLRRRFQVLAMGGNELGFRYKSVMDALITIGKTEGFRGYYKGLTANLFKV 302
            A T +YP D +RRR  + +  G  +  +Y    D    +   EG    +KG  AN+ + 
Sbjct: 230 GASTASYPLDTVRRRMMMTS--GQAV--KYDGAFDCFRKVVAAEGVSSLFKGCGANILRG 285

Query: 303 IPSTAV 308
           +    V
Sbjct: 286 VAGAGV 291

 Score = 48.9 bits (115), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 52/203 (25%), Positives = 87/203 (42%), Gaps = 9/203 (4%)

Query: 117 REQLQNWQRLFSGALCGGCS--VLATYPLDLVRTRLSIQTANLTKLSKSRAHNISKPPGV 174
           +E+++         L GG S  V  T    + R +L IQ  N  ++ K  + + SK  G+
Sbjct: 4   KEEVKKESNFAIDFLMGGVSAAVAKTAASPIERVKLLIQ--NQDEMIKQGSLD-SKYKGI 60

Query: 175 WDLLCRTYKEEGGIKGLYRGVWPTSLGVVPYVALNFAVYEQFKEFMPEGTDNTLANFY-- 232
            +   RT K EG I   +RG     +   P  ALNFA  ++ K       +     ++  
Sbjct: 61  IECFQRTAKTEG-IIAFWRGNTANVIRYFPTQALNFAFKDKIKAMFGFKKEEGYGKWFAG 119

Query: 233 KLSIGALSGGVAQTVTYPFDLLRRRFQVLAMGGNELGFR-YKSVMDALITIGKTEGFRGY 291
            L+ G  +GG++    Y  D  R R    A    + G R YK ++D       T+G  G 
Sbjct: 120 NLASGGAAGGLSLLFVYSLDYARTRLAADAKSSKKGGSRQYKGLIDVYKQTLATDGMAGL 179

Query: 292 YKGLTANLFKVIPSTAVSWLVYE 314
           Y+G   ++  +I    + + +Y+
Sbjct: 180 YRGFLPSVVGIIVYRGLYFGLYD 202

>AER184W [2686] [Homologous to ScYBL030C (PET9) - SH; ScYBR085W
           (AAC3) - SH] complement(978781..979698) [918 bp, 305 aa]
          Length = 305

 Score =  119 bits (298), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 90/298 (30%), Positives = 137/298 (45%), Gaps = 33/298 (11%)

Query: 24  VAFXXXXXXXXVSRTVVSPFERVKILLQVQNSTTA-------YNQGIVGAVRQVYREEGT 76
           + F        VS+T  +P ERVK+L+Q Q+           YN GIV   ++    EG 
Sbjct: 11  INFMMGGVSAAVSKTAAAPIERVKLLIQNQDEMLKQGSLDRRYN-GIVDCFKRTAASEGV 69

Query: 77  PGLFRGNGLNCIRIFPYSAVQFVVYEACKKHFFHVDGSKGREQLQNWQRLFSGALC---- 132
              +RGN  N IR FP  A+ F   +  K  F        R+++  + + F+G L     
Sbjct: 70  ISFWRGNTANVIRYFPTQALNFAFKDKIKAMFGF------RKEVDGYAKWFAGNLASGGA 123

Query: 133 -GGCSVLATYPLDLVRTRLSIQTANLTKLSKSRAHNISKPPGVWDLLCRTYKEEGGIKGL 191
            GG S+L  Y LD  RTRL+  + +  K    R  N     G+ D+  +T   +G I GL
Sbjct: 124 AGGLSLLFVYSLDYARTRLAADSKSAKK-GGERQFN-----GLVDVYKKTLASDG-IAGL 176

Query: 192 YRGVWPTSLGVVPYVALNFAVYEQFKEFMPEGT-DNTLANFYKLSIGALSGGVAQTVTYP 250
           YRG  P+ +G+V Y  L F +Y+  K  +  G  +++    + L     +G  A T +YP
Sbjct: 177 YRGFLPSVVGIVVYRGLYFGMYDSLKPLLLTGNLESSFIASFLLGWAVTTG--ASTASYP 234

Query: 251 FDLLRRRFQVLAMGGNELGFRYKSVMDALITIGKTEGFRGYYKGLTANLFKVIPSTAV 308
            D +RRR  + +  G  +  +Y    DA   I   EG +  +KG  AN+ + +    V
Sbjct: 235 LDTVRRRMMMTS--GQAV--KYDGAFDAFRKIVAAEGVKSLFKGCGANILRGVAGAGV 288

 Score = 38.5 bits (88), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 24/92 (26%), Positives = 48/92 (52%), Gaps = 7/92 (7%)

Query: 224 TDNTLANFY-KLSIGALSGGVAQTVTYPFD----LLRRRFQVLAMGGNELGFRYKSVMDA 278
           +DN  +NF     +G +S  V++T   P +    L++ + ++L  G   L  RY  ++D 
Sbjct: 2   SDNKQSNFLINFMMGGVSAAVSKTAAAPIERVKLLIQNQDEMLKQG--SLDRRYNGIVDC 59

Query: 279 LITIGKTEGFRGYYKGLTANLFKVIPSTAVSW 310
                 +EG   +++G TAN+ +  P+ A+++
Sbjct: 60  FKRTAASEGVISFWRGNTANVIRYFPTQALNF 91

>YBL030C (PET9) [164] chr2 complement(163006..163962) ADP/ATP
           carrier protein of the mitochondrial carrier family
           (MCF) of membrane transporters [957 bp, 318 aa]
          Length = 318

 Score =  119 bits (297), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 91/295 (30%), Positives = 136/295 (46%), Gaps = 28/295 (9%)

Query: 24  VAFXXXXXXXXVSRTVVSPFERVKILLQVQNSTTAYN------QGIVGAVRQVYREEGTP 77
           + F        V++T  SP ERVK+L+Q Q+             GI+   ++   +EG  
Sbjct: 25  IDFLMGGVSAAVAKTAASPIERVKLLIQNQDEMLKQGTLDRKYAGILDCFKRTATQEGVI 84

Query: 78  GLFRGNGLNCIRIFPYSAVQFVVYEACKKHFFHVDGSKGREQLQNW--QRLFSGALCGGC 135
             +RGN  N IR FP  A+ F   +  K  F    G K  E    W    L SG   G  
Sbjct: 85  SFWRGNTANVIRYFPTQALNFAFKDKIKAMF----GFKKEEGYAKWFAGNLASGGAAGAL 140

Query: 136 SVLATYPLDLVRTRLSIQTANLTKLSKSRAHNISKPPGVWDLLCRTYKEEGGIKGLYRGV 195
           S+L  Y LD  RTRL+  + + +K   +R  N     G+ D+  +T K +G + GLYRG 
Sbjct: 141 SLLFVYSLDYARTRLAADSKS-SKKGGARQFN-----GLIDVYKKTLKSDG-VAGLYRGF 193

Query: 196 WPTSLGVVPYVALNFAVYEQFKEFMPEGT--DNTLANFYKLSIGALSGGVAQTVTYPFDL 253
            P+ +G+V Y  L F +Y+  K  +  G+   + LA+F    +G +    A T +YP D 
Sbjct: 194 LPSVVGIVVYRGLYFGMYDSLKPLLLTGSLEGSFLASFL---LGWVVTTGASTCSYPLDT 250

Query: 254 LRRRFQVLAMGGNELGFRYKSVMDALITIGKTEGFRGYYKGLTANLFKVIPSTAV 308
           +RRR  + +  G  +  +Y    D L  I   EG    +KG  AN+ + +    V
Sbjct: 251 VRRRMMMTS--GQAV--KYDGAFDCLRKIVAAEGVGSLFKGCGANILRGVAGAGV 301

 Score = 33.9 bits (76), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 20/79 (25%), Positives = 41/79 (51%), Gaps = 6/79 (7%)

Query: 236 IGALSGGVAQTVTYPFD----LLRRRFQVLAMGGNELGFRYKSVMDALITIGKTEGFRGY 291
           +G +S  VA+T   P +    L++ + ++L  G   L  +Y  ++D        EG   +
Sbjct: 29  MGGVSAAVAKTAASPIERVKLLIQNQDEMLKQG--TLDRKYAGILDCFKRTATQEGVISF 86

Query: 292 YKGLTANLFKVIPSTAVSW 310
           ++G TAN+ +  P+ A+++
Sbjct: 87  WRGNTANVIRYFPTQALNF 105

>Kwal_27.12481
          Length = 304

 Score =  118 bits (296), Expect = 6e-31,   Method: Compositional matrix adjust.
 Identities = 96/302 (31%), Positives = 134/302 (44%), Gaps = 30/302 (9%)

Query: 19  KNDSNVA--FXXXXXXXXVSRTVVSPFERVKILLQVQNSTTAYNQ------GIVGAVRQV 70
           K  SN A  F        VS+T  +P ERVK+L+Q Q+             GI    ++ 
Sbjct: 5   KKQSNFAVDFLMGGVSAAVSKTAAAPIERVKLLIQNQDEMIKQGSLDRRYTGIGECFKRT 64

Query: 71  YREEGTPGLFRGNGLNCIRIFPYSAVQFVVYEACKKHFFHVDGSKGREQLQNW--QRLFS 128
              EG    +RGN  N IR FP  A+ F   +  K  F    G K  E    W    L S
Sbjct: 65  AANEGIASFWRGNTANVIRYFPTQALNFAFKDKIKAMF----GFKKEEGYAKWFAGNLAS 120

Query: 129 GALCGGCSVLATYPLDLVRTRLSIQTANLTKLSKSRAHNISKPPGVWDLLCRTYKEEGGI 188
           G   GG S++  Y LD  RTRL+  +    K    R  N     G+ D+  +T   +G I
Sbjct: 121 GGAAGGLSLMFVYSLDYARTRLAADSKGAKK-GGERQFN-----GLVDVYKKTLASDG-I 173

Query: 189 KGLYRGVWPTSLGVVPYVALNFAVYEQFKEFMPEGT--DNTLANFYKLSIGALSGGVAQT 246
            GLYRG  P+ +G+V Y  L F  Y+  K  +  G+   + LA+F  L     +G  A T
Sbjct: 174 AGLYRGFLPSVVGIVVYRGLYFGGYDSLKPLLLTGSLEGSFLASFL-LGWAVTTG--AST 230

Query: 247 VTYPFDLLRRRFQVLAMGGNELGFRYKSVMDALITIGKTEGFRGYYKGLTANLFKVIPST 306
            +YP D +RRR  + +  G  +  +Y    DA   I   EG +  +KG  AN+ + +   
Sbjct: 231 ASYPLDTVRRRMMMTS--GQAV--KYNGAFDAFRKIVAAEGIKSLFKGCGANILRGVAGA 286

Query: 307 AV 308
            V
Sbjct: 287 GV 288

 Score = 30.4 bits (67), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 18/79 (22%), Positives = 40/79 (50%), Gaps = 6/79 (7%)

Query: 236 IGALSGGVAQTVTYPFD----LLRRRFQVLAMGGNELGFRYKSVMDALITIGKTEGFRGY 291
           +G +S  V++T   P +    L++ + +++  G   L  RY  + +        EG   +
Sbjct: 16  MGGVSAAVSKTAAAPIERVKLLIQNQDEMIKQG--SLDRRYTGIGECFKRTAANEGIASF 73

Query: 292 YKGLTANLFKVIPSTAVSW 310
           ++G TAN+ +  P+ A+++
Sbjct: 74  WRGNTANVIRYFPTQALNF 92

>KLLA0D15015g 1267803..1268756 similar to sp|P53257 Saccharomyces
           cerevisiae YGR096w, start by similarity
          Length = 317

 Score =  117 bits (293), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 93/293 (31%), Positives = 127/293 (43%), Gaps = 27/293 (9%)

Query: 36  SRTVVSPFERVKILLQVQNSTTAYNQGIVGAVRQVYREEGTPGLFRGNGLNCIRIFPYSA 95
           +R   +P + VKI  Q+Q       +GI   VR + +EEG   L++GN         Y A
Sbjct: 32  ARMATAPMDTVKIRYQLQPVQEDKYKGIASTVRTIMKEEGLRALWKGNIPATAMYVVYGA 91

Query: 96  VQFVVYEACKKHFFHVDGSKGREQLQNWQRLFSGALCGGCSVLATYPLDLVRTRLSIQTA 155
           VQF  Y      F +V  +K     Q  Q L  GAL G  S + +YPLDL+RTRL    A
Sbjct: 92  VQFGSYS----WFNNVWSAKFPRFSQQGQTLTVGALAGMTSSVVSYPLDLLRTRL---IA 144

Query: 156 NLTKLSKSRAHNISKPPGVWDLLCRTYKEEGGIKGLYRGVWPTSLGVVPYVALNFAVYEQ 215
           N T    S A             CR      G++G + G+      V    A+ F  YE 
Sbjct: 145 NRTSHRTSVAEE-----------CRQMWLNEGVRGFFTGISTAMTTVTLSTAIMFLTYET 193

Query: 216 FKEFMPEGTDNTLANFYKLSIGALSGGVAQTVTYPFDLLRRRFQVL---------AMGGN 266
                        +     S G ++G V++T+ +P D LRRR QV+              
Sbjct: 194 VNIVCENHEKEFWSRPVSASSGIIAGFVSKTMVFPIDTLRRRMQVMNSKRTVHFTKFPAV 253

Query: 267 ELGFRYKSVMDALITIGKTEGFRGYYKGLTANLFKVIPSTAVSWLVYEVVCDL 319
              +RYKS    +  I + EG    Y+GLT  L K +P+TA+S  VYE   DL
Sbjct: 254 YHEYRYKSSTAIIYKILRQEGVSALYRGLTMGLCKSVPTTAISLFVYERTMDL 306

 Score = 73.9 bits (180), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 58/210 (27%), Positives = 95/210 (45%), Gaps = 21/210 (10%)

Query: 112 DGSKGREQLQNWQRLFSGALCGGCSVLATYPLDLVRTRLSIQTANLTKLSKSRAHNISKP 171
           D  +  E +  +  + +G++ G  + +AT P+D V+ R  +Q     K  K  A  +   
Sbjct: 8   DHLRKGETVSWYNSVIAGSVSGVFARMATAPMDTVKIRYQLQPVQEDKY-KGIASTV--- 63

Query: 172 PGVWDLLCRTYKEEGGIKGLYRGVWPTSLGVVPYVALNFAVYEQFKEFMPEGTDNTLANF 231
                   RT  +E G++ L++G  P +   V Y A+ F  Y  F               
Sbjct: 64  --------RTIMKEEGLRALWKGNIPATAMYVVYGAVQFGSYSWFNNVWSAKFPRFSQQG 115

Query: 232 YKLSIGALSGGVAQTVTYPFDLLRRRFQVLAMGGNELGFRYKSVMDALITIGKTEGFRGY 291
             L++GAL+G  +  V+YP DLLR R     +  N    R  SV +    +   EG RG+
Sbjct: 116 QTLTVGALAGMTSSVVSYPLDLLRTR-----LIANRTSHR-TSVAEECRQMWLNEGVRGF 169

Query: 292 YKGLTANLFKVIPSTAVSWLVYE---VVCD 318
           + G++  +  V  STA+ +L YE   +VC+
Sbjct: 170 FTGISTAMTTVTLSTAIMFLTYETVNIVCE 199

 Score = 50.1 bits (118), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 41/183 (22%), Positives = 75/183 (40%), Gaps = 35/183 (19%)

Query: 57  TAYNQGIVGAVRQVYREEGTPGLFRGNGLNCIRIFPYSAVQFVVYEA----CKKHFFHVD 112
           T++   +    RQ++  EG  G F G       +   +A+ F+ YE     C+ H     
Sbjct: 147 TSHRTSVAEECRQMWLNEGVRGFFTGISTAMTTVTLSTAIMFLTYETVNIVCENH----- 201

Query: 113 GSKGREQLQNWQR---LFSGALCGGCSVLATYPLDLVRTRLSIQTANLTKLSKSRAHNIS 169
                 + + W R     SG + G  S    +P+D +R R+ +       ++  R  + +
Sbjct: 202 ------EKEFWSRPVSASSGIIAGFVSKTMVFPIDTLRRRMQV-------MNSKRTVHFT 248

Query: 170 KPPGVWD---------LLCRTYKEEGGIKGLYRGVWPTSLGVVPYVALNFAVYEQFKEFM 220
           K P V+          ++ +  ++EG +  LYRG+       VP  A++  VYE+  +  
Sbjct: 249 KFPAVYHEYRYKSSTAIIYKILRQEG-VSALYRGLTMGLCKSVPTTAISLFVYERTMDLF 307

Query: 221 PEG 223
             G
Sbjct: 308 DHG 310

 Score = 37.0 bits (84), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 22/89 (24%), Positives = 39/89 (43%), Gaps = 13/89 (14%)

Query: 35  VSRTVVSPFERVKILLQVQNSTTAYN-------------QGIVGAVRQVYREEGTPGLFR 81
           VS+T+V P + ++  +QV NS    +             +     + ++ R+EG   L+R
Sbjct: 221 VSKTMVFPIDTLRRRMQVMNSKRTVHFTKFPAVYHEYRYKSSTAIIYKILRQEGVSALYR 280

Query: 82  GNGLNCIRIFPYSAVQFVVYEACKKHFFH 110
           G  +   +  P +A+   VYE     F H
Sbjct: 281 GLTMGLCKSVPTTAISLFVYERTMDLFDH 309

>YEL006W (YEL006W) [1417] chr5 (144326..145333) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters [1008 bp, 335 aa]
          Length = 335

 Score =  117 bits (293), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 100/318 (31%), Positives = 153/318 (48%), Gaps = 33/318 (10%)

Query: 11  PSYVKSILKN-DSNVAFXXXXXXXXVSRTVVSPFERVKILLQ---VQNST--TAYNQGIV 64
           P+ +  + KN D  VA         +S  +V PF+  K  LQ   +QN T  + + +G  
Sbjct: 26  PTKLNRLKKNADPRVAAISGALSGALSAMLVCPFDVAKTRLQAQGLQNMTHQSQHYKGFF 85

Query: 65  GAVRQVYREEGTPGLFRGNGLNCIRIFPYSAVQFVVYEACKKHFFHVDGSKGREQLQNWQ 124
           G    ++++EG  GL++G     +   P   + F VY+ C+K  + VD       L N  
Sbjct: 86  GTFATIFKDEGAAGLYKGLQPTVLGYIPTLMIYFSVYDFCRK--YSVDIFPHSPFLSNAS 143

Query: 125 RLFSGALCGGCSVLATYPLDLVRTRLSIQTANLTKLSKSRAHNISKPPGVWDLLCRTYKE 184
              S    G  S +AT P+ +V+TRL +QT     + K   H      G  D   +  ++
Sbjct: 144 ---SAITAGAISTVATNPIWVVKTRLMLQTG----IGKYSTHY----KGTIDTFRKIIQQ 192

Query: 185 EGGIKGLYRGVWPTSLGVVPYVALNFAVYEQFK------EFMPEGTDNTLANFYKLSIGA 238
           EG  K LY G+ P  LG++  VA+ F +YE  K      E     TD T +NF KL + +
Sbjct: 193 EGA-KALYAGLVPALLGMLN-VAIQFPLYENLKIRFGYSESTDVSTDVTSSNFQKLILAS 250

Query: 239 -LSGGVAQTVTYPFDLLRRRFQVLAMGGNELGFRYKSVMDALITIG-KTEGFRGYYKGLT 296
            LS  VA TVTYP ++LR R Q+     ++L    +  +  LI I  + EGF G+Y G  
Sbjct: 251 MLSKMVASTVTYPHEILRTRMQL----KSDLPNTVQRHLLPLIKITYRQEGFAGFYSGFA 306

Query: 297 ANLFKVIPSTAVSWLVYE 314
            NL + +P+  V+ + +E
Sbjct: 307 TNLVRTVPAAVVTLVSFE 324

 Score = 39.3 bits (90), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 20/75 (26%), Positives = 38/75 (50%), Gaps = 1/75 (1%)

Query: 35  VSRTVVSPFERVKILLQVQNS-TTAYNQGIVGAVRQVYREEGTPGLFRGNGLNCIRIFPY 93
           V+ TV  P E ++  +Q+++       + ++  ++  YR+EG  G + G   N +R  P 
Sbjct: 256 VASTVTYPHEILRTRMQLKSDLPNTVQRHLLPLIKITYRQEGFAGFYSGFATNLVRTVPA 315

Query: 94  SAVQFVVYEACKKHF 108
           + V  V +E  KK+ 
Sbjct: 316 AVVTLVSFEYSKKYL 330

>Kwal_55.20868
          Length = 380

 Score =  115 bits (288), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 90/290 (31%), Positives = 146/290 (50%), Gaps = 30/290 (10%)

Query: 39  VVSPFERVKILLQVQ---NSTTAYNQGIVGAVRQVYREEGTPGLFRGNGLNCIRIFPYSA 95
            V P +  K  LQ Q   ++ + Y +GI+G +  + R+EG  GL++G     +  FP   
Sbjct: 92  TVCPLDVAKTRLQAQGLHSNPSNYYKGILGTLTTIIRDEGARGLYKGLVPIIMGYFPTWM 151

Query: 96  VQFVVYEACKKHFFHVDGSKGREQLQNWQRLFSGALCGGCSVLATYPLDLVRTRLSIQTA 155
           + F VYE  KK +  +  S             S    G  S + T P+ +V+TRL +QT 
Sbjct: 152 IYFSVYERSKKLYPRIFPS-----FDFISHSASALTAGTVSTILTNPVWVVKTRLMLQT- 205

Query: 156 NLTKLSKSRAHNISKPPGVWDLLCRTYKEEGGIKGLYRGVWPTSLGVVPYVALNFAVYEQ 215
               ++K+  H  S     +D   + Y  EG ++  Y G+ P+ LG+  +VA++F +YE+
Sbjct: 206 ---HVNKNSTHYTS----TFDAFHKMYTTEG-LRTFYAGLLPSLLGLF-HVAIHFPIYEK 256

Query: 216 FKEF------MPEGTDNTLANFYKLSIGA-LSGGVAQTVTYPFDLLRRRFQVLAMGGNEL 268
            K +      M    D+ L N  +L I +  S  VA T+TYP ++LR R Q+ A   + L
Sbjct: 257 LKVWLHCTPSMSRTEDHNL-NLARLIIASSASKMVASTLTYPHEILRTRMQLKAYPTDPL 315

Query: 269 GFRYKSVMDALITI----GKTEGFRGYYKGLTANLFKVIPSTAVSWLVYE 314
               K+    LI +     K+EG RG+Y G TANL + +P++A++ + +E
Sbjct: 316 AALQKTSRHGLIRLIKHTYKSEGLRGFYSGFTANLARTLPASAITLVSFE 365

 Score = 58.9 bits (141), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 50/201 (24%), Positives = 90/201 (44%), Gaps = 18/201 (8%)

Query: 35  VSRTVVSPFERVKILLQVQ---NSTTAYNQGIVGAVRQVYREEGTPGLFRGNGLNCIRIF 91
           VS  + +P   VK  L +Q   N  + +      A  ++Y  EG    + G   + + +F
Sbjct: 186 VSTILTNPVWVVKTRLMLQTHVNKNSTHYTSTFDAFHKMYTTEGLRTFYAGLLPSLLGLF 245

Query: 92  PYSAVQFVVYEACKKHFFHVDGSKGREQLQNW---QRLFSGALCGGCSVLATYPLDLVRT 148
            + A+ F +YE  K  + H   S  R +  N    + + + +     +   TYP +++RT
Sbjct: 246 -HVAIHFPIYEKLKV-WLHCTPSMSRTEDHNLNLARLIIASSASKMVASTLTYPHEILRT 303

Query: 149 RLSIQ---TANLTKLSKSRAHNISKPPGVWDLLCRTYKEEGGIKGLYRGVWPTSLGVVPY 205
           R+ ++   T  L  L K+  H      G+  L+  TYK EG ++G Y G        +P 
Sbjct: 304 RMQLKAYPTDPLAALQKTSRH------GLIRLIKHTYKSEG-LRGFYSGFTANLARTLPA 356

Query: 206 VALNFAVYEQFKEFMPEGTDN 226
            A+    +E F++++ +  DN
Sbjct: 357 SAITLVSFEYFRKYLTKLNDN 377

>CAGL0J02002g 198226..199311 similar to sp|P40556 Saccharomyces
           cerevisiae YIL006w or sp|P39953 Saccharomyces cerevisiae
           YEL006w, hypothetical start
          Length = 361

 Score =  113 bits (282), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 86/316 (27%), Positives = 149/316 (47%), Gaps = 36/316 (11%)

Query: 20  NDSNVAFXXXXXXXXVSRTVVSPFERVKILLQVQ-----NSTTAYNQGIVGAVRQVYREE 74
           ND+ +          +S  VV P +  K  LQ Q      +   Y +G +G +  + R+E
Sbjct: 66  NDNRINAISGALAGLLSGIVVCPLDVAKTRLQAQGLQTRTTENLYYRGSIGTMTTIVRDE 125

Query: 75  GTPGLFRGNGLNCIRIFPYSAVQFVVYEACKKHFFHVDGSKGREQLQNW---QRLFSGAL 131
           G  GL++G     +  FP   + F VYE CK +         R    NW      FS   
Sbjct: 126 GVRGLYKGLVPIIMGYFPTWMIYFSVYEFCKDNL--------RTNSSNWSFVSHSFSAIT 177

Query: 132 CGGCSVLATYPLDLVRTRLSIQTANLTKLSKSRAHNISKPPGVWDLLCRTYKEEGGIKGL 191
            G  S + T P+ +V+TRL +QT            N +   G +D   +   +E G+K L
Sbjct: 178 AGAVSTVVTNPIWVVKTRLMLQT--------HIGSNTTHYQGTYDAFKKIINQE-GVKAL 228

Query: 192 YRGVWPTSLGVVPYVALNFAVYEQFKEFM-----PEGTDNTLANFYKLSIG-ALSGGVAQ 245
           Y G+ P+ LG++ +VA++F VYE+ K         E ++ +  N  +L +  ++S  VA 
Sbjct: 229 YAGLVPSLLGLL-HVAIHFPVYERLKVSFKCYQRDESSNESKINLKRLILASSVSKMVAS 287

Query: 246 TVTYPFDLLRRRFQVLAMGGNELGFRYKSVMDALITIGKTEGFRGYYKGLTANLFKVIPS 305
            ++YP ++LR R Q+     ++L    + ++  +      EG  G+Y G   NLF+ +P+
Sbjct: 288 VLSYPHEILRTRLQL----KSDLPSHQRRLIPLIKITYIQEGIFGFYSGFGTNLFRTLPA 343

Query: 306 TAVSWLVYEVVCDLMH 321
           +A++ + +E V + ++
Sbjct: 344 SAITLVSFEYVRNFLN 359

>KLLA0E12353g complement(1092303..1093220)
           gi|1351895|sp|P49382|ADT_KLULA Kluyveromyces lactis ADP,
           ATP carrier protein (ADP/ATP translocase) (Adenine
           nucleotide translocator) (ANT), start by similarity
          Length = 305

 Score =  110 bits (274), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 93/307 (30%), Positives = 135/307 (43%), Gaps = 34/307 (11%)

Query: 16  SILKNDSNVA--FXXXXXXXXVSRTVVSPFERVKILLQVQNSTTAYNQ------GIVGAV 67
           S  K  SN A  F        VS+T  +P ERVK+L+Q Q+             GIV   
Sbjct: 2   STDKKQSNFAIDFLMGGVSAAVSKTAAAPIERVKLLIQNQDEMIKQGSLDRRYTGIVECF 61

Query: 68  RQVYREEGTPGLFRGNGLNCIRIFPYSAVQFVVYEACKKHFFHVDGSKGREQLQNWQRLF 127
           ++   +EG    +RGN  N IR FP  A+ F   +  K  F    G K  E    W   F
Sbjct: 62  KRTAADEGVASFWRGNTANVIRYFPTQALNFAFKDKIKAMF----GFKKEEGYAKW---F 114

Query: 128 SGALCGGCSVLA-----TYPLDLVRTRLSIQTANLTKLSKSRAHNISKPPGVWDLLCRTY 182
           +G L  G           Y LD  RTRL+  + +  K    R  N     G+ D+  +T 
Sbjct: 115 AGNLASGGLAGGLSLLFVYSLDYARTRLAADSKSAKK-GGERQFN-----GLVDVYKKTL 168

Query: 183 KEEGGIKGLYRGVWPTSLGVVPYVALNFAVYEQFKEFMPEGT-DNTLANFYKLSIGALSG 241
             +G + GLYRG  P+ +G+V Y  L F +Y+  K  +  G+ +N+    + L     +G
Sbjct: 169 ASDG-VAGLYRGFLPSVVGIVVYRGLYFGLYDSLKPLLLTGSLENSFLASFLLGWAVTTG 227

Query: 242 GVAQTVTYPFDLLRRRFQVLAMGGNELGFRYKSVMDALITIGKTEGFRGYYKGLTANLFK 301
             A T +YP D +RRR  ++   G  +  +Y    DA   I   EG +  +KG  AN+ +
Sbjct: 228 --ASTASYPLDTVRRR--MMMTSGQAV--KYDGAFDAFRKIVAAEGIKSLFKGCGANILR 281

Query: 302 VIPSTAV 308
            +    V
Sbjct: 282 GVAGAGV 288

 Score = 33.9 bits (76), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 22/92 (23%), Positives = 46/92 (50%), Gaps = 7/92 (7%)

Query: 224 TDNTLANF-YKLSIGALSGGVAQTVTYPFD----LLRRRFQVLAMGGNELGFRYKSVMDA 278
           TD   +NF     +G +S  V++T   P +    L++ + +++  G   L  RY  +++ 
Sbjct: 3   TDKKQSNFAIDFLMGGVSAAVSKTAAAPIERVKLLIQNQDEMIKQG--SLDRRYTGIVEC 60

Query: 279 LITIGKTEGFRGYYKGLTANLFKVIPSTAVSW 310
                  EG   +++G TAN+ +  P+ A+++
Sbjct: 61  FKRTAADEGVASFWRGNTANVIRYFPTQALNF 92

 Score = 29.3 bits (64), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 18/80 (22%), Positives = 32/80 (40%)

Query: 10  QPSYVKSILKNDSNVAFXXXXXXXXVSRTVVSPFERVKILLQVQNSTTAYNQGIVGAVRQ 69
           +P  +   L+N    +F         + T   P + V+  + + +       G   A R+
Sbjct: 202 KPLLLTGSLENSFLASFLLGWAVTTGASTASYPLDTVRRRMMMTSGQAVKYDGAFDAFRK 261

Query: 70  VYREEGTPGLFRGNGLNCIR 89
           +   EG   LF+G G N +R
Sbjct: 262 IVAAEGIKSLFKGCGANILR 281

>Scas_602.8
          Length = 885

 Score =  111 bits (278), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 87/294 (29%), Positives = 137/294 (46%), Gaps = 26/294 (8%)

Query: 35  VSRTVVSPFERVKILLQVQNSTTAYNQGIVGAVRQVYREEGTPGLFRGNGLNCIRIFPYS 94
           +  T+V P + +K  +Q Q S T Y   I   V+ ++ +EG  GL+ G G   I + P  
Sbjct: 511 IGATLVYPIDFIKTRMQAQRSLTKYKNSIDCLVK-IFGKEGIRGLYSGLGPQLIGVAPEK 569

Query: 95  AVQFVVYEACKKHFFHVDGSKGREQLQNWQRLFSGALCGGCSVLATYPLDLVRTRLSIQT 154
           A++  V +  +K      G+     LQ    + SGA  G C V+ T PL++V+ RL +  
Sbjct: 570 AIKLTVNDFMRKSLVDKKGN-----LQLGAEVLSGATAGACQVVFTNPLEIVKIRLQV-- 622

Query: 155 ANLTKLSKSRAHNISKPPGVWDLLCRTYKEEGGIKGLYRGVWPTSLGVVPYVALNFAVYE 214
                  KS   N   P     L      +E  + GLY+GV    L  VP+ A+ F  Y 
Sbjct: 623 -------KSEYTNAMIPKS--QLTAFQIIKELKLIGLYKGVGACLLRDVPFSAIYFPTYA 673

Query: 215 QFK----EFMPEGTD--NTLANFYKLSIGALSGGVAQTVTYPFDLLRRRFQVLAMGGNEL 268
             K    +F P   D  + L  +  L+ GAL+G  A  +T PFD+++ R Q+    G   
Sbjct: 674 HLKKNVFQFDPNDKDKRDRLKTWELLTAGALAGVPAAFLTTPFDVIKTRLQIEPGVGET- 732

Query: 269 GFRYKSVMDALITIGKTEGFRGYYKGLTANLFKVIPSTAVSWLVYEVVCDLMHV 322
             RY  ++ A+ TI K E FR ++KG  A + +  P    +   YE+  ++ ++
Sbjct: 733 --RYTGILHAVRTILKEESFRSFFKGGAARVMRSSPQFGFTLAAYELFKNMFNI 784

 Score = 49.7 bits (117), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 38/149 (25%), Positives = 59/149 (39%), Gaps = 32/149 (21%)

Query: 168 ISKPPGVWDLLCRTYKEEGGIKGLYRGVWPTSLGVVPYVALNFAVYEQFKEFMPEGTDNT 227
           I  P  + DL+ R   E  G + LYR  +                      F P      
Sbjct: 463 ILNPNYLNDLVHRLELERIGKESLYRNYY----------------------FYP-----I 495

Query: 228 LANFYKLSIGALSGGVAQTVTYPFDLLRRRFQVLAMGGNELGFRYKSVMDALITIGKTEG 287
             + +  S+G+++G +  T+ YP D ++ R Q           +YK+ +D L+ I   EG
Sbjct: 496 FDSIFNFSLGSVAGCIGATLVYPIDFIKTRMQAQRSLT-----KYKNSIDCLVKIFGKEG 550

Query: 288 FRGYYKGLTANLFKVIPSTAVSWLVYEVV 316
            RG Y GL   L  V P  A+   V + +
Sbjct: 551 IRGLYSGLGPQLIGVAPEKAIKLTVNDFM 579

>ADL009W [1733] [Homologous to ScYIL006W - SH; ScYEL006W - SH]
           complement(693078..694217) [1140 bp, 379 aa]
          Length = 379

 Score =  109 bits (272), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 89/318 (27%), Positives = 150/318 (47%), Gaps = 35/318 (11%)

Query: 18  LKNDSNVAFXXXXXXXXVSRTVVSPFERVKILLQVQNSTTA--YNQGIVGAVRQVYREEG 75
           L +D+ V          VS  +V P +  K  LQ Q + +   Y +GIVG +  + R+EG
Sbjct: 80  LLDDTQVTAVSGALAGFVSGIMVCPLDVAKTRLQAQGAGSGERYYRGIVGTLSAILRDEG 139

Query: 76  TPGLFRGNGLNCIRIFPYSAVQFVVYEACKKHF-FHVDGSKGREQLQNWQRLFSGALCGG 134
             GL++G     +  FP   + F VYE CK+ +  ++ G              S    G 
Sbjct: 140 VAGLYKGLAPIVLGYFPTWMLYFSVYEKCKQRYPSYLPGG-------FVSHAASALTAGA 192

Query: 135 CSVLATYPLDLVRTRLSIQTANLTKLSKSRAHNISKPPGVWDLLCRTYKEEGGIKGLYRG 194
            S   T P+ +V+TRL IQ+ ++++ S +    +       D   + Y+ E G+K  Y G
Sbjct: 193 ISTALTNPIWVVKTRLMIQS-DVSRDSTNYRSTL-------DAFRKMYRSE-GLKVFYSG 243

Query: 195 VWPTSLGVVPYVALNFAVYEQFKEFMPEGT---DNTLANFYKLSI------GALSGGVAQ 245
           + P+  G+  +VA++F VYE+ K ++   T   D    +  KL +        LS  VA 
Sbjct: 244 LVPSLFGLF-HVAIHFPVYEKLKIWLHRNTPAADGQRLDHNKLQLDRLIVASCLSKVVAS 302

Query: 246 TVTYPFDLLRRRFQVLAMGGNELGFRYKSVMDALITIGKTEGFRGYYKGLTANLFKVIPS 305
            +TYP ++LR R QV   G         S+++ L  I  +EG+ G+Y G   NL + +P+
Sbjct: 303 VITYPHEILRTRMQVRHSGVP------PSLLNLLGRIRASEGYVGFYSGFATNLVRTVPA 356

Query: 306 TAVSWLVYEVVCDLMHVW 323
           + ++ + +E     + +W
Sbjct: 357 SVITLVSFEYFRKYLRMW 374

>YPR021C (AGC1) [5455] chr16 complement(600644..603352) Member of
           the mitochondrial carrier family (MCF) of membrane
           transporters [2709 bp, 902 aa]
          Length = 902

 Score =  107 bits (268), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 82/287 (28%), Positives = 131/287 (45%), Gaps = 26/287 (9%)

Query: 35  VSRTVVSPFERVKILLQVQNSTTAYNQGIVGAVRQVYREEGTPGLFRGNGLNCIRIFPYS 94
           +  TVV P + +K  +Q Q S   Y   I   ++ + RE G  GL+ G G   I + P  
Sbjct: 543 IGATVVYPIDFIKTRMQAQRSLAQYKNSIDCLLKIISRE-GIKGLYSGLGPQLIGVAPEK 601

Query: 95  AVQFVVYEACKKHFFHVDGSKGREQLQNWQRLFSGALCGGCSVLATYPLDLVRTRLSIQT 154
           A++  V +  +      +G     +L  +  + SGA  G C V+ T PL++V+ RL +Q 
Sbjct: 602 AIKLTVNDFMRNRLTDKNG-----KLSLFPEIISGASAGACQVIFTNPLEIVKIRLQVQ- 655

Query: 155 ANLTKLSKSRAHNISKPPGVWDLLCRTYKEEGGIKGLYRGVWPTSLGVVPYVALNFAVYE 214
                 S     NI +       + +      G++GLY GV    +  VP+ A+ F  Y 
Sbjct: 656 ------SDYVGENIQQANETATQIVKKL----GLRGLYNGVAACLMRDVPFSAIYFPTYA 705

Query: 215 QFKE--FMPEGTDNTLANFYK----LSIGALSGGVAQTVTYPFDLLRRRFQVLAMGGNEL 268
             K+  F  +  D T  N  K    L+ GA++G  A  +T PFD+++ R Q+    G   
Sbjct: 706 HLKKDLFDFDPNDKTKRNRLKTWELLTAGAIAGMPAAFLTTPFDVIKTRLQIDPRKGET- 764

Query: 269 GFRYKSVMDALITIGKTEGFRGYYKGLTANLFKVIPSTAVSWLVYEV 315
             +Y  +  A+ TI K E FR ++KG  A + +  P    +   YE+
Sbjct: 765 --KYNGIFHAIRTILKEESFRSFFKGGGARVLRSSPQFGFTLAAYEL 809

 Score = 78.6 bits (192), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 58/192 (30%), Positives = 85/192 (44%), Gaps = 15/192 (7%)

Query: 40  VSPFERVKILLQVQNSTTAYN-QGIVGAVRQVYREEGTPGLFRGNGLNCIRIFPYSAVQF 98
            +P E VKI LQVQ+     N Q       Q+ ++ G  GL+ G     +R  P+SA+ F
Sbjct: 642 TNPLEIVKIRLQVQSDYVGENIQQANETATQIVKKLGLRGLYNGVAACLMRDVPFSAIYF 701

Query: 99  VVYEACKKHFFHVD--GSKGREQLQNWQRLFSGALCGGCSVLATYPLDLVRTRLSIQTAN 156
             Y   KK  F  D      R +L+ W+ L +GA+ G  +   T P D+++TRL I    
Sbjct: 702 PTYAHLKKDLFDFDPNDKTKRNRLKTWELLTAGAIAGMPAAFLTTPFDVIKTRLQIDP-- 759

Query: 157 LTKLSKSRAHNISKPPGVWDLLCRTYKEEGGIKGLYRGVWPTSLGVVPYVALNFAVYEQF 216
                       +K  G++  + RT  +E   +  ++G     L   P      A YE F
Sbjct: 760 --------RKGETKYNGIFHAI-RTILKEESFRSFFKGGGARVLRSSPQFGFTLAAYELF 810

Query: 217 KEFMPEGTDNTL 228
           K F+P   DN L
Sbjct: 811 KGFIP-SPDNKL 821

>Sklu_2431.5 YBR192W, Contig c2431 8526-9638
          Length = 370

 Score =  105 bits (261), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 87/318 (27%), Positives = 140/318 (44%), Gaps = 53/318 (16%)

Query: 39  VVSPFERVKILLQVQNSTTAY---------NQGIV------------GAVRQVYREEGTP 77
           V  PF+ VK  LQ      AY         NQ  V            G +  VYR EG  
Sbjct: 69  VTCPFDVVKTRLQSDVFQAAYKSHAKSIGPNQANVIAQGVRHFKETFGIISNVYRNEGFR 128

Query: 78  GLFRGNGLNCIRIFPYSAVQFVVYEACKKHFFHVDGSKGREQLQNWQRLFSGALCGGCSV 137
            LF+G G N + + P  ++ F  Y    K  +    + G+E +  W  L + A  G  + 
Sbjct: 129 SLFKGLGPNLVGVIPARSINFFTY-GTTKEIYSKTLNNGQEAV--WIHLMAAATAGWATS 185

Query: 138 LATYPLDLVRTRLSIQTANLTKLSKSRAHNISKPPGVWDLLCRTYKEEGGIKGLYRGVWP 197
            AT P+ LV+TRL +  A  TK  K+           WD L    ++E GI GLY+G+  
Sbjct: 186 TATNPIWLVKTRLQLDKAGTTKKYKNS----------WDCLKNVVQKE-GILGLYKGLSA 234

Query: 198 TSLGVVPYVALNFAVYEQFKEFMPEGTDNTLANFYKLS---------------IGALSGG 242
           + LG V  + L + +YEQ K  + + +     N  ++                   L+  
Sbjct: 235 SYLGSVEGI-LQWVLYEQMKHIIKQRSMEKFGNISEVEKSTSDKIKEWCQRSGSAGLAKF 293

Query: 243 VAQTVTYPFDLLRRRFQVLAMGGNELGFRYKSVMDALITIGKTEGFRGYYKGLTANLFKV 302
           VA  +TYP +++R R +   +   +L  +Y  ++ ++  I K EG    Y GLT +L + 
Sbjct: 294 VASIITYPHEVVRTRLRQAPLENGKL--KYTGLVQSIRVIIKEEGLASMYGGLTPHLLRT 351

Query: 303 IPSTAVSWLVYEVVCDLM 320
           +P++ + +  +E+V  L+
Sbjct: 352 VPNSIIMFGTWELVIRLL 369

 Score = 67.8 bits (164), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 59/211 (27%), Positives = 100/211 (47%), Gaps = 22/211 (10%)

Query: 118 EQLQNWQRLFSGALCGGCSVLATYPLDLVRTRLSIQTANLTKLSKSRAHNISKPPGVWDL 177
           ++++ W    +G + G    + T P D+V+TRL  Q+       KS A +I   P   ++
Sbjct: 48  KEVKPWVHFVAGGIGGMAGAVVTCPFDVVKTRL--QSDVFQAAYKSHAKSIG--PNQANV 103

Query: 178 LC---RTYKEEGGI----------KGLYRGVWPTSLGVVPYVALNFAVYEQFKEFMPEGT 224
           +    R +KE  GI          + L++G+ P  +GV+P  ++NF  Y   KE   +  
Sbjct: 104 IAQGVRHFKETFGIISNVYRNEGFRSLFKGLGPNLVGVIPARSINFFTYGTTKEIYSKTL 163

Query: 225 DN-TLANFYKLSIGALSGGVAQTVTYPFDLLRRRFQVLAMGGNELGFRYKSVMDALITIG 283
           +N   A +  L   A +G    T T P  L++ R Q+   G  +   +YK+  D L  + 
Sbjct: 164 NNGQEAVWIHLMAAATAGWATSTATNPIWLVKTRLQLDKAGTTK---KYKNSWDCLKNVV 220

Query: 284 KTEGFRGYYKGLTANLFKVIPSTAVSWLVYE 314
           + EG  G YKGL+A+    +    + W++YE
Sbjct: 221 QKEGILGLYKGLSASYLGSVEGI-LQWVLYE 250

>YIL006W (YIL006W) [2659] chr9 (344059..345180) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters [1122 bp, 373 aa]
          Length = 373

 Score =  104 bits (260), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 87/289 (30%), Positives = 145/289 (50%), Gaps = 28/289 (9%)

Query: 35  VSRTVVSPFERVKILLQVQNSTT----AYNQGIVGAVRQVYREEGTPGLFRGNGLNCIRI 90
           +S   V P +  K  LQ Q   T     Y +GI+G +  + R+EG  GL++G     +  
Sbjct: 90  LSGVAVCPLDVAKTRLQAQGLQTRFENPYYRGIMGTLSTIVRDEGPRGLYKGLVPIVLGY 149

Query: 91  FPYSAVQFVVYEACKKHFFHVDGSKGREQLQNWQRLFSGALCGGCSVLATYPLDLVRTRL 150
           FP   + F VYE  KK FFH    +     Q+   + +GA     S   T P+ +V+TRL
Sbjct: 150 FPTWMIYFSVYEFSKK-FFHGIFPQFDFVAQSCAAITAGA----ASTTLTNPIWVVKTRL 204

Query: 151 SIQTANLTKLSKSRAHNISKPPGVWDLLCRTYKEEGGIKGLYRGVWPTSLGVVPYVALNF 210
            +Q    + L +   H      G +D   + + +E G K LY G+ P+ LG+  +VA++F
Sbjct: 205 MLQ----SNLGEHPTHY----KGTFDAFRKLFYQE-GFKALYAGLVPSLLGLF-HVAIHF 254

Query: 211 AVYE----QFKEFMPEGTDNTLANFYKLSIG-ALSGGVAQTVTYPFDLLRRRFQVLAMGG 265
            +YE    +F  +  E   N++ N  +L +  ++S  +A  VTYP ++LR R Q+ +   
Sbjct: 255 PIYEDLKVRFHCYSRENNTNSI-NLQRLIMASSVSKMIASAVTYPHEILRTRMQLKSDIP 313

Query: 266 NELGFRYKSVMDALITIGKTEGFRGYYKGLTANLFKVIPSTAVSWLVYE 314
           + +  R   ++ A       EG +G+Y G T NL + IP++A++ + +E
Sbjct: 314 DSIQRRLFPLIKATYA---QEGLKGFYSGFTTNLVRTIPASAITLVSFE 359

 Score = 65.1 bits (157), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 61/201 (30%), Positives = 93/201 (46%), Gaps = 19/201 (9%)

Query: 127 FSGALCGGCSVLATYPLDLVRTRLSIQTANLTKLSKSRAHNISKPP---GVWDLLCRTYK 183
            SGA  G  S +A  PLD+ +TRL  Q        ++R  N    P   G+   L    +
Sbjct: 82  LSGAFAGFLSGVAVCPLDVAKTRLQAQGL------QTRFEN----PYYRGIMGTLSTIVR 131

Query: 184 EEGGIKGLYRGVWPTSLGVVPYVALNFAVYEQFKEFMPEGTDNTLANFYKLSIGALSGGV 243
           +EG  +GLY+G+ P  LG  P   + F+VYE  K+F   G      +F   S  A++ G 
Sbjct: 132 DEGP-RGLYKGLVPIVLGYFPTWMIYFSVYEFSKKFF-HGIFPQF-DFVAQSCAAITAGA 188

Query: 244 AQ-TVTYPFDLLRRRFQVLAMGGNELGFRYKSVMDALITIGKTEGFRGYYKGLTANLFKV 302
           A  T+T P  +++ R  + +  G E    YK   DA   +   EGF+  Y GL  +L  +
Sbjct: 189 ASTTLTNPIWVVKTRLMLQSNLG-EHPTHYKGTFDAFRKLFYQEGFKALYAGLVPSLLGL 247

Query: 303 IPSTAVSWLVYEVVCDLMHVW 323
               A+ + +YE +    H +
Sbjct: 248 F-HVAIHFPIYEDLKVRFHCY 267

 Score = 55.1 bits (131), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 45/186 (24%), Positives = 87/186 (46%), Gaps = 17/186 (9%)

Query: 36  SRTVVSPFERVKILLQVQNST---TAYNQGIVGAVRQVYREEGTPGLFRGNGLNCIRIFP 92
           S T+ +P   VK  L +Q++      + +G   A R+++ +EG   L+ G   + + +F 
Sbjct: 190 STTLTNPIWVVKTRLMLQSNLGEHPTHYKGTFDAFRKLFYQEGFKALYAGLVPSLLGLF- 248

Query: 93  YSAVQFVVYEACKKHFFHVDGSKGREQLQNWQRL-FSGALCGGCSVLATYPLDLVRTRLS 151
           + A+ F +YE  K  F H    +      N QRL  + ++    +   TYP +++RTR+ 
Sbjct: 249 HVAIHFPIYEDLKVRF-HCYSRENNTNSINLQRLIMASSVSKMIASAVTYPHEILRTRMQ 307

Query: 152 IQTANLTKLSKSRAHNISKPPGVWDLLCRTYKEEGGIKGLYRGVWPTSLGVVPYVALNFA 211
           +++     + +           ++ L+  TY +EG +KG Y G     +  +P  A+   
Sbjct: 308 LKSDIPDSIQRR----------LFPLIKATYAQEG-LKGFYSGFTTNLVRTIPASAITLV 356

Query: 212 VYEQFK 217
            +E F+
Sbjct: 357 SFEYFR 362

>ADL049W [1692] [Homologous to ScYPR021C - SH]
           complement(598135..600873) [2739 bp, 912 aa]
          Length = 912

 Score =  106 bits (265), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 80/288 (27%), Positives = 131/288 (45%), Gaps = 27/288 (9%)

Query: 39  VVSPFERVKILLQVQNSTTAYNQGIVGAVRQVYREEGTPGLFRGNGLNCIRIFPYSAVQF 98
           VV P + VK  +Q Q   + Y   I   + ++  +EG  GL+ G G   I + P  A++ 
Sbjct: 541 VVYPIDMVKTRMQAQRDFSKYKNSI-DCLLKILSKEGVRGLYSGLGPQLIGVAPEKAIKL 599

Query: 99  VVYEACKKHFFHVDGSKGREQLQNWQRLFSGALCGGCSVLATYPLDLVRTRLSIQTANLT 158
            V +  +      DG     +L     + SGA  G C V+ T PL++V+ RL +++  + 
Sbjct: 600 TVNDHMRATLAGRDG-----KLSLPCEIISGATAGACQVVFTNPLEIVKIRLQVKSDYVA 654

Query: 159 KLSKSRAHNISKPPGVWDLLCRTYKEEGGIKGLYRGVWPTSLGVVPYVALNFAVYEQFK- 217
             +++  + IS    +            G+ GLYRG     L  +P+ A+ F  Y   K 
Sbjct: 655 DAARNSVNAISVIKNL------------GLIGLYRGAGACLLRDIPFSAIYFPTYAHIKS 702

Query: 218 ---EFMPEGTD--NTLANFYKLSIGALSGGVAQTVTYPFDLLRRRFQVLAMGGNELGFRY 272
               F P+ +D  N L  +  L  G L+G  A  +T PFD+++ R Q+    G  +   Y
Sbjct: 703 NVFNFDPKDSDKRNKLNTWQLLVSGGLAGMPAAFLTTPFDVIKTRLQIDPKKGESV---Y 759

Query: 273 KSVMDALITIGKTEGFRGYYKGLTANLFKVIPSTAVSWLVYEVVCDLM 320
             + DA  TI K EG + ++KG  A + +  P    +   YE+  +L 
Sbjct: 760 NGIWDAARTILKEEGIKSFFKGGPARVLRSSPQFGFTLAAYEIFHNLF 807

 Score = 87.0 bits (214), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 68/214 (31%), Positives = 97/214 (45%), Gaps = 18/214 (8%)

Query: 40  VSPFERVKILLQVQNSTTA-YNQGIVGAVRQVYREEGTPGLFRGNGLNCIRIFPYSAVQF 98
            +P E VKI LQV++   A   +  V A+  V +  G  GL+RG G   +R  P+SA+ F
Sbjct: 636 TNPLEIVKIRLQVKSDYVADAARNSVNAI-SVIKNLGLIGLYRGAGACLLRDIPFSAIYF 694

Query: 99  VVYEACKKHFFHVD--GSKGREQLQNWQRLFSGALCGGCSVLATYPLDLVRTRLSIQTAN 156
             Y   K + F+ D   S  R +L  WQ L SG L G  +   T P D+++TRL I    
Sbjct: 695 PTYAHIKSNVFNFDPKDSDKRNKLNTWQLLVSGGLAGMPAAFLTTPFDVIKTRLQIDPKK 754

Query: 157 LTKLSKSRAHNISKPPGVWDLLCRTYKEEGGIKGLYRGVWPTSLGVVPYVALNFAVYEQF 216
              +            G+WD   RT  +E GIK  ++G     L   P      A YE F
Sbjct: 755 GESVYN----------GIWD-AARTILKEEGIKSFFKGGPARVLRSSPQFGFTLAAYEIF 803

Query: 217 KEFMPEG--TDNTLANFYKLSIGALSGGVAQTVT 248
               P     D+T     +  +GAL+  + +TV+
Sbjct: 804 HNLFPAPRYDDSTTHRPTREPVGALA-PINKTVS 836

 Score = 50.4 bits (119), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 27/82 (32%), Positives = 42/82 (51%), Gaps = 7/82 (8%)

Query: 232 YKLSIGALSGGVAQTVTYPFDLLRRRFQVLAMGGNELGF-RYKSVMDALITIGKTEGFRG 290
           Y  ++G+++G +   V YP D+++ R Q       +  F +YK+ +D L+ I   EG RG
Sbjct: 526 YNFTLGSVAGCIGAMVVYPIDMVKTRMQA------QRDFSKYKNSIDCLLKILSKEGVRG 579

Query: 291 YYKGLTANLFKVIPSTAVSWLV 312
            Y GL   L  V P  A+   V
Sbjct: 580 LYSGLGPQLIGVAPEKAIKLTV 601

>Kwal_23.3965
          Length = 307

 Score =  102 bits (254), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 82/294 (27%), Positives = 135/294 (45%), Gaps = 36/294 (12%)

Query: 36  SRTVVSPFERVKILLQVQNSTTAYNQGIVGAVRQVYREEGTPGLFRGNGLNCIRIFPYSA 95
           +R V +P + +KI LQ+Q +  A   GI+   +++ R+EG   L++GN         Y +
Sbjct: 28  ARIVTAPLDTLKIRLQLQLANEAQYGGILVTFKRLVRQEGVRALWKGNVPAMAMYILYGS 87

Query: 96  VQFVVYEACKKHFFHVDGSKGREQLQNWQRLFSGALCGGCSVLATYPLDLVRTRLSIQTA 155
            QF  Y    K       SK +   Q    +  GAL G CS +A+YP D++RTR      
Sbjct: 88  TQFTSYAILNKLL-----SKSQLPAQIHTGMV-GALSGTCSAIASYPCDVLRTRF----- 136

Query: 156 NLTKLSKSRAHNISKPPGVWDLLCRTYKEEGGIKGLYRGVWPTSLGVVPYVALNFAVYEQ 215
            +   S+  +  +S    +W           G +G ++GV  + + +    +   A YE 
Sbjct: 137 -IANHSRELSTMLSTAQEIW--------RHEGFRGFFKGVSSSIVSIAVATSSILATYES 187

Query: 216 FKEFMPE--GTDNTLANFYKLSIGALSGGVAQTVTYPFDLLRRRFQVLAM------GGNE 267
            K F  +    D+++    + S   ++G V++T+ +P D +R+R+QV+        G   
Sbjct: 188 VKIFCEQRPDRDSSVIQLLESSASVIAGIVSKTIVFPIDTVRKRYQVIDWQQLGHPGHTN 247

Query: 268 LGFR-YKSVMD------ALITIGKTEGFRGYYKGLTANLFKVIPSTAVSWLVYE 314
             ++ YKS         AL+ + K EG    Y G T  + K +PST VS  VYE
Sbjct: 248 KAYKAYKSYTSTNFLRLALMIVEK-EGLLALYHGYTLGIAKSVPSTVVSLGVYE 300

 Score = 72.0 bits (175), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 55/202 (27%), Positives = 97/202 (48%), Gaps = 21/202 (10%)

Query: 115 KGREQLQNWQRLFSGALCGGCSVLATYPLDLVRTRLSIQTANLTKLSKSRAHNISKPPGV 174
           KG+E +  +Q L +G L G  + + T PLD ++ RL +Q AN  +             G+
Sbjct: 8   KGQE-VPVFQSLVAGCLSGISARIVTAPLDTLKIRLQLQLANEAQYG-----------GI 55

Query: 175 WDLLCRTYKEEGGIKGLYRGVWPTSLGVVPYVALNFAVYEQFKEFMPEGTDNTLANFYKL 234
                R  ++EG ++ L++G  P     + Y +  F  Y    + + +      A  +  
Sbjct: 56  LVTFKRLVRQEG-VRALWKGNVPAMAMYILYGSTQFTSYAILNKLLSK--SQLPAQIHTG 112

Query: 235 SIGALSGGVAQTVTYPFDLLRRRFQVLAMGGNELGFRYKSVMDALITIGKTEGFRGYYKG 294
            +GALSG  +   +YP D+LR RF  +A    EL     +++     I + EGFRG++KG
Sbjct: 113 MVGALSGTCSAIASYPCDVLRTRF--IANHSRELS----TMLSTAQEIWRHEGFRGFFKG 166

Query: 295 LTANLFKVIPSTAVSWLVYEVV 316
           +++++  +  +T+     YE V
Sbjct: 167 VSSSIVSIAVATSSILATYESV 188

>Sklu_2359.6 YPR021C, Contig c2359 14617-17325
          Length = 902

 Score =  105 bits (262), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 81/292 (27%), Positives = 134/292 (45%), Gaps = 27/292 (9%)

Query: 35  VSRTVVSPFERVKILLQVQNSTTAYNQGIVGAVRQVYREEGTPGLFRGNGLNCIRIFPYS 94
           +  TVV P + VK  +Q Q S + Y   I     +++  EG  G++ G G   I + P  
Sbjct: 531 IGATVVYPIDLVKTRMQAQRSFSQYKNSI-DCFAKIFSREGIRGIYSGLGPQLIGVAPEK 589

Query: 95  AVQFVVYEACKKHFFHVDGSKGREQLQNWQRLFSGALCGGCSVLATYPLDLVRTRLSIQT 154
           A++  V +  +              L+ +  + SGA  G C V+ T PL++V+ RL +++
Sbjct: 590 AIKLTVNDYMRGRLM-----DKHANLKWYFEILSGACAGACQVVFTNPLEVVKIRLQVRS 644

Query: 155 ANLTKLSKSRAHNISKPPGVWDLLCRTYKEEGGIKGLYRGVWPTSLGVVPYVALNFAVYE 214
                + KS+   +    GV   L        GIKGLY+G+    +  VP+ A+ F  Y 
Sbjct: 645 EYAGDVLKSQVTAL----GVIKQL--------GIKGLYKGIAACLMRDVPFSAIYFPTYA 692

Query: 215 QFKE--FMPEGTD----NTLANFYKLSIGALSGGVAQTVTYPFDLLRRRFQVLAMGGNEL 268
             K+  F  +  D    N L  +  L  G L+G  A  +T PFD+++ R Q+    G   
Sbjct: 693 HLKKDVFKYDPKDKKQRNKLKTWELLVAGGLAGMPAAYLTTPFDVIKTRLQIDPRKGET- 751

Query: 269 GFRYKSVMDALITIGKTEGFRGYYKGLTANLFKVIPSTAVSWLVYEVVCDLM 320
             RY+ +  A  TI K E F+ ++KG +A + +  P    +   YE+  ++ 
Sbjct: 752 --RYEGIFHAARTILKEESFKSFFKGGSARVLRSSPQFGFTLAAYEIFQNMF 801

 Score = 69.3 bits (168), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 53/188 (28%), Positives = 80/188 (42%), Gaps = 21/188 (11%)

Query: 40  VSPFERVKILLQVQN----STTAYNQGIVGAVRQVYREEGTPGLFRGNGLNCIRIFPYSA 95
            +P E VKI LQV++             +G ++Q+    G  GL++G     +R  P+SA
Sbjct: 630 TNPLEVVKIRLQVRSEYAGDVLKSQVTALGVIKQL----GIKGLYKGIAACLMRDVPFSA 685

Query: 96  VQFVVYEACKKHFFHVD--GSKGREQLQNWQRLFSGALCGGCSVLATYPLDLVRTRLSIQ 153
           + F  Y   KK  F  D    K R +L+ W+ L +G L G  +   T P D+++TRL I 
Sbjct: 686 IYFPTYAHLKKDVFKYDPKDKKQRNKLKTWELLVAGGLAGMPAAYLTTPFDVIKTRLQID 745

Query: 154 TANLTKLSKSRAHNISKPPGVWDLLCRTYKEEGGIKGLYRGVWPTSLGVVPYVALNFAVY 213
                +  ++R   I           RT  +E   K  ++G     L   P      A Y
Sbjct: 746 ----PRKGETRYEGIFHA-------ARTILKEESFKSFFKGGSARVLRSSPQFGFTLAAY 794

Query: 214 EQFKEFMP 221
           E F+   P
Sbjct: 795 EIFQNMFP 802

 Score = 50.4 bits (119), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 27/81 (33%), Positives = 39/81 (48%), Gaps = 5/81 (6%)

Query: 232 YKLSIGALSGGVAQTVTYPFDLLRRRFQVLAMGGNELGFRYKSVMDALITIGKTEGFRGY 291
           Y  ++G+++G +  TV YP DL++ R Q           +YK+ +D    I   EG RG 
Sbjct: 520 YNFTLGSIAGCIGATVVYPIDLVKTRMQAQRSFS-----QYKNSIDCFAKIFSREGIRGI 574

Query: 292 YKGLTANLFKVIPSTAVSWLV 312
           Y GL   L  V P  A+   V
Sbjct: 575 YSGLGPQLIGVAPEKAIKLTV 595

>Sklu_2334.2 YJR095W, Contig c2334 6303-7262 reverse complement
          Length = 319

 Score = 99.8 bits (247), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 82/284 (28%), Positives = 123/284 (43%), Gaps = 26/284 (9%)

Query: 42  PFERVKILLQVQNSTTAYN---QGIVGAVRQVYREEGTPGLFRGNGLNCIRIFPYSAVQF 98
           P + +K+ +Q+   +        G +   R +Y EEG   L++G G   I I P  A++F
Sbjct: 30  PLDTIKVRMQIYRRSALEGIKPPGFIKTGRNIYTEEGLLALYKGLGAVVIGIIPKMAIRF 89

Query: 99  VVYEACKKHFFHVDGSKGREQLQNWQRLFSGALCGGC-SVLATYPLDLVRTRLSIQTANL 157
             YE  +      D   G     N     +G   G   +VL   P+++V+ RL  Q  + 
Sbjct: 90  SSYEFYRSAL--ADKQTGSVSTGNT--FLAGVGAGTTEAVLVVNPMEVVKIRLQAQHLHP 145

Query: 158 TKLSKSRAHNISKPPGVWDLLCRTYKEEGGIKGLYRGVWPTSLGVVPYVALNFAVYEQFK 217
              +  R  N  +        C    +E GI  LYRGV  T+         NF VY + K
Sbjct: 146 ETAASPRYRNALQA-------CYLIVKEEGIGALYRGVSLTAARQATNQGANFTVYSKLK 198

Query: 218 EFMPEG-TDNTLANFYKLSIGALSGGVAQTVTYPFDLLRRRFQVLAMGGNELGFRYKSVM 276
           EF+ E    + L ++    IG +SG +      P D ++ R Q      N  G+      
Sbjct: 199 EFLQEHHKTDALPSWETSCIGLISGAIGPFSNAPLDTIKTRLQKDKSTANMSGW------ 252

Query: 277 DALITIGK----TEGFRGYYKGLTANLFKVIPSTAVSWLVYEVV 316
             ++TIGK     EGFR  YKG+T  + +V P  AV++ VYE V
Sbjct: 253 SRIVTIGKQLIKEEGFRALYKGITPRVMRVAPGQAVTFTVYEFV 296

 Score = 67.8 bits (164), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 58/187 (31%), Positives = 83/187 (44%), Gaps = 18/187 (9%)

Query: 39  VVSPFERVKILLQVQN--STTAYNQGIVGAVRQVY---REEGTPGLFRGNGLNCIRIFPY 93
           VV+P E VKI LQ Q+    TA +     A++  Y   +EEG   L+RG  L   R    
Sbjct: 127 VVNPMEVVKIRLQAQHLHPETAASPRYRNALQACYLIVKEEGIGALYRGVSLTAARQATN 186

Query: 94  SAVQFVVYEACKKHFFHVDGSKGREQLQNWQRLFSGALCGGCSVLATYPLDLVRTRLSIQ 153
               F VY   K+  F  +  K  + L +W+    G + G     +  PLD ++TRL   
Sbjct: 187 QGANFTVYSKLKE--FLQEHHK-TDALPSWETSCIGLISGAIGPFSNAPLDTIKTRLQKD 243

Query: 154 TANLTKLSKSRAHNISKPPGVWDLLCRTYKEEGGIKGLYRGVWPTSLGVVPYVALNFAVY 213
            +       SR   I K         +  KEEG  + LY+G+ P  + V P  A+ F VY
Sbjct: 244 KSTANMSGWSRIVTIGK---------QLIKEEG-FRALYKGITPRVMRVAPGQAVTFTVY 293

Query: 214 EQFKEFM 220
           E  +E +
Sbjct: 294 EFVREHL 300

>Kwal_27.12081
          Length = 369

 Score = 99.0 bits (245), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 85/315 (26%), Positives = 140/315 (44%), Gaps = 50/315 (15%)

Query: 39  VVSPFERVKILLQVQ------------NSTTAYNQGI------VGAVRQVYREEGTPGLF 80
           V  PF+ VK  LQ               S+   + GI       G +  +Y+ EG   LF
Sbjct: 69  VTCPFDVVKTRLQSDVFQSTYANLSHNKSSNVVSSGIRHFRETFGIISNLYKLEGFRSLF 128

Query: 81  RGNGLNCIRIFPYSAVQFVVYEACKKHFFHVDGSKGREQLQNWQRLFSGALCGGCSVLAT 140
           +G G N + + P  ++ F  Y    K  +    + G E    W  L S A  G  +  AT
Sbjct: 129 KGLGPNLVGVIPARSINFFTY-GTTKQIYSRAFNNGEEA--PWIHLISAATAGWATSTAT 185

Query: 141 YPLDLVRTRLSIQTANLTKLSKSRAHNISKPPGVWDLLCRTYKEEGGIKGLYRGVWPTSL 200
            P+ L++TRL +  A  T+  K+           WD L    ++EG   GLY+G+  + L
Sbjct: 186 NPIWLIKTRLQLDKAGHTRQYKNS----------WDCLKHIIQKEGFF-GLYKGLSASYL 234

Query: 201 GVVPYVALNFAVYEQFKEFM-----------PEGTDNTLANFYKLSIGALSGGVAQ---- 245
           G V  + L + +YEQ K+ +            EG  NT     +    + S G+A+    
Sbjct: 235 GSVEGI-LQWLLYEQMKQMIKMRSIEKFGHISEGEKNTSEKIKEWCQRSGSAGLAKFLAS 293

Query: 246 TVTYPFDLLRRRFQVLAMGGNELGFRYKSVMDALITIGKTEGFRGYYKGLTANLFKVIPS 305
            VTYP +++R R +   +  ++L  +Y  ++ +   I K EG    Y GLT +L + +P+
Sbjct: 294 IVTYPHEVVRTRLRQAPLENDKL--KYTGLIQSFRVIIKEEGLASMYGGLTPHLLRTVPN 351

Query: 306 TAVSWLVYEVVCDLM 320
           + + +  +E+V  L+
Sbjct: 352 SIIMFGTWELVIKLL 366

 Score = 70.9 bits (172), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 54/193 (27%), Positives = 93/193 (48%), Gaps = 13/193 (6%)

Query: 138 LATYPLDLVRTRL--SIQTANLTKLSKSRAHNISKP-----PGVWDLLCRTYKEEGGIKG 190
           + T P D+V+TRL   +  +    LS +++ N+           + ++   YK E G + 
Sbjct: 68  IVTCPFDVVKTRLQSDVFQSTYANLSHNKSSNVVSSGIRHFRETFGIISNLYKLE-GFRS 126

Query: 191 LYRGVWPTSLGVVPYVALNFAVYEQFKEFMPEGTDN-TLANFYKLSIGALSGGVAQTVTY 249
           L++G+ P  +GV+P  ++NF  Y   K+      +N   A +  L   A +G    T T 
Sbjct: 127 LFKGLGPNLVGVIPARSINFFTYGTTKQIYSRAFNNGEEAPWIHLISAATAGWATSTATN 186

Query: 250 PFDLLRRRFQVLAMGGNELGFRYKSVMDALITIGKTEGFRGYYKGLTANLFKVIPSTAVS 309
           P  L++ R Q+   G      +YK+  D L  I + EGF G YKGL+A+    +    + 
Sbjct: 187 PIWLIKTRLQLDKAGHTR---QYKNSWDCLKHIIQKEGFFGLYKGLSASYLGSVEGI-LQ 242

Query: 310 WLVYEVVCDLMHV 322
           WL+YE +  ++ +
Sbjct: 243 WLLYEQMKQMIKM 255

>Scas_716.29
          Length = 316

 Score = 97.4 bits (241), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 84/300 (28%), Positives = 135/300 (45%), Gaps = 34/300 (11%)

Query: 35  VSRTVVSPFERVKILLQVQNSTTAYN-QGIVGAVR-QVYREEGTPGLFRGNGLNCIRIFP 92
           ++RTV++P + +KI LQ++ S T     G++  ++  +  E G    ++GN    +    
Sbjct: 35  LARTVIAPLDTLKIRLQLRPSYTGQAPSGLLKMMKGMILNEGGLRSFWKGNVPGTMMYVL 94

Query: 93  YSAVQFVVYEACKKHFFHVDGSKGREQLQNWQRLFSGALCGGCSVLATYPLDLVRTRLSI 152
           Y   QF  Y      F       G+      Q L  GAL G  S   +YP D++RTR   
Sbjct: 95  YGGAQFSSYSFYNNLFGETSDMNGQ-----LQSLVVGALAGMTSSFVSYPTDVLRTRF-- 147

Query: 153 QTANLTKLSKSRAHNISKPPGVWDLLCRTYKEEGGIKGLYRGVWPTSLGVVPYVALNFAV 212
             AN      S +H   +   +W++         GI G +RG   +   +    ++ F  
Sbjct: 148 -IANQDVALSSLSHGCKE---IWNM--------EGIPGFFRGCTASMFTITLSASILFGT 195

Query: 213 YEQFKEFMPE-GTDNTLANFYKLSIGALSGGVAQTVTYPFDLLRRRFQV---LAMGGN-- 266
           YE  K +  E   ++   N+ + S  ++SG  ++ VTYP D +RRR QV   + +  N  
Sbjct: 196 YESIKIYCDEYSKESDYTNYLRYSASSISGVTSKMVTYPLDTIRRRIQVRNSVYVQHNVE 255

Query: 267 -----ELGFRYK--SVMDALITIGKTEGFRGYYKGLTANLFKVIPSTAVSWLVYEVVCDL 319
                E+   YK  S +   + I + EG    Y+G++ +L K +PST VS   YE V  L
Sbjct: 256 NKIVTEIYQSYKGASFIRMGLNILRQEGLLSLYQGVSMSLCKTVPSTVVSLWAYETVMRL 315

>KLLA0E13453g complement(1184806..1187526) similar to sgd|S0006225
           Saccharomyces cerevisiae YPR021c, start by similarity
          Length = 906

 Score =  100 bits (248), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 77/287 (26%), Positives = 138/287 (48%), Gaps = 27/287 (9%)

Query: 35  VSRTVVSPFERVKILLQVQNSTTAYNQGIVGAVRQVYREEGTPGLFRGNGLNCIRIFPYS 94
           +  TVV P + VK  +Q Q ++  Y   I   V ++++ +G  GL+ G G   I + P  
Sbjct: 517 IGATVVYPIDLVKTRMQAQRNSVQYKNSI-DCVVKIFQTKGIRGLYSGLGPQLIGVAPEK 575

Query: 95  AVQFVVYEACKKHFFHVDGSKGREQLQNWQRLFSGALCGGCSVLATYPLDLVRTRLSIQT 154
           A++  V +  +++F     +K R  ++ +Q + SGA  G C V+ T PL++V+ RL +++
Sbjct: 576 AIKLTVNDFMRQYFM----NKSR-TIKWYQEILSGATAGACQVVFTNPLEIVKIRLQMRS 630

Query: 155 ANLTKLSKSRAHNISKPPGVWDLLCRTYKEEGGIKGLYRGVWPTSLGVVPYVALNFAVYE 214
             + + ++ +   +    G+   L        G++GLY+G     L  VP+ A+ F  Y 
Sbjct: 631 DYVGENARPQLGAV----GIIRQL--------GLRGLYKGAAACLLRDVPFSAIYFPTYA 678

Query: 215 QFKE----FMPEGTD--NTLANFYKLSIGALSGGVAQTVTYPFDLLRRRFQVLAMGGNEL 268
             K+    F P   +  N L  +  L  G ++G  A  +T PFD+++ R Q+    G   
Sbjct: 679 HLKKDVFNFDPNDKNKRNKLKTWELLLAGGIAGMPAAYLTTPFDVIKTRLQIDPRKGETT 738

Query: 269 GFRYKSVMDALITIGKTEGFRGYYKGLTANLFKVIPSTAVSWLVYEV 315
              Y  V+ A  TI K E  + ++KG  A + +  P    +   +E+
Sbjct: 739 ---YTGVIHAARTILKEESIKSFFKGGPARVLRSSPQFGFTLAAFEM 782

 Score = 73.6 bits (179), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 54/193 (27%), Positives = 80/193 (41%), Gaps = 21/193 (10%)

Query: 40  VSPFERVKILLQVQNSTTAYNQ----GIVGAVRQVYREEGTPGLFRGNGLNCIRIFPYSA 95
            +P E VKI LQ+++     N     G VG +RQ+    G  GL++G     +R  P+SA
Sbjct: 616 TNPLEIVKIRLQMRSDYVGENARPQLGAVGIIRQL----GLRGLYKGAAACLLRDVPFSA 671

Query: 96  VQFVVYEACKKHFFHVD--GSKGREQLQNWQRLFSGALCGGCSVLATYPLDLVRTRLSIQ 153
           + F  Y   KK  F+ D      R +L+ W+ L +G + G  +   T P D+++TRL I 
Sbjct: 672 IYFPTYAHLKKDVFNFDPNDKNKRNKLKTWELLLAGGIAGMPAAYLTTPFDVIKTRLQID 731

Query: 154 TANLTKLSKSRAHNISKPPGVWDLLCRTYKEEGGIKGLYRGVWPTSLGVVPYVALNFAVY 213
                       H             RT  +E  IK  ++G     L   P      A +
Sbjct: 732 PRKGETTYTGVIH-----------AARTILKEESIKSFFKGGPARVLRSSPQFGFTLAAF 780

Query: 214 EQFKEFMPEGTDN 226
           E F+   P    N
Sbjct: 781 EMFQGLFPSHFKN 793

 Score = 62.8 bits (151), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 47/185 (25%), Positives = 87/185 (47%), Gaps = 18/185 (9%)

Query: 129 GALCGGCSVLATYPLDLVRTRLSIQTANLTKLSKSRAHNISKPPGVWDLLCRTYKEEGGI 188
           G++ G       YP+DLV+TR+  Q             N  +     D + + ++ + GI
Sbjct: 511 GSIAGCIGATVVYPIDLVKTRMQAQ------------RNSVQYKNSIDCVVKIFQTK-GI 557

Query: 189 KGLYRGVWPTSLGVVPYVALNFAVYEQFKEFMPEGTDNTLANFYKLSIGALSGGVAQTVT 248
           +GLY G+ P  +GV P  A+   V +  +++    +  T+  + ++  GA +G      T
Sbjct: 558 RGLYSGLGPQLIGVAPEKAIKLTVNDFMRQYFMNKS-RTIKWYQEILSGATAGACQVVFT 616

Query: 249 YPFDLLRRRFQVLAMGGNELGFRYKSVMDALITIGKTEGFRGYYKGLTANLFKVIPSTAV 308
            P ++++ R Q   M  + +G   +  + A + I +  G RG YKG  A L + +P +A+
Sbjct: 617 NPLEIVKIRLQ---MRSDYVGENARPQLGA-VGIIRQLGLRGLYKGAAACLLRDVPFSAI 672

Query: 309 SWLVY 313
            +  Y
Sbjct: 673 YFPTY 677

 Score = 52.8 bits (125), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 26/85 (30%), Positives = 45/85 (52%), Gaps = 5/85 (5%)

Query: 232 YKLSIGALSGGVAQTVTYPFDLLRRRFQVLAMGGNELGFRYKSVMDALITIGKTEGFRGY 291
           +  ++G+++G +  TV YP DL++ R     M       +YK+ +D ++ I +T+G RG 
Sbjct: 506 HNFTLGSIAGCIGATVVYPIDLVKTR-----MQAQRNSVQYKNSIDCVVKIFQTKGIRGL 560

Query: 292 YKGLTANLFKVIPSTAVSWLVYEVV 316
           Y GL   L  V P  A+   V + +
Sbjct: 561 YSGLGPQLIGVAPEKAIKLTVNDFM 585

>Kwal_47.17321
          Length = 881

 Score = 99.4 bits (246), Expect = 8e-23,   Method: Compositional matrix adjust.
 Identities = 77/292 (26%), Positives = 134/292 (45%), Gaps = 27/292 (9%)

Query: 35  VSRTVVSPFERVKILLQVQNSTTAYNQGIVGAVRQVYREEGTPGLFRGNGLNCIRIFPYS 94
           +  T V P + VK  +Q Q + + Y   I   V+ ++  EG  G++ G G   + + P  
Sbjct: 513 IGATAVYPIDLVKTRMQAQRNFSQYKNSIDCFVK-IFSREGIRGIYSGLGPQLVGVAPEK 571

Query: 95  AVQFVVYEACKKHFFHVDGSKGREQLQNWQRLFSGALCGGCSVLATYPLDLVRTRLSIQT 154
           A++  V +  +K     +      +L     + SGA  G C V+ T PL++V+ RL +++
Sbjct: 572 AIKLTVNDYVRKLLMDENN-----RLTLPLEIISGAAAGACQVIFTNPLEIVKIRLQVRS 626

Query: 155 ANLTKLSKSRAHNISKPPGVWDLLCRTYKEEGGIKGLYRGVWPTSLGVVPYVALNFAVYE 214
                L KS+   +    GV   L        G++GLY+G+    +  VP+ A+ F  Y 
Sbjct: 627 EYADSLPKSQLTAL----GVVKSL--------GLRGLYKGLVACLMRDVPFSAIYFPTYA 674

Query: 215 QFK----EFMPEGTDN--TLANFYKLSIGALSGGVAQTVTYPFDLLRRRFQVLAMGGNEL 268
             K     + P+  +    L  +  L+ G L+G  A  +T PFD+++ R Q+    G   
Sbjct: 675 HLKRDIFNYDPQDKNKRARLHTWELLTAGGLAGMPAAYLTTPFDVIKTRLQIDPRKGET- 733

Query: 269 GFRYKSVMDALITIGKTEGFRGYYKGLTANLFKVIPSTAVSWLVYEVVCDLM 320
             RY  ++ A  TI K E F+ ++KG  A + +  P    +   YE+  ++ 
Sbjct: 734 --RYTGILHAARTILKEERFKSFFKGGGARVLRSSPQFGFTLAAYEIFQNMF 783

 Score = 62.4 bits (150), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 52/188 (27%), Positives = 79/188 (42%), Gaps = 21/188 (11%)

Query: 40  VSPFERVKILLQVQ----NSTTAYNQGIVGAVRQVYREEGTPGLFRGNGLNCIRIFPYSA 95
            +P E VKI LQV+    +S        +G V+ +    G  GL++G     +R  P+SA
Sbjct: 612 TNPLEIVKIRLQVRSEYADSLPKSQLTALGVVKSL----GLRGLYKGLVACLMRDVPFSA 667

Query: 96  VQFVVYEACKKHFFHVD--GSKGREQLQNWQRLFSGALCGGCSVLATYPLDLVRTRLSIQ 153
           + F  Y   K+  F+ D      R +L  W+ L +G L G  +   T P D+++TRL I 
Sbjct: 668 IYFPTYAHLKRDIFNYDPQDKNKRARLHTWELLTAGGLAGMPAAYLTTPFDVIKTRLQID 727

Query: 154 TANLTKLSKSRAHNISKPPGVWDLLCRTYKEEGGIKGLYRGVWPTSLGVVPYVALNFAVY 213
                +  ++R   I           RT  +E   K  ++G     L   P      A Y
Sbjct: 728 P----RKGETRYTGILHA-------ARTILKEERFKSFFKGGGARVLRSSPQFGFTLAAY 776

Query: 214 EQFKEFMP 221
           E F+   P
Sbjct: 777 EIFQNMFP 784

 Score = 50.1 bits (118), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 29/90 (32%), Positives = 44/90 (48%), Gaps = 7/90 (7%)

Query: 232 YKLSIGALSGGVAQTVTYPFDLLRRRFQVLAMGGNELGF-RYKSVMDALITIGKTEGFRG 290
           Y   +G+++G +  T  YP DL++ R Q       +  F +YK+ +D  + I   EG RG
Sbjct: 502 YNFLLGSVAGCIGATAVYPIDLVKTRMQA------QRNFSQYKNSIDCFVKIFSREGIRG 555

Query: 291 YYKGLTANLFKVIPSTAVSWLVYEVVCDLM 320
            Y GL   L  V P  A+   V + V  L+
Sbjct: 556 IYSGLGPQLVGVAPEKAIKLTVNDYVRKLL 585

 Score = 37.4 bits (85), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 24/84 (28%), Positives = 39/84 (46%), Gaps = 5/84 (5%)

Query: 39  VVSPFERVKILLQV--QNSTTAYNQGIVGAVRQVYREEGTPGLFRGNGLNCIRIFPYSAV 96
           + +PF+ +K  LQ+  +   T Y  GI+ A R + +EE     F+G G   +R  P    
Sbjct: 713 LTTPFDVIKTRLQIDPRKGETRYT-GILHAARTILKEERFKSFFKGGGARVLRSSPQFGF 771

Query: 97  QFVVYEACKKHF--FHVDGSKGRE 118
               YE  +  F   H + ++ RE
Sbjct: 772 TLAAYEIFQNMFPLQHSENNESRE 795

>Kwal_33.14050
          Length = 314

 Score = 96.7 bits (239), Expect = 9e-23,   Method: Compositional matrix adjust.
 Identities = 73/291 (25%), Positives = 125/291 (42%), Gaps = 33/291 (11%)

Query: 35  VSRTVVSPFERVKILLQV-------QNSTTAYNQGIVGAVRQVYREEGTPGLFRGNGLNC 87
           +  +++ P + +K  +Q         N+       IV  + ++   EG+  L++G     
Sbjct: 29  MEHSIMFPIDAIKTRMQALSATIGSANAAAKLPSNIVQQIARISTTEGSMALWKGVQSVI 88

Query: 88  IRIFPYSAVQFVVYEACKKHFFHVDGSKGREQLQNWQRLFSGALCGGCSVLATYPLDLVR 147
           +   P  AV F  YE CK +       +  + L+      SG      + L   P D ++
Sbjct: 89  LGAGPAHAVYFATYEMCKSYLIDPQDFQTHQPLKT---AASGIAATVAADLLMNPFDTIK 145

Query: 148 TRLSIQTANLTKLSKSRAHNISKPPGVWDLLCRTYKEEGGIKGLYRGVWPTSLGV-VPYV 206
            R+ ++T      SK R         +W +  R Y+ EG     Y   +PT++ + +P+ 
Sbjct: 146 QRMQLRT-----FSKDR---------MWSVASRIYRNEGLAAFFYS--YPTTIAMNIPFA 189

Query: 207 ALNFAVYEQFKEFM-PEGTDNTLANFYKLSIGALSGGVAQTVTYPFDLLRRRFQVLAMGG 265
           A NFA+YE   +F  PE T N L +      G +SG     +T P D ++   QV     
Sbjct: 190 AFNFAIYESATKFFNPENTYNPLIHCL---CGGISGATCAAITTPLDCIKTVLQVRGSES 246

Query: 266 --NELGFRYKSVMDALITIGKTEGFRGYYKGLTANLFKVIPSTAVSWLVYE 314
             + L  +  +   A   I K  G+ G+++GL   +   +P+TA+SW  YE
Sbjct: 247 VVDPLFRQADTFSRAASAISKVYGWSGFWRGLKPRIISNMPATAISWTAYE 297

 Score = 53.5 bits (127), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 47/193 (24%), Positives = 83/193 (43%), Gaps = 15/193 (7%)

Query: 124 QRLFSGALCGGCSVLATYPLDLVRTRLSIQTANLTKLSKSRAHNISK-PPGVWDLLCRTY 182
            +L +GA  G       +P+D ++TR+   +A +       A+  +K P  +   + R  
Sbjct: 18  HQLAAGAFAGIMEHSIMFPIDAIKTRMQALSATI-----GSANAAAKLPSNIVQQIARIS 72

Query: 183 KEEGGIKGLYRGVWPTSLGVVPYVALNFAVYEQFKEFMPEGTDNTLANFYKLSIGALSGG 242
             EG +  L++GV    LG  P  A+ FA YE  K ++ +  D       K +   ++  
Sbjct: 73  TTEGSM-ALWKGVQSVILGAGPAHAVYFATYEMCKSYLIDPQDFQTHQPLKTAASGIAAT 131

Query: 243 VAQTVTY-PFDLLRRRFQVLAMGGNELGFRYKSVMDALITIGKTEGFRGYYKGLTANLFK 301
           VA  +   PFD +++R Q+     +    R  SV      I + EG   ++      +  
Sbjct: 132 VAADLLMNPFDTIKQRMQLRTFSKD----RMWSVAS---RIYRNEGLAAFFYSYPTTIAM 184

Query: 302 VIPSTAVSWLVYE 314
            IP  A ++ +YE
Sbjct: 185 NIPFAAFNFAIYE 197

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 21/87 (24%), Positives = 43/87 (49%), Gaps = 3/87 (3%)

Query: 232 YKLSIGALSGGVAQTVTYPFDLLRRRFQVLAM---GGNELGFRYKSVMDALITIGKTEGF 288
           ++L+ GA +G +  ++ +P D ++ R Q L+      N       +++  +  I  TEG 
Sbjct: 18  HQLAAGAFAGIMEHSIMFPIDAIKTRMQALSATIGSANAAAKLPSNIVQQIARISTTEGS 77

Query: 289 RGYYKGLTANLFKVIPSTAVSWLVYEV 315
              +KG+ + +    P+ AV +  YE+
Sbjct: 78  MALWKGVQSVILGAGPAHAVYFATYEM 104

 Score = 30.8 bits (68), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 21/78 (26%), Positives = 35/78 (44%), Gaps = 13/78 (16%)

Query: 39  VVSPFERVKILLQVQNSTTAYN---------QGIVGAVRQVYREEGTPGLFRGNGLNCIR 89
           + +P + +K +LQV+ S +  +              A+ +VY   G  G +RG     I 
Sbjct: 228 ITTPLDCIKTVLQVRGSESVVDPLFRQADTFSRAASAISKVY---GWSGFWRGLKPRIIS 284

Query: 90  IFPYSAVQFVVYEACKKH 107
             P +A+ +  YE C KH
Sbjct: 285 NMPATAISWTAYE-CAKH 301

>Scas_709.9
          Length = 365

 Score = 97.1 bits (240), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 80/294 (27%), Positives = 140/294 (47%), Gaps = 35/294 (11%)

Query: 35  VSRTVVSPFERVKILLQ---VQNSTTAYNQGIVGAVRQVYREEGTPGLFRGNGLNCIRIF 91
           +S  +V P +  K  LQ   +Q+    Y +G++G +  +  +EG  GL++G     +  F
Sbjct: 77  LSGIIVCPLDVTKTRLQAQGIQSIENPYYRGVLGTMSTIVVDEGVRGLYKGLIPIILGYF 136

Query: 92  PYSAVQFVVYEACKKHFFHVDGSKGREQLQNWQRLF---SGALCGGCSVLATYPLDLVRT 148
           P   + F VYE  K  +  V        L N   +    S    G  S + T P+ +V+T
Sbjct: 137 PTWMIYFSVYEFAKDLYPRV--------LPNSDFISHSCSAITAGAASTVLTNPIWVVKT 188

Query: 149 RLSIQTANLTKLSKSRAHNISKPPGVWDLLCRTYKEEGGIKGLYRGVWPTSLGVVPYVAL 208
           RL +QT     L +SR H      G  D   +   +E G++ LY G+ P+  G++ +VA+
Sbjct: 189 RLMLQTP----LGESRTHY----RGTIDAFKKIITQE-GVRTLYTGLVPSMFGLL-HVAI 238

Query: 209 NFAVYEQFKEFMP----EGTDNTLANFYKLS----IGALSGGVAQTVTYPFDLLRRRFQV 260
           +F VYE+ K  +      G  N+  +   L+      + S  +A  +TYP ++LR R Q 
Sbjct: 239 HFPVYEKLKNRLHCDTITGGHNSQEHSLHLTRLIIASSASKMLASILTYPHEILRTRMQ- 297

Query: 261 LAMGGNELGFRYKSVMDALITIGKTEGFRGYYKGLTANLFKVIPSTAVSWLVYE 314
             +  ++L      ++D +    + EG  G+Y G   NL + +P++A++ + +E
Sbjct: 298 --LKSDKLLISKHKLLDLIKRTYRYEGLLGFYSGFATNLLRTVPASAITLVSFE 349

 Score = 74.7 bits (182), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 62/198 (31%), Positives = 94/198 (47%), Gaps = 18/198 (9%)

Query: 127 FSGALCGGCSVLATYPLDLVRTRLSIQTANLTKLSKSRAHNISKP--PGVWDLLCRTYKE 184
            SGAL G  S +   PLD+ +TRL  Q             +I  P   GV   +     +
Sbjct: 69  LSGALAGFLSGIIVCPLDVTKTRLQAQGIQ----------SIENPYYRGVLGTMSTIVVD 118

Query: 185 EGGIKGLYRGVWPTSLGVVPYVALNFAVYEQFKEFMPEGTDNTLANFYKLSIGALSGGVA 244
           EG ++GLY+G+ P  LG  P   + F+VYE  K+  P    N  ++F   S  A++ G A
Sbjct: 119 EG-VRGLYKGLIPIILGYFPTWMIYFSVYEFAKDLYPRVLPN--SDFISHSCSAITAGAA 175

Query: 245 QTV-TYPFDLLRRRFQVLAMGGNELGFRYKSVMDALITIGKTEGFRGYYKGLTANLFKVI 303
            TV T P  +++ R  +    G E    Y+  +DA   I   EG R  Y GL  ++F ++
Sbjct: 176 STVLTNPIWVVKTRLMLQTPLG-ESRTHYRGTIDAFKKIITQEGVRTLYTGLVPSMFGLL 234

Query: 304 PSTAVSWLVYEVVCDLMH 321
              A+ + VYE + + +H
Sbjct: 235 -HVAIHFPVYEKLKNRLH 251

 Score = 55.5 bits (132), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 52/191 (27%), Positives = 88/191 (46%), Gaps = 23/191 (12%)

Query: 36  SRTVVSPFERVKILLQVQN----STTAYNQGIVGAVRQVYREEGTPGLFRGNGLNCIRIF 91
           S  + +P   VK  L +Q     S T Y +G + A +++  +EG   L+ G   +   + 
Sbjct: 176 STVLTNPIWVVKTRLMLQTPLGESRTHY-RGTIDAFKKIITQEGVRTLYTGLVPSMFGLL 234

Query: 92  PYSAVQFVVYEACKKHFFHVD----GSKGREQLQNWQRLF-SGALCGGCSVLATYPLDLV 146
            + A+ F VYE  K    H D    G   +E   +  RL  + +     + + TYP +++
Sbjct: 235 -HVAIHFPVYEKLKNRL-HCDTITGGHNSQEHSLHLTRLIIASSASKMLASILTYPHEIL 292

Query: 147 RTRLSIQTANLTKLSKSRAHNISKPPGVWDLLCRTYKEEGGIKGLYRGVWPTSLGVVPYV 206
           RTR+ +++  L  +SK +         + DL+ RTY+ EG + G Y G     L  VP  
Sbjct: 293 RTRMQLKSDKLL-ISKHK---------LLDLIKRTYRYEG-LLGFYSGFATNLLRTVPAS 341

Query: 207 ALNFAVYEQFK 217
           A+    +E F+
Sbjct: 342 AITLVSFEYFR 352

>CAGL0K02365g 212702..215461 highly similar to tr|Q12482
           Saccharomyces cerevisiae YPR021c, start by similarity
          Length = 919

 Score = 99.0 bits (245), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 77/292 (26%), Positives = 130/292 (44%), Gaps = 26/292 (8%)

Query: 35  VSRTVVSPFERVKILLQVQNSTTAYNQGIVGAVRQVYREEGTPGLFRGNGLNCIRIFPYS 94
           +  T+V P + VK  +Q Q S + Y   I   ++ + RE G  G++ G G   I + P  
Sbjct: 556 IGATIVYPIDFVKTRMQAQRSLSQYKNSIDCFLKILSRE-GIRGVYSGLGPQLIGVAPEK 614

Query: 95  AVQFVVYEACKKHFFHVDGSKGREQLQNWQRLFSGALCGGCSVLATYPLDLVRTRLSIQT 154
           A++  V +  +      +G  G         + SGA  G C V+ T PL++V+ RL +  
Sbjct: 615 AIKLTVNDYMRNKLKDKNGKLGL-----LSEIISGASAGACQVIFTNPLEIVKIRLQV-- 667

Query: 155 ANLTKLSKSRAHNISKPPGVWDLLCRTYKEEGGIKGLYRGVWPTSLGVVPYVALNFAVYE 214
                    +   +++      L      +  G+ GLY+G     L  VP+ A+ F  Y 
Sbjct: 668 ---------KGEYVAENAENAKLTALQIIKRLGLPGLYKGAAACLLRDVPFSAIYFPTYA 718

Query: 215 QFK----EFMPEGTD--NTLANFYKLSIGALSGGVAQTVTYPFDLLRRRFQVLAMGGNEL 268
             K     F P   +  + L  +  LS GAL+G  A  +T PFD+++ R Q+    G  +
Sbjct: 719 HLKRDLFNFDPNDKNKRSRLNTWELLSAGALAGMPAAYLTTPFDVIKTRLQIDPKKGETI 778

Query: 269 GFRYKSVMDALITIGKTEGFRGYYKGLTANLFKVIPSTAVSWLVYEVVCDLM 320
              YK ++ A  TI + E F+ ++KG  A + +  P    +   YE+  ++ 
Sbjct: 779 ---YKGIIHAARTILREESFKSFFKGGAARVLRSSPQFGFTLAAYELFHNIF 827

 Score = 79.0 bits (193), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 55/189 (29%), Positives = 77/189 (40%), Gaps = 14/189 (7%)

Query: 40  VSPFERVKILLQVQNSTTAYN-QGIVGAVRQVYREEGTPGLFRGNGLNCIRIFPYSAVQF 98
            +P E VKI LQV+    A N +       Q+ +  G PGL++G     +R  P+SA+ F
Sbjct: 655 TNPLEIVKIRLQVKGEYVAENAENAKLTALQIIKRLGLPGLYKGAAACLLRDVPFSAIYF 714

Query: 99  VVYEACKKHFFHVD--GSKGREQLQNWQRLFSGALCGGCSVLATYPLDLVRTRLSIQTAN 156
             Y   K+  F+ D      R +L  W+ L +GAL G  +   T P D+++TRL I    
Sbjct: 715 PTYAHLKRDLFNFDPNDKNKRSRLNTWELLSAGALAGMPAAYLTTPFDVIKTRLQIDPKK 774

Query: 157 LTKLSKSRAHNISKPPGVWDLLCRTYKEEGGIKGLYRGVWPTSLGVVPYVALNFAVYEQF 216
              + K   H             RT   E   K  ++G     L   P      A YE F
Sbjct: 775 GETIYKGIIH-----------AARTILREESFKSFFKGGAARVLRSSPQFGFTLAAYELF 823

Query: 217 KEFMPEGTD 225
               P   D
Sbjct: 824 HNIFPLPND 832

 Score = 49.7 bits (117), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 26/81 (32%), Positives = 39/81 (48%), Gaps = 5/81 (6%)

Query: 232 YKLSIGALSGGVAQTVTYPFDLLRRRFQVLAMGGNELGFRYKSVMDALITIGKTEGFRGY 291
           Y  S+G+++G +  T+ YP D ++ R Q           +YK+ +D  + I   EG RG 
Sbjct: 545 YNFSLGSVAGCIGATIVYPIDFVKTRMQAQRSLS-----QYKNSIDCFLKILSREGIRGV 599

Query: 292 YKGLTANLFKVIPSTAVSWLV 312
           Y GL   L  V P  A+   V
Sbjct: 600 YSGLGPQLIGVAPEKAIKLTV 620

>YJR095W (SFC1) [2987] chr10 (609690..610658) Mitochondrial membrane
           succinate-fumarate transporter, member of the
           mitochondrial carrier family (MCF) of membrane
           transporters [969 bp, 322 aa]
          Length = 322

 Score = 96.3 bits (238), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 80/286 (27%), Positives = 123/286 (43%), Gaps = 26/286 (9%)

Query: 42  PFERVKILLQVQNSTTAYNQ----GIVGAVRQVYREEGTPGLFRGNGLNCIRIFPYSAVQ 97
           P + +K+ +Q+             G +   R +Y++EG   L++G G   I I P  A++
Sbjct: 30  PLDTIKVRMQIYRRVAGIEHVKPPGFIKTGRTIYQKEGFLALYKGLGAVVIGIIPKMAIR 89

Query: 98  FVVYEACKKHFFHVDGSKGREQLQNWQRLFSGALCGGCS--VLATYPLDLVRTRLSIQTA 155
           F  YE     F+          + +    F   +  G +  VL   P+++V+ RL  Q  
Sbjct: 90  FSSYE-----FYRTLLVNKESGIVSTGNTFVAGVGAGITEAVLVVNPMEVVKIRLQAQ-- 142

Query: 156 NLTKLSKSRAHNISKPPGVWDLLCRTYKEEGGIKGLYRGVWPTSLGVVPYVALNFAVYEQ 215
               L+ S  +   K            KEEG +  LYRGV  T+         NF VY +
Sbjct: 143 ---HLTPSEPNAGPKYNNAIHAAYTIVKEEG-VSALYRGVSLTAARQATNQGANFTVYSK 198

Query: 216 FKEFMPEGTD-NTLANFYKLSIGALSGGVAQTVTYPFDLLRRRFQVLAMGGNELGFRYKS 274
            KEF+      + L ++    IG +SG +      P D ++ R Q        +    +S
Sbjct: 199 LKEFLQNYHQMDVLPSWETSCIGLISGAIGPFSNAPLDTIKTRLQ----KDKSISLEKQS 254

Query: 275 VMDALITIG----KTEGFRGYYKGLTANLFKVIPSTAVSWLVYEVV 316
            M  +ITIG    K EGFR  YKG+T  + +V P  AV++ VYE V
Sbjct: 255 GMKKIITIGAQLLKEEGFRALYKGITPRVMRVAPGQAVTFTVYEYV 300

 Score = 73.6 bits (179), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 57/195 (29%), Positives = 87/195 (44%), Gaps = 31/195 (15%)

Query: 39  VVSPFERVKILLQVQ-------NSTTAYNQGIVGAVRQVYREEGTPGLFRGNGLNCIRIF 91
           VV+P E VKI LQ Q       N+   YN  I  A   + +EEG   L+RG  L   R  
Sbjct: 128 VVNPMEVVKIRLQAQHLTPSEPNAGPKYNNAI-HAAYTIVKEEGVSALYRGVSLTAARQA 186

Query: 92  PYSAVQFVVYEACK---KHFFHVDGSKGREQLQNWQRLFSGALCGGCSVLATYPLDLVRT 148
                 F VY   K   +++  +D       L +W+    G + G     +  PLD ++T
Sbjct: 187 TNQGANFTVYSKLKEFLQNYHQMD------VLPSWETSCIGLISGAIGPFSNAPLDTIKT 240

Query: 149 RLSIQTANLTKLSKSRAHNISKPPGVWDLL---CRTYKEEGGIKGLYRGVWPTSLGVVPY 205
           RL           K ++ ++ K  G+  ++    +  KEEG  + LY+G+ P  + V P 
Sbjct: 241 RLQ----------KDKSISLEKQSGMKKIITIGAQLLKEEG-FRALYKGITPRVMRVAPG 289

Query: 206 VALNFAVYEQFKEFM 220
            A+ F VYE  +E +
Sbjct: 290 QAVTFTVYEYVREHL 304

>CAGL0M09020g complement(896312..897358) highly similar to sp|P33303
           Saccharomyces cerevisiae YJR095w succinate-fumarate
           transporter, start by similarity
          Length = 348

 Score = 95.9 bits (237), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 79/264 (29%), Positives = 121/264 (45%), Gaps = 26/264 (9%)

Query: 62  GIVGAVRQVYREEGTPGLFRGNGLNCIRIFPYSAVQFVVYEACKKHFFHVDGSKGREQLQ 121
           G +   R +Y +EG   L++G G   I I P  A++F  YE     F+    +  +  + 
Sbjct: 81  GFIRTGRNIYAQEGFLALYKGLGAVVIGIIPKMAIRFSSYE-----FYRTLLADKQTGVV 135

Query: 122 NWQRLFSGALCGGCS--VLATYPLDLVRTRLSIQTANLTKLSKSRAHNISKPPGVWDLLC 179
           +    F   +  G +  VL   P+++V+ RL  Q  N         H+++KP     +  
Sbjct: 136 STSNTFIAGVGAGVTEAVLVVNPMEVVKIRLQAQHLNPN-------HDLAKPKYTNAVQA 188

Query: 180 -RTYKEEGGIKGLYRGVWPTSLGVVPYVALNFAVYEQFKEFMPE--GTDNTLANFYKLSI 236
             T  +E GI  LYRGV  T+         NF VY + +EF+ E  GT+ TL ++    I
Sbjct: 189 GYTIIKEEGISALYRGVSLTAARQATNQGANFTVYSKLREFLQEYHGTE-TLPSWETSCI 247

Query: 237 GALSGGVAQTVTYPFDLLRRRFQVLAMGGNELGFRYKSVMDALITIG----KTEGFRGYY 292
           G +SG +      P D ++ R Q          F+ +S    +  IG    K EGFR  Y
Sbjct: 248 GLISGAIGPFSNAPLDTIKTRLQ----KDKSTSFKGESGWKRIAHIGTQLLKEEGFRALY 303

Query: 293 KGLTANLFKVIPSTAVSWLVYEVV 316
           KG+T  + +V P  AV++ VYE V
Sbjct: 304 KGITPRVMRVAPGQAVTFTVYEFV 327

 Score = 66.2 bits (160), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 52/185 (28%), Positives = 79/185 (42%), Gaps = 23/185 (12%)

Query: 39  VVSPFERVKILLQVQNSTTAYN------QGIVGAVRQVYREEGTPGLFRGNGLNCIRIFP 92
           VV+P E VKI LQ Q+    ++         V A   + +EEG   L+RG  L   R   
Sbjct: 155 VVNPMEVVKIRLQAQHLNPNHDLAKPKYTNAVQAGYTIIKEEGISALYRGVSLTAARQAT 214

Query: 93  YSAVQFVVYEACKKHFFHVDGSKGREQLQNWQRLFSGALCGGCSVLATYPLDLVRTRLSI 152
                F VY   ++      G+   E L +W+    G + G     +  PLD ++TR   
Sbjct: 215 NQGANFTVYSKLREFLQEYHGT---ETLPSWETSCIGLISGAIGPFSNAPLDTIKTR--- 268

Query: 153 QTANLTKLSKSRAHNISKPPG---VWDLLCRTYKEEGGIKGLYRGVWPTSLGVVPYVALN 209
                  L K ++ +     G   +  +  +  KEE G + LY+G+ P  + V P  A+ 
Sbjct: 269 -------LQKDKSTSFKGESGWKRIAHIGTQLLKEE-GFRALYKGITPRVMRVAPGQAVT 320

Query: 210 FAVYE 214
           F VYE
Sbjct: 321 FTVYE 325

 Score = 38.1 bits (87), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 35/72 (48%), Gaps = 4/72 (5%)

Query: 41  SPFERVKILLQVQNSTTAYNQG----IVGAVRQVYREEGTPGLFRGNGLNCIRIFPYSAV 96
           +P + +K  LQ   ST+   +     I     Q+ +EEG   L++G     +R+ P  AV
Sbjct: 260 APLDTIKTRLQKDKSTSFKGESGWKRIAHIGTQLLKEEGFRALYKGITPRVMRVAPGQAV 319

Query: 97  QFVVYEACKKHF 108
            F VYE  ++H 
Sbjct: 320 TFTVYEFVRRHL 331

>AEL253W [2253] [Homologous to ScYBR192W (RIM2) - SH]
           complement(164665..165762) [1098 bp, 365 aa]
          Length = 365

 Score = 94.7 bits (234), Expect = 9e-22,   Method: Compositional matrix adjust.
 Identities = 90/313 (28%), Positives = 138/313 (44%), Gaps = 51/313 (16%)

Query: 42  PFERVKILLQVQNSTTAYN-----------QGI------VGAVRQVYREEGTPGLFRGNG 84
           PF+ VK  LQ      AY            QG+      VG ++ VY +EG   LF+G G
Sbjct: 69  PFDVVKTRLQSDVFHGAYKTQATARTNVVYQGLMHFRETVGIIQNVYTQEGFRSLFKGLG 128

Query: 85  LNCIRIFPYSAVQFVVYEACKKHFFHV--DGSKGREQLQNWQRLFSGALCGGCSVLATYP 142
            N + + P  ++ F  Y   K     +  DG     Q   W    +GA  G  +  AT P
Sbjct: 129 PNLVGVIPARSINFFTYGVTKDTASRLLNDG-----QEAPWIHFLAGATAGWATSTATNP 183

Query: 143 LDLVRTRLSIQTANLTKLSKSRAHNISKPPGVWDLLCRTYKEEGGIKGLYRGVWPTSLGV 202
           + LV+TRL +  A      +SR +  S     WD L    + E GI GLY+G+  + LG 
Sbjct: 184 IWLVKTRLQLDKA---ADGRSRRYKNS-----WDCLKGVMRNE-GILGLYKGLSASYLGS 234

Query: 203 VPYVALNFAVYEQFK---------EF--MPEGTDNTLANFYKLSIGALSGGVAQ----TV 247
           V  + L + +YEQ K         EF  + E    T     +    + S G A+     +
Sbjct: 235 VESI-LQWVLYEQMKHIIRQRSIEEFGDISEENKTTYMKVKEWCQRSGSAGAAKLFASIL 293

Query: 248 TYPFDLLRRRFQVLAMGGNELGFRYKSVMDALITIGKTEGFRGYYKGLTANLFKVIPSTA 307
           TYP +++R R +       +L  +Y  +  +   I K EGF   Y GLT +L + +P++ 
Sbjct: 294 TYPHEVVRTRLRQAPKENGKL--KYTGLFQSFSLIIKEEGFASMYSGLTPHLMRTVPNSI 351

Query: 308 VSWLVYEVVCDLM 320
           + +  +E+V  L+
Sbjct: 352 IMFGTWELVIKLL 364

 Score = 62.4 bits (150), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 51/182 (28%), Positives = 84/182 (46%), Gaps = 10/182 (5%)

Query: 140 TYPLDLVRTRLSIQTANLTKLSKSRAHNISKPPGVWD------LLCRTYKEEGGIKGLYR 193
           T P D+V+TRL     +    +++ A       G+        ++   Y +E G + L++
Sbjct: 67  TCPFDVVKTRLQSDVFHGAYKTQATARTNVVYQGLMHFRETVGIIQNVYTQE-GFRSLFK 125

Query: 194 GVWPTSLGVVPYVALNFAVYEQFKEFMPE-GTDNTLANFYKLSIGALSGGVAQTVTYPFD 252
           G+ P  +GV+P  ++NF  Y   K+       D   A +     GA +G    T T P  
Sbjct: 126 GLGPNLVGVIPARSINFFTYGVTKDTASRLLNDGQEAPWIHFLAGATAGWATSTATNPIW 185

Query: 253 LLRRRFQVLAMGGNELGFRYKSVMDALITIGKTEGFRGYYKGLTANLFKVIPSTAVSWLV 312
           L++ R Q L    +    RYK+  D L  + + EG  G YKGL+A+    + S  + W++
Sbjct: 186 LVKTRLQ-LDKAADGRSRRYKNSWDCLKGVMRNEGILGLYKGLSASYLGSVESI-LQWVL 243

Query: 313 YE 314
           YE
Sbjct: 244 YE 245

>KLLA0D14036g complement(1203522..1204817) some similarities with
           sp|P40556 Saccharomyces cerevisiae YIL006w, hypothetical
           start
          Length = 431

 Score = 95.1 bits (235), Expect = 9e-22,   Method: Compositional matrix adjust.
 Identities = 85/342 (24%), Positives = 146/342 (42%), Gaps = 59/342 (17%)

Query: 20  NDSNVAFXXXXXXXXVSRTVVSPFERVKILLQVQN--------------STT---AYNQG 62
           ND+ +          ++  +V P +  K  LQ Q               +TT    Y  G
Sbjct: 101 NDTEITALSGALAGFLAGVIVCPLDVAKTRLQAQGLQLNGPVTRPVGSVATTFGGKYYSG 160

Query: 63  IVGAVRQVYREEGTPGLFRGNGLNCIRIFPYSAVQFVVYEACKKHFFHVDGSKGREQLQN 122
           I G +  + R+E   GL++G     +  FP   + F VYE CK  +      +     + 
Sbjct: 161 IWGTLTTIVRDESIRGLYKGIVPIVLGYFPTWMIYFSVYERCKLSY-----PRYFNNSEF 215

Query: 123 WQRLFSGALCGGCSVLATYPLDLVRTRLSIQTANLTKLSKSRAHNISKPPGVWDLLCRTY 182
                S    G  S   T P+ +V+TRL +Q+    K        ++      D   + Y
Sbjct: 216 LSHSMSALTAGAISTTLTNPIWVVKTRLMLQSGKNIK-------GMTHYKNTLDAFIKIY 268

Query: 183 KEEGGIKGLYRGVWPTSLGVVPYVALNFAVYEQFKEFM--------------------PE 222
           K EG IK  Y G+ P+  G++ +VA++F VYE+ K+ +                    P+
Sbjct: 269 KVEG-IKSFYSGLIPSLFGLL-HVAIHFPVYEKLKKVLHCYPSGRPNQETMNVNGNSNPQ 326

Query: 223 GTDNTLANFYKLSIGAL-SGGVAQTVTYPFDLLRRRFQVLAMGGNELGFRYKSVMDALIT 281
            T +T     +L + +  S  +A T+TYP ++LR R Q+ +    ++    KS++    T
Sbjct: 327 TTGSTNFQLGRLIVASCGSKMIASTLTYPHEILRTRLQLKS----DMKPSIKSIIR---T 379

Query: 282 IGKTEGFRGYYKGLTANLFKVIPSTAVSWLVYEVVCDLMHVW 323
               EG RG+Y G   N+F+ +P++A++ + +E       +W
Sbjct: 380 TYAKEGIRGFYSGFLTNMFRTVPASAITLVSFEYFRKHFKLW 421

>YJL133W (MRS3) [2785] chr10 (160537..161481) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters, overexpression suppresses mitochondrial
           splicing defects [945 bp, 314 aa]
          Length = 314

 Score = 93.2 bits (230), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 70/288 (24%), Positives = 125/288 (43%), Gaps = 36/288 (12%)

Query: 35  VSRTVVSPFERVKILLQVQNSTTAYNQGIVGAVRQVYREEGTPGLFRGNGLNCIRIFPYS 94
           +  +V+ P + +K  +Q  N+ +   + ++  +  +   EGT  L++G     +   P  
Sbjct: 46  MEHSVMFPIDALKTRIQSANAKSLSAKNMLSQISHISTSEGTLALWKGVQSVILGAGPAH 105

Query: 95  AVQFVVYEACKKHFFHVDGSKGREQLQNWQRLFSGALCGGCSVLAT----YPLDLVRTRL 150
           AV F  YE CKK+   +D S  +         F  A+ G C+  A+     P D ++ R+
Sbjct: 106 AVYFGTYEFCKKNL--IDSSDTQT-----HHPFKTAISGACATTASDALMNPFDTIKQRI 158

Query: 151 SIQTANLTKLSKSRAHNISKPPGVWDLLCRTYKEEGGIKGLYRGVWPTSLGV-VPYVALN 209
            + T+                  VW    + Y+ EG     Y   +PT+L + +P+ A N
Sbjct: 159 QLNTS----------------ASVWQTTKQIYQSEGLAAFYYS--YPTTLVMNIPFAAFN 200

Query: 210 FAVYEQFKEFM-PEGTDNTLANFYKLSIGALSGGVAQTVTYPFDLLRRRFQVLAMGGNEL 268
           F +YE   +F+ P    N L +      G++SG     +T P D ++   Q+       L
Sbjct: 201 FVIYESSTKFLNPSNEYNPLIHCL---CGSISGSTCAAITTPLDCIKTVLQIRGSQTVSL 257

Query: 269 GFRYK--SVMDALITIGKTEGFRGYYKGLTANLFKVIPSTAVSWLVYE 314
               K  +   A   I +  G++G+++G    +   +P+TA+SW  YE
Sbjct: 258 EIMRKADTFSKAASAIYQVYGWKGFWRGWKPRIVANMPATAISWTAYE 305

 Score = 59.7 bits (143), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 51/194 (26%), Positives = 84/194 (43%), Gaps = 24/194 (12%)

Query: 123 WQRLFSGALCGGCSVLATYPLDLVRTRLSIQTANLTKLS-KSRAHNISKPPGVWDLLCRT 181
           + +L +GA  G       +P+D ++TR  IQ+AN   LS K+    IS            
Sbjct: 34  YHQLIAGAFAGIMEHSVMFPIDALKTR--IQSANAKSLSAKNMLSQISH----------- 80

Query: 182 YKEEGGIKGLYRGVWPTSLGVVPYVALNFAVYEQFKEFMPEGTDNTLANFYKLSI-GALS 240
                G   L++GV    LG  P  A+ F  YE  K+ + + +D    + +K +I GA +
Sbjct: 81  ISTSEGTLALWKGVQSVILGAGPAHAVYFGTYEFCKKNLIDSSDTQTHHPFKTAISGACA 140

Query: 241 GGVAQTVTYPFDLLRRRFQVLAMGGNELGFRYKSVMDALITIGKTEGFRGYYKGLTANLF 300
              +  +  PFD +++R Q+             SV      I ++EG   +Y      L 
Sbjct: 141 TTASDALMNPFDTIKQRIQLNTSA---------SVWQTTKQIYQSEGLAAFYYSYPTTLV 191

Query: 301 KVIPSTAVSWLVYE 314
             IP  A ++++YE
Sbjct: 192 MNIPFAAFNFVIYE 205

 Score = 58.9 bits (141), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 44/187 (23%), Positives = 78/187 (41%), Gaps = 19/187 (10%)

Query: 35  VSRTVVSPFERVKILLQVQNSTTAYNQGIVGAVRQVYREEGTPGLFRGNGLNCIRIFPYS 94
            S  +++PF+ +K  +Q+  S + +        +Q+Y+ EG    +       +   P++
Sbjct: 143 ASDALMNPFDTIKQRIQLNTSASVWQ-----TTKQIYQSEGLAAFYYSYPTTLVMNIPFA 197

Query: 95  AVQFVVYEACKKHFFHVDGSKGREQLQNWQRLFSGALCGGCSVLATYPLDLVRTRLSIQT 154
           A  FV+YE+  K            +         G++ G      T PLD ++T L I+ 
Sbjct: 198 AFNFVIYESSTKFL------NPSNEYNPLIHCLCGSISGSTCAAITTPLDCIKTVLQIRG 251

Query: 155 ANLTKLSKSR-AHNISKPPGVWDLLCRTYKEEGGIKGLYRGVWPTSLGVVPYVALNFAVY 213
           +    L   R A   SK       + + Y    G KG +RG  P  +  +P  A+++  Y
Sbjct: 252 SQTVSLEIMRKADTFSKAASA---IYQVY----GWKGFWRGWKPRIVANMPATAISWTAY 304

Query: 214 EQFKEFM 220
           E  K F+
Sbjct: 305 ECAKHFL 311

>CAGL0K08250g complement(820185..821078) highly similar to sp|P23500
           Saccharomyces cerevisiae YKR052c Mitochondrial RNA
           splicing protein, hypothetical start
          Length = 297

 Score = 92.4 bits (228), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 71/283 (25%), Positives = 119/283 (42%), Gaps = 27/283 (9%)

Query: 35  VSRTVVSPFERVKILLQVQNSTTAYNQGIVGAVRQVYREEGTPGLFRGNGLNCIRIFPYS 94
           +  +V+ P + +K  +Q  +S+ A  QG++  + ++   EG+  L++G     +   P  
Sbjct: 29  MEHSVLFPVDAIKTRIQ-SSSSGAATQGLIKQISKITTAEGSLALWKGVQSVILGAGPAH 87

Query: 95  AVQFVVYEACKKHFFHVDGSKGREQLQNWQRLFSGALCGGCSVLATYPLDLVRTRLSIQT 154
           AV F  YE  K         +     Q  +   SG      +     P D+++ R+ + T
Sbjct: 88  AVYFATYEFSKSKLI---DPQDMHTHQPIKTAISGMAATTVADALMNPFDVIKQRMQLNT 144

Query: 155 ANLTKLSKSRAHNISKPPGVWDLLCRTYKEEGGIKGLYRGVWPTSLGV-VPYVALNFAVY 213
                              VW +    Y +EG     Y   +PT+L + +P+ A NFA+Y
Sbjct: 145 RE----------------SVWHVTKNIYHKEGFAAFYYS--YPTTLVMNIPFAAFNFAIY 186

Query: 214 EQFKEFMPEGTDNTLANFYKLSIGALSGGVAQTVTYPFDLLRRRFQVLAMG--GNELGFR 271
           E   +FM     N    F     G LSG     +T P D ++   QV       NE+  +
Sbjct: 187 ESATKFM--NPSNEYNPFIHCISGGLSGATCAAITTPLDCIKTVLQVRGSETVSNEIMKQ 244

Query: 272 YKSVMDALITIGKTEGFRGYYKGLTANLFKVIPSTAVSWLVYE 314
             +   A   I K  G++G+ +GL   +   +P+TA+SW  YE
Sbjct: 245 ANTFQRAASAIYKIHGWKGFLRGLKPRVIANMPATAISWTSYE 287

 Score = 56.6 bits (135), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 53/199 (26%), Positives = 84/199 (42%), Gaps = 23/199 (11%)

Query: 124 QRLFSGALCGGCSVLATYPLDLVRTRLSIQTANLTKLSKSRAHNISKPPGVWDLLCRTYK 183
            +L +GA  G       +P+D ++TR  IQ+++    ++     ISK             
Sbjct: 18  HQLLAGAFAGIMEHSVLFPVDAIKTR--IQSSSSGAATQGLIKQISK----------ITT 65

Query: 184 EEGGIKGLYRGVWPTSLGVVPYVALNFAVYEQFKEFMPEGTDNTLANFYKLSIGALSGG- 242
            EG +  L++GV    LG  P  A+ FA YE  K  + +  D       K +I  ++   
Sbjct: 66  AEGSL-ALWKGVQSVILGAGPAHAVYFATYEFSKSKLIDPQDMHTHQPIKTAISGMAATT 124

Query: 243 VAQTVTYPFDLLRRRFQVLAMGGNELGFRYKSVMDALITIGKTEGFRGYYKGLTANLFKV 302
           VA  +  PFD++++R Q        L  R +SV      I   EGF  +Y      L   
Sbjct: 125 VADALMNPFDVIKQRMQ--------LNTR-ESVWHVTKNIYHKEGFAAFYYSYPTTLVMN 175

Query: 303 IPSTAVSWLVYEVVCDLMH 321
           IP  A ++ +YE     M+
Sbjct: 176 IPFAAFNFAIYESATKFMN 194

 Score = 56.6 bits (135), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 39/186 (20%), Positives = 78/186 (41%), Gaps = 17/186 (9%)

Query: 35  VSRTVVSPFERVKILLQVQNSTTAYNQGIVGAVRQVYREEGTPGLFRGNGLNCIRIFPYS 94
           V+  +++PF+ +K  +Q+    + ++       + +Y +EG    +       +   P++
Sbjct: 125 VADALMNPFDVIKQRMQLNTRESVWH-----VTKNIYHKEGFAAFYYSYPTTLVMNIPFA 179

Query: 95  AVQFVVYEACKKHFFHVDGSKGREQLQNWQRLFSGALCGGCSVLATYPLDLVRTRLSIQT 154
           A  F +YE+  K            +   +    SG L G      T PLD ++T L ++ 
Sbjct: 180 AFNFAIYESATKFM------NPSNEYNPFIHCISGGLSGATCAAITTPLDCIKTVLQVRG 233

Query: 155 ANLTKLSKSRAHNISKPPGVWDLLCRTYKEEGGIKGLYRGVWPTSLGVVPYVALNFAVYE 214
                 S++ ++ I K    +        +  G KG  RG+ P  +  +P  A+++  YE
Sbjct: 234 ------SETVSNEIMKQANTFQRAASAIYKIHGWKGFLRGLKPRVIANMPATAISWTSYE 287

Query: 215 QFKEFM 220
             K F+
Sbjct: 288 CAKHFL 293

>YIL134W (FLX1) [2542] chr9 (97395..98330) Protein involved in
           transport of FAD from cytosol into the mitochondrial
           matrix, member of mitochondrial carrier (MCF) family of
           membrane transporters [936 bp, 311 aa]
          Length = 311

 Score = 92.0 bits (227), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 89/301 (29%), Positives = 141/301 (46%), Gaps = 38/301 (12%)

Query: 35  VSRTVVSPFERVKILLQVQ-NSTTAYNQGIVGAVRQVYREEGTPG------LFRGNGLNC 87
           V+  VV P + +K+ LQ+   S    + G    ++++ R     G      L+RG  +N 
Sbjct: 22  VTTLVVHPLDLLKVRLQLSATSAQKAHYGPFMVIKEIIRSSANSGRSVTNELYRGLSINL 81

Query: 88  IRIFPYSAVQFVVYEACKKHFFHVDGSKGREQLQ---NWQRLFS------GALCGGCSVL 138
                   V F +Y   K+  +      G  QL+   N  ++ S      GA  G  + +
Sbjct: 82  FGNAIAWGVYFGLYGVTKELIYKSVAKPGETQLKGVGNDHKMNSLIYLSAGASSGLMTAI 141

Query: 139 ATYPLDLVRTRLSIQTANLTKLSKSRAHNISKPPGVWDLLCRTYKEEGGIKGLYRGVWPT 198
            T P+ +++TR+ + T+   + + +  +N     GV  LL RT     G +GL++G+ P 
Sbjct: 142 LTNPIWVIKTRI-MSTSKGAQGAYTSMYN-----GVQQLL-RT----DGFQGLWKGLVPA 190

Query: 199 SLGVVPYVALNFAVYEQFKEFM-----PEGTDNTLANFYKLSIGALSGGVAQTVTYPFDL 253
             GV    AL FAVY+  K+         G D  L N   + I +L   V+ T+ YPF L
Sbjct: 191 LFGV-SQGALYFAVYDTLKQRKLRRKRENGLDIHLTNLETIEITSLGKMVSVTLVYPFQL 249

Query: 254 LRRRFQVLAMGGNELGFRYKSVMDALITIGKTEGFRGYYKGLTANLFKVIPSTAVSWLVY 313
           L+   Q  +   NE  FR   ++  +I     +GF G YKGL+ANL + IPST +++ VY
Sbjct: 250 LKSNLQ--SFRANEQKFRLFPLIKLIIA---NDGFVGLYKGLSANLVRAIPSTCITFCVY 304

Query: 314 E 314
           E
Sbjct: 305 E 305

 Score = 53.5 bits (127), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 54/208 (25%), Positives = 90/208 (43%), Gaps = 26/208 (12%)

Query: 124 QRLFSGALCGGCSVLATYPLDLVRTRLSIQTANLTKLSKSRAHNISKPPGVWDLLCRTYK 183
           + + SG   G  + L  +PLDL++ RL      L+  S  +AH    P  V   + R+  
Sbjct: 11  KEVISGLSAGSVTTLVVHPLDLLKVRL-----QLSATSAQKAH--YGPFMVIKEIIRSSA 63

Query: 184 EEGG--IKGLYRGVWPTSLGVVPYVALNFAVYEQFKEFMPE-------------GTDNTL 228
             G      LYRG+     G      + F +Y   KE + +             G D+ +
Sbjct: 64  NSGRSVTNELYRGLSINLFGNAIAWGVYFGLYGVTKELIYKSVAKPGETQLKGVGNDHKM 123

Query: 229 ANFYKLSIGALSGGVAQTVTYPFDLLRRRFQVLAMGGNELGFRYKSVMDALITIGKTEGF 288
            +   LS GA SG +   +T P  +++ R    + G       Y S+ + +  + +T+GF
Sbjct: 124 NSLIYLSAGASSGLMTAILTNPIWVIKTRIMSTSKGAQG---AYTSMYNGVQQLLRTDGF 180

Query: 289 RGYYKGLTANLFKVIPSTAVSWLVYEVV 316
           +G +KGL   LF V    A+ + VY+ +
Sbjct: 181 QGLWKGLVPALFGV-SQGALYFAVYDTL 207

 Score = 39.3 bits (90), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 40/164 (24%), Positives = 68/164 (41%), Gaps = 20/164 (12%)

Query: 56  TTAYNQGIVGAVRQVYREEGTPGLFRGNGLNCIRIFPYSAVQFVVYEACKKHFFHVDGSK 115
           T+ YN      V+Q+ R +G  GL++G  +  +      A+ F VY+  K+         
Sbjct: 165 TSMYN-----GVQQLLRTDGFQGLWKGL-VPALFGVSQGALYFAVYDTLKQRKLRRKREN 218

Query: 116 GRE-QLQNWQRLFSGALCGGCSVLATYPLDLVRTRLSIQTANLTKLSKSRAHNISKPPGV 174
           G +  L N + +   +L    SV   YP  L+++ L    AN  K              +
Sbjct: 219 GLDIHLTNLETIEITSLGKMVSVTLVYPFQLLKSNLQSFRANEQKFR------------L 266

Query: 175 WDLLCRTYKEEGGIKGLYRGVWPTSLGVVPYVALNFAVYEQFKE 218
           + L+      +G + GLY+G+    +  +P   + F VYE  K 
Sbjct: 267 FPLIKLIIANDGFV-GLYKGLSANLVRAIPSTCITFCVYENLKH 309

 Score = 35.0 bits (79), Expect = 0.062,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 37/76 (48%), Gaps = 5/76 (6%)

Query: 35  VSRTVVSPFERVKILLQVQNSTTAYNQG--IVGAVRQVYREEGTPGLFRGNGLNCIRIFP 92
           VS T+V PF+ +K  LQ   S  A  Q   +   ++ +   +G  GL++G   N +R  P
Sbjct: 239 VSVTLVYPFQLLKSNLQ---SFRANEQKFRLFPLIKLIIANDGFVGLYKGLSANLVRAIP 295

Query: 93  YSAVQFVVYEACKKHF 108
            + + F VYE  K   
Sbjct: 296 STCITFCVYENLKHRL 311

>Scas_721.27
          Length = 374

 Score = 92.8 bits (229), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 84/322 (26%), Positives = 139/322 (43%), Gaps = 57/322 (17%)

Query: 39  VVSPFERVKILLQ-----------VQNSTTAYNQGIVGAVRQ--------------VYRE 73
           V  PF+ VK  LQ               T A+N  I  ++ Q              VY+ 
Sbjct: 69  VTCPFDLVKTRLQSDIYQSVYKSKAATVTAAHNSKIANSLVQAGTHFKETFGILGNVYKR 128

Query: 74  EGTPGLFRGNGLNCIRIFPYSAVQFVVYEACKKHFFHVDGSKGREQLQNWQRLFSGALCG 133
           EG   LF+G G N + + P  ++ F  Y    K  +    + G+E       L S A  G
Sbjct: 129 EGFRSLFKGLGPNLVGVIPARSINFFTY-GTTKEIYSKAFNNGQE--TPLIHLMSAATAG 185

Query: 134 GCSVLATYPLDLVRTRLSIQTANLTKLSKSRAHNISKPPGVWDLLCRTYKEEGGIKGLYR 193
             +  AT P+ +++TR+ +  A  T+  K+           WD L    K E GI GLYR
Sbjct: 186 WATSTATNPIWMIKTRVQLDKAGTTRKYKNS----------WDCLKTVLKSE-GIYGLYR 234

Query: 194 GVWPTSLGVVPYVALNFAVYEQFKEFMPEGTDNTLANFYKLSIGAL-----------SGG 242
           G+  + LG +  + L + +YEQ K  + + +     +  +L+               S G
Sbjct: 235 GLSASYLGSIEGI-LQWLLYEQMKHLIKQRSIEKFGHEGQLTKSRTEKIKEWCQRSGSAG 293

Query: 243 VAQ----TVTYPFDLLRRRFQVLAMGGNELGFRYKSVMDALITIGKTEGFRGYYKGLTAN 298
           VA+     VTYP +++R R + + M   +   +Y  ++ +   I K EG    Y GLT +
Sbjct: 294 VAKFIASIVTYPHEVVRTRLRQMPMENGKP--KYTGLVQSFRVIIKEEGLASMYSGLTPH 351

Query: 299 LFKVIPSTAVSWLVYEVVCDLM 320
           L + +P++ + +  +E+V  L+
Sbjct: 352 LMRTVPNSIIMFGTWELVIRLL 373

 Score = 73.9 bits (180), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 56/198 (28%), Positives = 93/198 (46%), Gaps = 20/198 (10%)

Query: 138 LATYPLDLVRTRL--------------SIQTANLTKLSKSRAHNISKPPGVWDLLCRTYK 183
           + T P DLV+TRL              ++  A+ +K++ S     +     + +L   YK
Sbjct: 68  VVTCPFDLVKTRLQSDIYQSVYKSKAATVTAAHNSKIANSLVQAGTHFKETFGILGNVYK 127

Query: 184 EEGGIKGLYRGVWPTSLGVVPYVALNFAVYEQFKEFMPEGTDNTLAN-FYKLSIGALSGG 242
            E G + L++G+ P  +GV+P  ++NF  Y   KE   +  +N        L   A +G 
Sbjct: 128 RE-GFRSLFKGLGPNLVGVIPARSINFFTYGTTKEIYSKAFNNGQETPLIHLMSAATAGW 186

Query: 243 VAQTVTYPFDLLRRRFQVLAMGGNELGFRYKSVMDALITIGKTEGFRGYYKGLTANLFKV 302
              T T P  +++ R Q+   G      +YK+  D L T+ K+EG  G Y+GL+A+    
Sbjct: 187 ATSTATNPIWMIKTRVQLDKAGTTR---KYKNSWDCLKTVLKSEGIYGLYRGLSASYLGS 243

Query: 303 IPSTAVSWLVYEVVCDLM 320
           I    + WL+YE +  L+
Sbjct: 244 IEGI-LQWLLYEQMKHLI 260

 Score = 30.8 bits (68), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 19/71 (26%), Positives = 35/71 (49%), Gaps = 4/71 (5%)

Query: 35  VSRTVVSPFERVKILLQ---VQNSTTAYNQGIVGAVRQVYREEGTPGLFRGNGLNCIRIF 91
           ++  V  P E V+  L+   ++N    Y  G+V + R + +EEG   ++ G   + +R  
Sbjct: 298 IASIVTYPHEVVRTRLRQMPMENGKPKYT-GLVQSFRVIIKEEGLASMYSGLTPHLMRTV 356

Query: 92  PYSAVQFVVYE 102
           P S + F  +E
Sbjct: 357 PNSIIMFGTWE 367

>Kwal_23.4731
          Length = 314

 Score = 90.9 bits (224), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 75/292 (25%), Positives = 139/292 (47%), Gaps = 35/292 (11%)

Query: 42  PFERVKILLQVQNSTTAYNQGIVGAVRQVYREEGTPG-----LFRGNGLNCIRIFPYSAV 96
           P + VK+ LQ+  +TT ++ G    ++ + R+           +RG G+N I       +
Sbjct: 33  PLDLVKLRLQLLVNTT-HSHGYKEVIKTIIRDSKADSNVFREAYRGLGVNLIGNSIAWGL 91

Query: 97  QFVVYEACKKHFFHVDGSKGREQLQN-WQR---------LFSGALCGGCSVLATYPLDLV 146
            F +Y   K   +    ++ +   Q+ +Q+         L S AL G  + + T P+ ++
Sbjct: 92  YFGLYRFTKDMVYRYGVAQMKTPTQSSFQKDKAMGPSLYLASAALSGLGTAILTNPIWVI 151

Query: 147 RTRLSIQTANLTKLSKSRAHNISKPPGVWDLLCRTYKEEGGIKGLYRGVWPTSLGVVPYV 206
           +TR+   ++  ++  K+           WD + + Y  EG   G +RG+ P+  GV    
Sbjct: 152 KTRIMSTSSQASERYKT----------TWDGIRKVYAHEG-FSGFWRGLVPSLFGVAQ-G 199

Query: 207 ALNFAVYEQFKE--FMPEGT--DNTLANFYKLSIGALSGGVAQTVTYPFDLLRRRFQVLA 262
           A+ F +Y+  +   F   G   D  + N   ++I ++S  ++ T  YPF LL+   Q  A
Sbjct: 200 AIYFTIYDSLRHQYFARRGITEDEKMGNLENIAITSVSKMLSVTAVYPFQLLKSNLQSFA 259

Query: 263 MGGNELGFRYKSVMDALITIGKTEGFRGYYKGLTANLFKVIPSTAVSWLVYE 314
                  +R+ +++    +I + EG +G YKGL+ANL + IPST +++ +YE
Sbjct: 260 AVEKRDSYRFWNLVK---SIHQKEGLQGLYKGLSANLLRAIPSTCITFCIYE 308

 Score = 59.7 bits (143), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 36/154 (23%), Positives = 75/154 (48%), Gaps = 12/154 (7%)

Query: 67  VRQVYREEGTPGLFRGNGLNCIRIFPYSAVQFVVYEACKKHFFHVDGSKGREQLQNWQRL 126
           +R+VY  EG  G +RG   +   +    A+ F +Y++ +  +F   G    E++ N + +
Sbjct: 173 IRKVYAHEGFSGFWRGLVPSLFGV-AQGAIYFTIYDSLRHQYFARRGITEDEKMGNLENI 231

Query: 127 FSGALCGGCSVLATYPLDLVRTRLSIQTANLTKLSKSRAHNISKPPGVWDLLCRTYKEEG 186
              ++    SV A YP  L+++ L     +   + K  ++        W+L+   +++EG
Sbjct: 232 AITSVSKMLSVTAVYPFQLLKSNLQ----SFAAVEKRDSYRF------WNLVKSIHQKEG 281

Query: 187 GIKGLYRGVWPTSLGVVPYVALNFAVYEQFKEFM 220
            ++GLY+G+    L  +P   + F +YE  + ++
Sbjct: 282 -LQGLYKGLSANLLRAIPSTCITFCIYENLRHWL 314

 Score = 50.1 bits (118), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 50/206 (24%), Positives = 93/206 (45%), Gaps = 28/206 (13%)

Query: 124 QRLFSGALCGGCSVLATYPLDLVRTRLSIQTANLTKLSKSRAHNISKPPGVWDLLCRTYK 183
           + + +G   G  + +AT+PLDLV+ RL +       ++ + +H   +   V   + R  K
Sbjct: 15  REIIAGLAAGTLTTIATHPLDLVKLRLQLL------VNTTHSHGYKE---VIKTIIRDSK 65

Query: 184 EEGGI-KGLYRGVWPTSLGVVPYVALNFAVYEQFKEF-----MPEGTDNTLANFYK---- 233
            +  + +  YRG+    +G      L F +Y   K+      + +    T ++F K    
Sbjct: 66  ADSNVFREAYRGLGVNLIGNSIAWGLYFGLYRFTKDMVYRYGVAQMKTPTQSSFQKDKAM 125

Query: 234 -----LSIGALSGGVAQTVTYPFDLLRRRFQVLAMGGNELGFRYKSVMDALITIGKTEGF 288
                L+  ALSG     +T P  +++ R    +   +E   RYK+  D +  +   EGF
Sbjct: 126 GPSLYLASAALSGLGTAILTNPIWVIKTRIMSTSSQASE---RYKTTWDGIRKVYAHEGF 182

Query: 289 RGYYKGLTANLFKVIPSTAVSWLVYE 314
            G+++GL  +LF V    A+ + +Y+
Sbjct: 183 SGFWRGLVPSLFGV-AQGAIYFTIYD 207

>YKR052C (MRS4) [3303] chr11 complement(532192..533106) Member of
           the mitochondrial carrier (MCF) family of membrane
           transporters, overexpression suppresses defects in
           splicing of mitochondrial introns [915 bp, 304 aa]
          Length = 304

 Score = 90.1 bits (222), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 73/295 (24%), Positives = 128/295 (43%), Gaps = 50/295 (16%)

Query: 35  VSRTVVSPFERVKILLQVQNSTTAYNQGIVGAVRQVYREEGTPGLFRGNGLNCIRIFPYS 94
           +  +++ P + +K  +Q      A + G++  + ++   EG+  L++G     +   P  
Sbjct: 36  MEHSLMFPIDALKTRVQAAGLNKAASTGMISQISKISTMEGSMALWKGVQSVILGAGPAH 95

Query: 95  AVQFVVYEACKKHFFHVDGSKGREQLQNWQRLFSGALCGGCSVLAT----YPLDLVRTRL 150
           AV F  YE CK            E +Q  Q +   AL G  + +A      P D V+ RL
Sbjct: 96  AVYFGTYEFCKARLI------SPEDMQTHQPM-KTALSGTIATIAADALMNPFDTVKQRL 148

Query: 151 SIQTANLTKLSKSRAHNISKPPGVWDLLCRTYKEEGGIKGLYRGVWPTSLGV-VPYVALN 209
            + T NL                VW++  + Y+ EG     Y   +PT+L + +P+ A N
Sbjct: 149 QLDT-NLR---------------VWNVTKQIYQNEGFAAFYYS--YPTTLAMNIPFAAFN 190

Query: 210 FAVYEQFKEFM-PEGTDNTLANFYKLSIGALSGGVAQTVTYPFDLLRRRFQV-------- 260
           F +YE   +F  P+ + N L +      G +SG     +T P D ++   QV        
Sbjct: 191 FMIYESASKFFNPQNSYNPLIHCL---CGGISGATCAALTTPLDCIKTVLQVRGSETVSI 247

Query: 261 -LAMGGNELGFRYKSVMDALITIGKTEGFRGYYKGLTANLFKVIPSTAVSWLVYE 314
            +    N  G   +++++         G++G+++GL   +   IP+TA+SW  YE
Sbjct: 248 EIMKDANTFGRASRAILE-------VHGWKGFWRGLKPRIVANIPATAISWTAYE 295

 Score = 65.5 bits (158), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 49/191 (25%), Positives = 83/191 (43%), Gaps = 27/191 (14%)

Query: 35  VSRTVVSPFERVKILLQVQNSTTAYNQGIVGAVRQVYREEGTPGLFRGNGLNCIRIFPYS 94
            +  +++PF+ VK  LQ+  +   +N       +Q+Y+ EG    +           P++
Sbjct: 133 AADALMNPFDTVKQRLQLDTNLRVWN-----VTKQIYQNEGFAAFYYSYPTTLAMNIPFA 187

Query: 95  AVQFVVYEACKKHFFHVDGSKGREQLQNWQRLFSGALCGG-----CSVLATYPLDLVRTR 149
           A  F++YE+  K F            QN        LCGG     C+ L T PLD ++T 
Sbjct: 188 AFNFMIYESASKFF----------NPQNSYNPLIHCLCGGISGATCAALTT-PLDCIKTV 236

Query: 150 LSIQTANLTKLSKSRAHNISKPPGVWDLLCRTYKEEGGIKGLYRGVWPTSLGVVPYVALN 209
           L ++       S++ +  I K    +    R   E  G KG +RG+ P  +  +P  A++
Sbjct: 237 LQVRG------SETVSIEIMKDANTFGRASRAILEVHGWKGFWRGLKPRIVANIPATAIS 290

Query: 210 FAVYEQFKEFM 220
           +  YE  K F+
Sbjct: 291 WTAYECAKHFL 301

 Score = 52.8 bits (125), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 48/191 (25%), Positives = 82/191 (42%), Gaps = 22/191 (11%)

Query: 125 RLFSGALCGGCSVLATYPLDLVRTRLSIQTANLTKLSKSRAHNISKPPGVWDLLCRTYKE 184
           +L +GA  G       +P+D ++TR  +Q A L K + +         G+   + +    
Sbjct: 26  QLLAGAFAGIMEHSLMFPIDALKTR--VQAAGLNKAAST---------GMISQISKISTM 74

Query: 185 EGGIKGLYRGVWPTSLGVVPYVALNFAVYEQFKEFMPEGTDNTLANFYKLSI-GALSGGV 243
           EG +  L++GV    LG  P  A+ F  YE  K  +    D       K ++ G ++   
Sbjct: 75  EGSM-ALWKGVQSVILGAGPAHAVYFGTYEFCKARLISPEDMQTHQPMKTALSGTIATIA 133

Query: 244 AQTVTYPFDLLRRRFQVLAMGGNELGFRYKSVMDALITIGKTEGFRGYYKGLTANLFKVI 303
           A  +  PFD +++R Q+      +   R   V +    I + EGF  +Y      L   I
Sbjct: 134 ADALMNPFDTVKQRLQL------DTNLR---VWNVTKQIYQNEGFAAFYYSYPTTLAMNI 184

Query: 304 PSTAVSWLVYE 314
           P  A ++++YE
Sbjct: 185 PFAAFNFMIYE 195

>KLLA0E23705g complement(2099965..2101071) highly similar to
           sp|P38127 Saccharomyces cerevisiae YBR192w RIM2
           mitochondrial carrier protein (MCF), start by similarity
          Length = 368

 Score = 90.9 bits (224), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 78/274 (28%), Positives = 128/274 (46%), Gaps = 36/274 (13%)

Query: 62  GIVGAVRQVYREEGTPGLFRGNGLNCIRIFPYSAVQFVVYEACKKHFFHVDGSKGREQLQ 121
           GI+G    VYR+EG   LF+G G N + + P  ++ F+ Y    K  +    + G+E   
Sbjct: 115 GIIG---NVYRQEGFRSLFKGLGPNLVGVIPARSINFLTY-GTTKDIYSRTLNNGQE--A 168

Query: 122 NWQRLFSGALCGGCSVLATYPLDLVRTRLSIQTANLTKLSKSRAHNISKPPGVWDLLCRT 181
            W  L + A  G  +   T P+ LV+TRL +  A  TK  K+            D +   
Sbjct: 169 PWIHLLAAATAGWATSTVTNPIWLVKTRLQLDKAG-TKTYKNSL----------DCIKSV 217

Query: 182 YKEEGGIKGLYRGVWPTSLGVVPYVALNFAVYEQFKEFMPE--------------GTDNT 227
            K E G+ GLY+G+  + LG V  + L + +YEQ K  + E               T + 
Sbjct: 218 VKNE-GVLGLYKGLSASYLGSVEGI-LQWILYEQMKRIIKERSIEKFGHIHEDAKSTSDK 275

Query: 228 LANFYKLSIGA-LSGGVAQTVTYPFDLLRRRFQVLAMGGNELGFRYKSVMDALITIGKTE 286
           +  + + S  A L+  VA  VTYP +++R R +       +L  +Y  ++ +   I K E
Sbjct: 276 VKEWCQRSGSAGLAKFVASIVTYPHEVVRTRLRQAPTENGKL--KYTGLVQSFRVIIKEE 333

Query: 287 GFRGYYKGLTANLFKVIPSTAVSWLVYEVVCDLM 320
           G    Y GLT +L + +P++ + +  +E+V  L+
Sbjct: 334 GLVSMYSGLTPHLLRTVPNSIIMFGTWELVIKLL 367

 Score = 69.3 bits (168), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 52/187 (27%), Positives = 90/187 (48%), Gaps = 18/187 (9%)

Query: 140 TYPLDLVRTRL-------SIQTANLTKLSKSRAHNISKP----PGVWDLLCRTYKEEGGI 188
           T P D+V+TRL         ++A +     S  H +S+        + ++   Y++E G 
Sbjct: 68  TCPFDVVKTRLQSDVFRTQYKSAAMQNNGSSTLHFVSRSLLHFKETFGIIGNVYRQE-GF 126

Query: 189 KGLYRGVWPTSLGVVPYVALNFAVYEQFKEFMPEGTDN-TLANFYKLSIGALSGGVAQTV 247
           + L++G+ P  +GV+P  ++NF  Y   K+      +N   A +  L   A +G    TV
Sbjct: 127 RSLFKGLGPNLVGVIPARSINFLTYGTTKDIYSRTLNNGQEAPWIHLLAAATAGWATSTV 186

Query: 248 TYPFDLLRRRFQVLAMGGNELGFRYKSVMDALITIGKTEGFRGYYKGLTANLFKVIPSTA 307
           T P  L++ R Q+   G       YK+ +D + ++ K EG  G YKGL+A+    +    
Sbjct: 187 TNPIWLVKTRLQLDKAGTKT----YKNSLDCIKSVVKNEGVLGLYKGLSASYLGSVEGI- 241

Query: 308 VSWLVYE 314
           + W++YE
Sbjct: 242 LQWILYE 248

 Score = 53.9 bits (128), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 48/189 (25%), Positives = 82/189 (43%), Gaps = 20/189 (10%)

Query: 36  SRTVVSPFERVKILLQVQNSTTAYNQGIVGAVRQVYREEGTPGLFRGNGLN-------CI 88
           + TV +P   VK  LQ+  + T   +  +  ++ V + EG  GL++G   +        +
Sbjct: 183 TSTVTNPIWLVKTRLQLDKAGTKTYKNSLDCIKSVVKNEGVLGLYKGLSASYLGSVEGIL 242

Query: 89  RIFPYSAVQFVVYEACKKHFFHV--DGSKGREQLQNW-QRLFSGALCGGCSVLATYPLDL 145
           +   Y  ++ ++ E   + F H+  D     ++++ W QR  S  L    + + TYP ++
Sbjct: 243 QWILYEQMKRIIKERSIEKFGHIHEDAKSTSDKVKEWCQRSGSAGLAKFVASIVTYPHEV 302

Query: 146 VRTRLSIQTANLTKLSKSRAHNISKPPGVWDLLCRTYKEEGGIKGLYRGVWPTSLGVVPY 205
           VRTRL        KL         K  G+        KEEG +  +Y G+ P  L  VP 
Sbjct: 303 VRTRLRQAPTENGKL---------KYTGLVQSFRVIIKEEGLV-SMYSGLTPHLLRTVPN 352

Query: 206 VALNFAVYE 214
             + F  +E
Sbjct: 353 SIIMFGTWE 361

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 30/91 (32%), Positives = 45/91 (49%), Gaps = 18/91 (19%)

Query: 247 VTYPFDLLRRRFQV---------LAM---GGNELGFRYKSVMDALITIG------KTEGF 288
           VT PFD+++ R Q           AM   G + L F  +S++    T G      + EGF
Sbjct: 67  VTCPFDVVKTRLQSDVFRTQYKSAAMQNNGSSTLHFVSRSLLHFKETFGIIGNVYRQEGF 126

Query: 289 RGYYKGLTANLFKVIPSTAVSWLVYEVVCDL 319
           R  +KGL  NL  VIP+ ++++L Y    D+
Sbjct: 127 RSLFKGLGPNLVGVIPARSINFLTYGTTKDI 157

>CAGL0L05742g complement(630844..631761) similar to sp|P10566
           Saccharomyces cerevisiae YJL133w MRS3 or sp|P23500
           Saccharomyces cerevisiae YKR052c MRS4, start by
           similarity
          Length = 305

 Score = 89.4 bits (220), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 78/289 (26%), Positives = 126/289 (43%), Gaps = 36/289 (12%)

Query: 37  RTVVSPFERVKILLQVQN--STTAYNQGIVGAVRQ---VYREEGTPGLFRGNGLNCIRIF 91
            +V+ P + +K  LQ  +  STT         +RQ   +  +EG+  L++G     +   
Sbjct: 33  HSVIFPLDALKTRLQAMHAISTTGGQPIPSTMLRQLSSISAQEGSMVLWKGVQSVLLGAG 92

Query: 92  PYSAVQFVVYEACKKHFFHVDGSKGREQLQNWQRLFSGALCGGCSVLATYPLDLVRTRLS 151
           P  AV F  YE  K   F +D +    +   ++  FSGA     +     P D+++ R+ 
Sbjct: 93  PAHAVYFATYEMVKS--FLIDEATSTSKYHFFKTAFSGATATIAADALMNPFDVIKQRIQ 150

Query: 152 IQTANLTKLSKSRAHNISKPPGVWDLLCRTYKEEGGIKGLYRGVWPTSLGV-VPYVALNF 210
           + T            NIS    VWD   R Y +EG  +  Y   +PT+L + +P+ A NF
Sbjct: 151 LNT------------NIS----VWDTAKRIYSKEG-FQAFYSS-YPTTLAINIPFAAFNF 192

Query: 211 AVYEQF-KEFMPEGTDNTLANFYKLSIGALSGGVAQTVTYPFDLLRRRFQVLAMGGNELG 269
            +Y+   + F P G  N    F     G +SG     +T P D ++   QV   G  ++ 
Sbjct: 193 GIYDTATRYFNPSGVYNP---FIHCLCGGISGAACAGLTTPLDCIKTALQV--RGSEKVS 247

Query: 270 FRYKSVMD----ALITIGKTEGFRGYYKGLTANLFKVIPSTAVSWLVYE 314
                  D    A   I +  G+RG++ G+   +   +P+TA+SW  YE
Sbjct: 248 MEVFKQADTFKKATRAIYQVYGWRGFWSGVKPRILANMPATAISWTAYE 296

 Score = 63.5 bits (153), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 56/195 (28%), Positives = 87/195 (44%), Gaps = 18/195 (9%)

Query: 124 QRLFSGALCGGCSVLATYPLDLVRTRLSIQTANLTKLSKSRAHNISKPPGVWDLLCRTYK 183
            +L +GA  G       +PLD ++TRL    A    +S +    I  P  +   L     
Sbjct: 20  HQLMAGAFAGIAEHSVIFPLDALKTRLQAMHA----ISTTGGQPI--PSTMLRQLSSISA 73

Query: 184 EEGGIKGLYRGVWPTSLGVVPYVALNFAVYEQFKEFM-PEGTDNTLANFYKLSI-GALSG 241
           +EG +  L++GV    LG  P  A+ FA YE  K F+  E T  +  +F+K +  GA + 
Sbjct: 74  QEGSMV-LWKGVQSVLLGAGPAHAVYFATYEMVKSFLIDEATSTSKYHFFKTAFSGATAT 132

Query: 242 GVAQTVTYPFDLLRRRFQVLAMGGNELGFRYKSVMDALITIGKTEGFRGYYKGLTANLFK 301
             A  +  PFD++++R Q   +  N       SV D    I   EGF+ +Y      L  
Sbjct: 133 IAADALMNPFDVIKQRIQ---LNTN------ISVWDTAKRIYSKEGFQAFYSSYPTTLAI 183

Query: 302 VIPSTAVSWLVYEVV 316
            IP  A ++ +Y+  
Sbjct: 184 NIPFAAFNFGIYDTA 198

 Score = 50.1 bits (118), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 40/190 (21%), Positives = 79/190 (41%), Gaps = 25/190 (13%)

Query: 35  VSRTVVSPFERVKILLQVQNSTTAYNQGIVGAVRQVYREEGTPGLFRGNGLNCIRIFPYS 94
            +  +++PF+ +K  +Q+  + + ++       +++Y +EG    +           P++
Sbjct: 134 AADALMNPFDVIKQRIQLNTNISVWDTA-----KRIYSKEGFQAFYSSYPTTLAINIPFA 188

Query: 95  AVQFVVYEACKKHFFHVDGSKGREQLQNWQRLFSGALCGGCSVLA----TYPLDLVRTRL 150
           A  F +Y+   ++F                  F   LCGG S  A    T PLD ++T L
Sbjct: 189 AFNFGIYDTATRYF----------NPSGVYNPFIHCLCGGISGAACAGLTTPLDCIKTAL 238

Query: 151 SIQTANLTKLSKSRAHNISKPPGVWDLLCRTYKEEGGIKGLYRGVWPTSLGVVPYVALNF 210
            ++       S+  +  + K    +    R   +  G +G + GV P  L  +P  A+++
Sbjct: 239 QVRG------SEKVSMEVFKQADTFKKATRAIYQVYGWRGFWSGVKPRILANMPATAISW 292

Query: 211 AVYEQFKEFM 220
             YE  K F+
Sbjct: 293 TAYEFAKHFL 302

 Score = 29.6 bits (65), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 20/78 (25%), Positives = 33/78 (42%), Gaps = 6/78 (7%)

Query: 39  VVSPFERVKILLQVQNS----TTAYNQG--IVGAVRQVYREEGTPGLFRGNGLNCIRIFP 92
           + +P + +K  LQV+ S       + Q      A R +Y+  G  G + G     +   P
Sbjct: 227 LTTPLDCIKTALQVRGSEKVSMEVFKQADTFKKATRAIYQVYGWRGFWSGVKPRILANMP 286

Query: 93  YSAVQFVVYEACKKHFFH 110
            +A+ +  YE  K   FH
Sbjct: 287 ATAISWTAYEFAKHFLFH 304

>YGR096W (TPC1) [2056] chr7 (676623..677567) Mitochondrial thiamine
           pyrophosphate transporter, controls import of thiamine
           pyrophosphate during growth on fermentative carbon
           sources, member of the mitochondrial carrier family
           (MCF) of membrane transporters [945 bp, 314 aa]
          Length = 314

 Score = 89.4 bits (220), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 74/306 (24%), Positives = 134/306 (43%), Gaps = 37/306 (12%)

Query: 35  VSRTVVSPFERVKILLQVQ--NSTTAYNQGIVGAVRQVYREEGTPGLFRGNGLNCIRIFP 92
           ++R++ +P + +KI LQ+   N    +   ++   R + + EG    ++GN    +    
Sbjct: 29  LARSITAPMDTIKIRLQLTPANGLKPFGSQVMEVARSMIKNEGIRSFWKGNIPGSLLYVT 88

Query: 93  YSAVQFVVYEACKKHFFHVDGSKGREQLQNWQRLFSGALCGGCSVLATYPLDLVRTRLSI 152
           Y + QF  Y    ++     G + R        L  GA  G  S + +YP D++RTRL  
Sbjct: 89  YGSAQFSSYSLFNRYLTPF-GLEAR-----LHSLVVGAFAGITSSIVSYPFDVLRTRL-- 140

Query: 153 QTANLTKLSKSRAHNISKPPGVWDLLCRTYKEEGGIKGLYRGVWPTSLGVVPYVALNFAV 212
                  ++ ++ H++S    V D+    +K EG + G ++G   +   +    ++ F  
Sbjct: 141 -------VANNQMHSMSITREVRDI----WKLEG-LPGFFKGSIASMTTITLTASIMFGT 188

Query: 213 YEQFKEFMPEGTDNTLAN------FYKLSIGALSGGVAQTVTYPFDLLRRRFQVLAMGGN 266
           YE  + +  E    T A+          S G + G +A+ +T+P + +RRR Q +     
Sbjct: 189 YETIRIYCDENEKTTAAHKKWELATLNHSAGTIGGVIAKIITFPLETIRRRMQFMNSKHL 248

Query: 267 ELGFRYKSVMDAL---------ITIGKTEGFRGYYKGLTANLFKVIPSTAVSWLVYEVVC 317
           E   R+ SV  +          + I K EG    Y+G+   L K IP+T VS+  YE   
Sbjct: 249 EKFSRHSSVYGSYKGYGFARIGLQILKQEGVSSLYRGILVALSKTIPTTFVSFWGYETAI 308

Query: 318 DLMHVW 323
             + ++
Sbjct: 309 HYLRMY 314

 Score = 78.2 bits (191), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 57/215 (26%), Positives = 101/215 (46%), Gaps = 23/215 (10%)

Query: 108 FFHVDGSKGREQLQNWQRLFSGALCGGCSVLATYPLDLVRTRLSIQTANLTKLSKSRAHN 167
           F   D  +  + +  W+ L +GA+ G  +   T P+D ++ RL +  AN  K   S+   
Sbjct: 2   FKEEDSLRKGQNVAAWKTLLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVME 61

Query: 168 ISKPPGVWDLLCRTYKEEGGIKGLYRGVWPTSLGVVPYVALNFAVYEQFKEFM-PEGTDN 226
           +           R+  +  GI+  ++G  P SL  V Y +  F+ Y  F  ++ P G + 
Sbjct: 62  V----------ARSMIKNEGIRSFWKGNIPGSLLYVTYGSAQFSSYSLFNRYLTPFGLE- 110

Query: 227 TLANFYKLSIGALSGGVAQTVTYPFDLLRRRFQVLAMGGNELGFRYKSVMDALITIGKTE 286
             A  + L +GA +G  +  V+YPFD+LR R     +  N++     S+   +  I K E
Sbjct: 111 --ARLHSLVVGAFAGITSSIVSYPFDVLRTRL----VANNQM--HSMSITREVRDIWKLE 162

Query: 287 GFRGYYKGLTANLFKVIPSTAVSWLVYEVV---CD 318
           G  G++KG  A++  +  + ++ +  YE +   CD
Sbjct: 163 GLPGFFKGSIASMTTITLTASIMFGTYETIRIYCD 197

>CAGL0G08910g complement(853693..854562) similar to sp|P40464
           Saccharomyces cerevisiae YIL134w FLX1, hypothetical
           start
          Length = 289

 Score = 88.2 bits (217), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 73/290 (25%), Positives = 133/290 (45%), Gaps = 37/290 (12%)

Query: 35  VSRTVVSPFERVKILLQVQNSTTAYN------QGIVGAVRQVYREEGTPGLFRGNGLNCI 88
           V+  +V P +  K+ LQ+  ++T           IVG+   + RE     L+RG  +N +
Sbjct: 21  VTTLIVHPLDLFKVRLQLLITSTTKKGYRNLWSEIVGSDLSLTRE-----LYRGLTVNLV 75

Query: 89  RIFPYSAVQFVVYEACKKHFFHVDGS-KGREQLQNWQRLFSGALCGGCSVLATYPLDLVR 147
                  + F  Y   K +  + +   +  + L +W  L + A  G  + + T PL +++
Sbjct: 76  GNTIAWGLYFASYRVAKDYLINYNHRIRNDKDLSSWMYLSASASSGMLTTVLTNPLWVIK 135

Query: 148 TRL-SIQTANLTKLSKSRAHNISKPPGVWDLLCRTYKEEGGIKGLYRGVWPTSLGVVPYV 206
           TR+ S   ++LT +   R           DL+     +  G++GL++G+ P  +GV    
Sbjct: 136 TRMMSKANSDLTSMKVLR-----------DLI-----KNDGVQGLWKGLVPALVGV-SQG 178

Query: 207 ALNFAVYEQFKE--FMPEGTDNTLANFYKLSIGALSGGVAQTVTYPFDLLRRRFQVLAMG 264
           AL+F  Y+  K    +     + + N   +++ ++S  ++ +  YPF LL+   Q     
Sbjct: 179 ALHFTCYDTLKHKLVLKNRDSDEITNLETIAVTSVSKMLSTSAVYPFQLLKSNLQSFQAS 238

Query: 265 GNELGFRYKSVMDALITIGKTEGFRGYYKGLTANLFKVIPSTAVSWLVYE 314
            N+      S M     I    G  G+YKGL+ANL + +PST +++ +YE
Sbjct: 239 ENDFKLLPLSKM-----IYSRSGLLGFYKGLSANLLRSVPSTCITFCIYE 283

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 34/155 (21%), Positives = 66/155 (42%), Gaps = 18/155 (11%)

Query: 67  VRQVYREEGTPGLFRGNGLNCIRIFPYSAVQFVVYEACKKHFFHVDGSKGREQLQNWQRL 126
           +R + + +G  GL++G     + +    A+ F  Y+  K     V  ++  +++ N + +
Sbjct: 152 LRDLIKNDGVQGLWKGLVPALVGV-SQGALHFTCYDTLKHKL--VLKNRDSDEITNLETI 208

Query: 127 FSGALCGGCSVLATYPLDLVRTRL-SIQTANLTKLSKSRAHNISKPPGVWDLLCRTYKEE 185
              ++    S  A YP  L+++ L S Q +          ++    P     L +     
Sbjct: 209 AVTSVSKMLSTSAVYPFQLLKSNLQSFQASE---------NDFKLLP-----LSKMIYSR 254

Query: 186 GGIKGLYRGVWPTSLGVVPYVALNFAVYEQFKEFM 220
            G+ G Y+G+    L  VP   + F +YE FK F+
Sbjct: 255 SGLLGFYKGLSANLLRSVPSTCITFCIYENFKSFL 289

 Score = 33.1 bits (74), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 18/65 (27%), Positives = 33/65 (50%), Gaps = 7/65 (10%)

Query: 237 GALSGGVAQTVTYPFDLLRRRFQVLAMGGNELGFR--YKSVMDALITIGKTEGFRGYYKG 294
           G  +G V   + +P DL + R Q+L     + G+R  +  ++ + +++      R  Y+G
Sbjct: 15  GLTAGSVTTLIVHPLDLFKVRLQLLITSTTKKGYRNLWSEIVGSDLSLT-----RELYRG 69

Query: 295 LTANL 299
           LT NL
Sbjct: 70  LTVNL 74

>CAGL0G03135g 290834..291757 similar to sp|P53257 Saccharomyces
           cerevisiae YGR096w, hypothetical start
          Length = 307

 Score = 88.2 bits (217), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 85/302 (28%), Positives = 133/302 (44%), Gaps = 45/302 (14%)

Query: 36  SRTVVSPFERVKILLQVQNSTTAYNQGIVGAVRQVYREEGTPGLFRGNGLNCIRIFPYSA 95
           +RT ++P + VKI LQV    T +N+     +  + + EG  G ++GN    I    Y  
Sbjct: 29  ARTCIAPLDTVKIKLQV----TPHNKN-ANVLINILKREGIRGFWKGNVPGSIMYIIYGG 83

Query: 96  VQFVVYEACKKHFFHVDGSKGREQLQNWQRLFS---GALCGGCSVLATYPLDLVRTRLSI 152
            QF  Y             +G   L    +L+S   G+L G  S LA+YP D++RTR + 
Sbjct: 84  AQFGSYTYIGSFL------RGGLDLNISPQLYSCLVGSLAGMTSSLASYPFDVLRTRFAA 137

Query: 153 QT-ANLTKLSKSRAHNISKPPGVWDLLCRTYKEEGGIKGLYRGVWPTSLGVVPYVALNFA 211
            +   L KL               D +   +  EG + G + G   + + +    A+ F 
Sbjct: 138 NSQGQLIKLR--------------DEIMAIWSHEG-LMGFFSGCGSSMINIGLNTAIMFG 182

Query: 212 VYEQFKEFMPEGT--DNTLANFYKLS--IGALSGGVAQTVTYPFDLLRRRFQVLAMGGNE 267
           VYE  K F  E +   +    F  L+   G +SG  ++  T+P D +RRR Q+      E
Sbjct: 183 VYESIKIFTEERSKLSDRRDPFTLLNELAGPISGFTSKLATFPLDTVRRRIQIRNSPNEE 242

Query: 268 LGFR------YKS-----VMDALITIGKTEGFRGYYKGLTANLFKVIPSTAVSWLVYEVV 316
              R      YKS      +   I++ + EG    Y+G+T +L K +PSTA+S   YE+ 
Sbjct: 243 RHDREFTKDIYKSYKNRRFLGVGISMVQQEGPLSLYRGVTMSLIKSVPSTAISLWSYELF 302

Query: 317 CD 318
            +
Sbjct: 303 MN 304

 Score = 71.2 bits (173), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 52/206 (25%), Positives = 90/206 (43%), Gaps = 24/206 (11%)

Query: 112 DGSKGREQLQNWQRLFSGALCGGCSVLATYPLDLVRTRLSIQTANLTKLSKSRAHNISKP 171
           D  +  E++     L +G+L G  +     PLD V+ +L +   N               
Sbjct: 5   DHLRKDEEVSTTNSLVAGSLSGLFARTCIAPLDTVKIKLQVTPHNKNA------------ 52

Query: 172 PGVWDLLCRTYKEEGGIKGLYRGVWPTSLGVVPYVALNFAVYEQFKEFMPEGTD-NTLAN 230
               ++L    K EG I+G ++G  P S+  + Y    F  Y     F+  G D N    
Sbjct: 53  ----NVLINILKREG-IRGFWKGNVPGSIMYIIYGGAQFGSYTYIGSFLRGGLDLNISPQ 107

Query: 231 FYKLSIGALSGGVAQTVTYPFDLLRRRFQVLAMGGNELGFRYKSVMDALITIGKTEGFRG 290
            Y   +G+L+G  +   +YPFD+LR RF   + G      +   + D ++ I   EG  G
Sbjct: 108 LYSCLVGSLAGMTSSLASYPFDVLRTRFAANSQG------QLIKLRDEIMAIWSHEGLMG 161

Query: 291 YYKGLTANLFKVIPSTAVSWLVYEVV 316
           ++ G  +++  +  +TA+ + VYE +
Sbjct: 162 FFSGCGSSMINIGLNTAIMFGVYESI 187

>ACR260W [1307] [Homologous to ScYJL133W (MRS3) - SH; ScYKR052C
           (MRS4) - SH] complement(823895..824830) [936 bp, 311 aa]
          Length = 311

 Score = 87.8 bits (216), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 70/296 (23%), Positives = 125/296 (42%), Gaps = 35/296 (11%)

Query: 35  VSRTVVSPFERVKILLQVQNST-----TAYNQGIVGAVRQVYREEGTPGLFRGNGLNCIR 89
           +  +++ P + +K  +Q  ++T     T     ++  + ++   EG+  L++G     + 
Sbjct: 30  MEHSIMFPIDAIKTRMQAVSTTGSSAATRLPSNMLAQIAKISTTEGSLALWKGVQSVVLG 89

Query: 90  IFPYSAVQFVVYEACKKHFFHVDGSKGREQLQNWQRLFSGALCGGCSVLATYPLDLVRTR 149
             P  AV F  YE CK         + R+  Q  +   SG L    +     P D ++ R
Sbjct: 90  AGPAHAVYFATYEMCKSRLI---DPEDRQTHQPLKTALSGTLATVAADALMNPFDTIKQR 146

Query: 150 LSIQTAN-LTKLSKSRAHNISKPPGVWDLLCRTYKEEGGIKGLYRGVWPTSLGV-VPYVA 207
           L +  ++ +TK +                  R Y+ EG     Y   +PT++ + +P+ A
Sbjct: 147 LQLHPSDSMTKCA-----------------VRMYQREGIAAFFYS--YPTTIAMNIPFAA 187

Query: 208 LNFAVYEQ-FKEFMPEGTDNTLANFYKLSIGALSGGVAQTVTYPFDLLRRRFQVLAMGG- 265
           LNF +YE   K F P    N    +     G +SG     +T P D ++   Q+      
Sbjct: 188 LNFVIYESSTKIFNPSNNYNP---WIHCLCGGISGATCAAITTPLDCVKTVLQIRGADSV 244

Query: 266 -NELGFRYKSVMDALITIGKTEGFRGYYKGLTANLFKVIPSTAVSWLVYEVVCDLM 320
            ++L     +   A   I KT G+ G+++GL   +   +P+TA+SW  YE    L+
Sbjct: 245 QSQLFKEADTFRKAASAIHKTYGWSGFFRGLKPRIISNMPATAISWTSYEFAKHLL 300

 Score = 50.8 bits (120), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 44/191 (23%), Positives = 82/191 (42%), Gaps = 17/191 (8%)

Query: 125 RLFSGALCGGCSVLATYPLDLVRTRLSIQTANLTKLSKSRAHNISKPPGVWDLLCRTYKE 184
           +L +GA  G       +P+D ++TR+  Q  + T  S +       P  +   + +    
Sbjct: 20  QLAAGAFAGIMEHSIMFPIDAIKTRM--QAVSTTGSSAA----TRLPSNMLAQIAKISTT 73

Query: 185 EGGIKGLYRGVWPTSLGVVPYVALNFAVYEQFKEFMPEGTDNTLANFYKLSI-GALSGGV 243
           EG +  L++GV    LG  P  A+ FA YE  K  + +  D       K ++ G L+   
Sbjct: 74  EGSL-ALWKGVQSVVLGAGPAHAVYFATYEMCKSRLIDPEDRQTHQPLKTALSGTLATVA 132

Query: 244 AQTVTYPFDLLRRRFQVLAMGGNELGFRYKSVMDALITIGKTEGFRGYYKGLTANLFKVI 303
           A  +  PFD +++R Q+             S+    + + + EG   ++      +   I
Sbjct: 133 ADALMNPFDTIKQRLQL---------HPSDSMTKCAVRMYQREGIAAFFYSYPTTIAMNI 183

Query: 304 PSTAVSWLVYE 314
           P  A+++++YE
Sbjct: 184 PFAALNFVIYE 194

 Score = 47.8 bits (112), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 26/85 (30%), Positives = 45/85 (52%), Gaps = 1/85 (1%)

Query: 232 YKLSIGALSGGVAQTVTYPFDLLRRRFQVLAMGGNELGFRYKSVMDALIT-IGKTEGFRG 290
           Y+L+ GA +G +  ++ +P D ++ R Q ++  G+    R  S M A I  I  TEG   
Sbjct: 19  YQLAAGAFAGIMEHSIMFPIDAIKTRMQAVSTTGSSAATRLPSNMLAQIAKISTTEGSLA 78

Query: 291 YYKGLTANLFKVIPSTAVSWLVYEV 315
            +KG+ + +    P+ AV +  YE+
Sbjct: 79  LWKGVQSVVLGAGPAHAVYFATYEM 103

>Kwal_47.18216
          Length = 333

 Score = 87.8 bits (216), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 78/302 (25%), Positives = 128/302 (42%), Gaps = 36/302 (11%)

Query: 42  PFERVKILLQVQNSTTAYNQ---GIVGAVRQVYREEGTPGLFRGNGLNCIRIFPYSAVQF 98
           P + +K+ +Q+ +      Q   G +G  R +  +EG   L++G G   I I P  A++F
Sbjct: 30  PLDTIKVRMQIYSRAREQGQRARGFIGTARDISTQEGFLALYKGLGAVVIGIIPKMAIRF 89

Query: 99  VVYEACKKHFFHVDGSKGREQLQNWQRLFSGALCGGCS--VLATYPLDLVRTRLSIQTAN 156
             YE     FF    +  +  + +    F   +  G +  V+   P+++V+ RL  Q   
Sbjct: 90  TSYE-----FFRTLLADRQTGVVSTGNTFVAGVGAGITEAVMVVNPMEVVKIRLQAQHVR 144

Query: 157 LTKLSKSRA-----------------HNISKPPGVWDLLCRTY---KEEGGIKGLYRGVW 196
              L    A                  N++  P   + +   Y   KEEG  + LYRGV 
Sbjct: 145 YVPLKAQLAGSVTSSSATFSSATTATENVAATPKYRNAIQAAYVIVKEEGP-RALYRGVS 203

Query: 197 PTSLGVVPYVALNFAVYEQFKEFMPEGTDNTLANFYKLS-IGALSGGVAQTVTYPFDLLR 255
            T+         NF VY   K  + E     +   ++ S IG +SG +      P D ++
Sbjct: 204 LTAARQATNQGANFTVYSTLKSRLQEYHQTDMLPSWETSLIGLISGALGPFSNAPLDTIK 263

Query: 256 RRFQVLAMGGNELGF-RYKSVMDALITIGKTEGFRGYYKGLTANLFKVIPSTAVSWLVYE 314
            R Q       + G+ R  ++   LI   + EGFR  YKG+T  + +V P  AV++ VYE
Sbjct: 264 TRLQKDKSTSKDSGWSRILAIGRQLI---REEGFRALYKGITPRVMRVAPGQAVTFTVYE 320

Query: 315 VV 316
           ++
Sbjct: 321 LI 322

 Score = 59.3 bits (142), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 54/214 (25%), Positives = 78/214 (36%), Gaps = 50/214 (23%)

Query: 39  VVSPFERVKILLQVQN--------------------------------STTAYNQGIVGA 66
           VV+P E VKI LQ Q+                                +T  Y   I  A
Sbjct: 127 VVNPMEVVKIRLQAQHVRYVPLKAQLAGSVTSSSATFSSATTATENVAATPKYRNAIQAA 186

Query: 67  VRQVYREEGTPGLFRGNGLNCIRIFPYSAVQFVVYEACKKHFFHVDGSKGREQLQNWQRL 126
              + +EEG   L+RG  L   R        F VY   K        +   + L +W+  
Sbjct: 187 Y-VIVKEEGPRALYRGVSLTAARQATNQGANFTVYSTLKSRLQEYHQT---DMLPSWETS 242

Query: 127 FSGALCGGCSVLATYPLDLVRTRLSIQTANLTKLSKSRAHNISKPPGVWDLLC--RTYKE 184
             G + G     +  PLD ++TRL             +  + SK  G   +L   R    
Sbjct: 243 LIGLISGALGPFSNAPLDTIKTRL------------QKDKSTSKDSGWSRILAIGRQLIR 290

Query: 185 EGGIKGLYRGVWPTSLGVVPYVALNFAVYEQFKE 218
           E G + LY+G+ P  + V P  A+ F VYE  ++
Sbjct: 291 EEGFRALYKGITPRVMRVAPGQAVTFTVYELIRK 324

>CAGL0K11616g complement(1121834..1122796) highly similar to
           sp|P32332 Saccharomyces cerevisiae YKL120w, hypothetical
           start
          Length = 320

 Score = 87.4 bits (215), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 83/296 (28%), Positives = 125/296 (42%), Gaps = 21/296 (7%)

Query: 35  VSRTVVSPFERVKILLQVQNSTTAYNQGI----VGAVRQVYREEGTPGLFRGNGLNCIRI 90
           ++ TV +P E VKI +Q+Q    A NQ I      A+  V+R EG  GL +G     I  
Sbjct: 31  IAVTVTNPIEVVKIRMQLQGELMAANQRIYTNPFQAMGVVFRNEGIRGLQKGLVAAYIYQ 90

Query: 91  FPYSAVQFVVYE---ACKKHFFHVDGSKGREQLQNWQRLFSGALCGGCSVLATYPLDLVR 147
              +  +   YE   A     F+ D    + Q      +F+GA  G    +   PL LV+
Sbjct: 91  IALNGSRLGFYEPIRAVMNKTFYPDQESHKVQSVGIN-VFAGAASGIIGAVMGSPLFLVK 149

Query: 148 TRLSIQTANLTKLSKSRAHNISKPPGVWDLLCRTYKEEGGIKGLYRGVWPTSLGVVPYVA 207
           TRL    +N  K+ +   +      GVW+ L   Y  EG +KGL+RG+    L      +
Sbjct: 150 TRLQ-SYSNAIKIGEQTHYT-----GVWNGLKTIYMTEG-VKGLFRGIDAAILRTGAGSS 202

Query: 208 LNFAVYEQFKEFMPEGTDNTLANFYKLSIGALSGGVAQTVTYPFDLLRRRFQVLAMGGNE 267
           +   +Y   K F+             L+   +SG     V  P+D++  R        N+
Sbjct: 203 VQLPIYNTAKNFLLRNDIMEDGPSLHLTASTISGLGVAVVMNPWDVILTRIY------NQ 256

Query: 268 LGFRYKSVMDALITIGKTEGFRGYYKGLTANLFKVIPSTAVSWLVYEVVCDLMHVW 323
            G  YK  +D L+   K EG    YKG  A +F++ P T +     E    L+H +
Sbjct: 257 KGDLYKGPIDCLVKTVKIEGITALYKGFEAQVFRIGPHTILCLTFLEQTMKLVHAF 312

>Scas_645.9
          Length = 391

 Score = 88.2 bits (217), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 78/280 (27%), Positives = 132/280 (47%), Gaps = 29/280 (10%)

Query: 50  LQVQNSTTAYNQGIVGAVRQVYREEGTPGLFRGNGLNCIRIFPYSAVQFVVYEACKKHFF 109
           L  +NS+  +N G + A  ++++ EG   L+RG  +N +   P + V F  YE  +    
Sbjct: 120 LNCKNSSVRFN-GTLEAFNKIWKLEGITTLWRGISINLLMAIPANIVYFTGYEYLR---- 174

Query: 110 HVDGSKGREQLQNWQRLFSGALCGGCSVLATYPLDLVRTRLSIQTANLTKLSKSRAHNIS 169
             D S        +  L  GA+    +     PL+L++T+L     ++ ++SKS    + 
Sbjct: 175 --DNSPLATSSPTFNPLMCGAIARILAASTVAPLELLKTKLQ----SIPRVSKSTTSWMM 228

Query: 170 KPPGVWDLLCRTYKE---EGGIKGLYRGVWPTSLGVVPYVALNFAVYEQFKEFMPEGTDN 226
               V +LL  T +E    G    L++G+  T    VP+ A+ +  YE  K  +   T  
Sbjct: 229 ----VKELLKETRQEMRISGASNALFKGLEITLWRDVPFSAIYWGSYEFCKTHLWMDTSK 284

Query: 227 TLAN--FYKLSI--GALSGGVAQTVTYPFDLLRRRFQVLAMGGNELGF-------RYKSV 275
           + +N  F+  S   G++SG +A  VT+PFD+ + R+Q+  MG N+          + K++
Sbjct: 285 SHSNLTFFINSFIGGSISGTIAALVTHPFDVGKTRWQISFMGNNDKSVVKSPDIEQTKNM 344

Query: 276 MDALITIGKTEGFRGYYKGLTANLFKVIPSTAVSWLVYEV 315
              L  I K EG+   Y GL   + K+ PS A+    YE+
Sbjct: 345 FKFLRNIWKLEGWGALYTGLVPRMVKIAPSCAIMISSYEL 384

 Score = 47.4 bits (111), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 64/277 (23%), Positives = 103/277 (37%), Gaps = 68/277 (24%)

Query: 100 VYEACKKHFFHVDGSKGREQLQNWQRLFSGALCGGCSVLATYPLDLVRTRLSIQ------ 153
           + E+C +       +   + L   QR+ S +     + L   P+D+VR RL  Q      
Sbjct: 18  LLESCNRAM----STNATDGLTLHQRMLSASTGSLLTSLTLTPMDVVRIRLQQQELLPDC 73

Query: 154 --------------TANLTKLSKSRAHNIS---KPPGVWDLLC----------------- 179
                           +L+ +  SRA  IS   K    WD  C                 
Sbjct: 74  SCETIAVKDFLPKAKTDLSSVQVSRAATISTGNKNKVFWDNPCFQELNCKNSSVRFNGTL 133

Query: 180 ----RTYKEEGGIKGLYRGVWPTSLGVVPYVALNFAVYEQFKEFMPEGTDNTLANFYKLS 235
               + +K E GI  L+RG+    L  +P   + F  YE  ++  P  T +    F  L 
Sbjct: 134 EAFNKIWKLE-GITTLWRGISINLLMAIPANIVYFTGYEYLRDNSPLATSS--PTFNPLM 190

Query: 236 IGALSGGVAQTVTYPFDLLRRRFQVLA---------MGGNELGFRYKSVMDALITIGKTE 286
            GA++  +A +   P +LL+ + Q +          M   EL    K     +   G + 
Sbjct: 191 CGAIARILAASTVAPLELLKTKLQSIPRVSKSTTSWMMVKEL---LKETRQEMRISGASN 247

Query: 287 GFRGYYKGLTANLFKVIPSTAVSWLVYEVVCDLMHVW 323
                +KGL   L++ +P +A+ W  YE  C   H+W
Sbjct: 248 AL---FKGLEITLWRDVPFSAIYWGSYE-FCK-THLW 279

>Scas_582.7
          Length = 329

 Score = 86.7 bits (213), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 71/284 (25%), Positives = 126/284 (44%), Gaps = 38/284 (13%)

Query: 42  PFERVKILLQVQNS--TTAYNQGIVGAVRQVYREEGTPGLFRGNGLNCIRIFPYSAVQFV 99
           P + +K  +Q   +  T   +  I+  + ++   EG+  L++G     +   P  AV F 
Sbjct: 56  PIDALKTRIQSTTTKGTEQTSTSIIKQISKISTMEGSLALWKGVQSVILGAGPAHAVYFA 115

Query: 100 VYEACKKHFFHVDGSKGREQLQNWQRLFSGALCGGCSVLATYPLDLVRTRLSIQTANLTK 159
            YE  K H         RE  Q  +   SGA     S     P D ++ R+ I     + 
Sbjct: 116 TYEFTKAHLI---PDSQRETHQPIKVAVSGATATVASDFFMNPFDTIKQRMQI-----SD 167

Query: 160 LSKSRAHNISKPPGVWDLLCRTYKEEGGIKGLYRGVWPTSLGV-VPYVALNFAVYEQFKE 218
           L K + +N++K         + Y  EG +   Y   +PT++ + +P+ A NF +YE   +
Sbjct: 168 LKKEKVYNVAK---------KIYNLEG-LSAFYYS-YPTTIAMNIPFAAFNFMIYESASK 216

Query: 219 FMPEGTDNTLANFYKLS---IGALSGGVAQTVTYPFDLLRRRFQ-----VLAMGGNELGF 270
           F      N L ++  L     G +SG +A  VT P D ++   Q     V+++   +   
Sbjct: 217 FF-----NPLHHYNPLIHCLCGGISGAIAAAVTTPLDCIKTVIQIRGSSVVSLEVMKKAN 271

Query: 271 RYKSVMDALITIGKTEGFRGYYKGLTANLFKVIPSTAVSWLVYE 314
            +K    A++ +    G++G+++GL   +   +P+TA+SW  YE
Sbjct: 272 TFKKATSAILMV---YGWKGFWRGLQPRILANMPATAISWTAYE 312

 Score = 59.7 bits (143), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 44/185 (23%), Positives = 80/185 (43%), Gaps = 23/185 (12%)

Query: 40  VSPFERVKILLQVQNSTTAYNQGIVGAVRQVYREEGTPGLFRGNGLNCIRIFPYSAVQFV 99
           ++PF+ +K  +Q+ +      + +    +++Y  EG    +           P++A  F+
Sbjct: 153 MNPFDTIKQRMQISD---LKKEKVYNVAKKIYNLEGLSAFYYSYPTTIAMNIPFAAFNFM 209

Query: 100 VYEACKKHFFHVDGSKGREQLQNWQRLFSGALCGGCS----VLATYPLDLVRTRLSIQTA 155
           +YE+  K F           L ++  L    LCGG S       T PLD ++T + I+ +
Sbjct: 210 IYESASKFF---------NPLHHYNPLIH-CLCGGISGAIAAAVTTPLDCIKTVIQIRGS 259

Query: 156 NLTKLSKSRAHNISKPPGVWDLLCRTYKEEGGIKGLYRGVWPTSLGVVPYVALNFAVYEQ 215
           ++  L   +  N  K      L+        G KG +RG+ P  L  +P  A+++  YE 
Sbjct: 260 SVVSLEVMKKANTFKKATSAILMVY------GWKGFWRGLQPRILANMPATAISWTAYEC 313

Query: 216 FKEFM 220
            K F+
Sbjct: 314 AKHFL 318

 Score = 51.2 bits (121), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 47/193 (24%), Positives = 80/193 (41%), Gaps = 20/193 (10%)

Query: 124 QRLFSGALCGGCSVLATYPLDLVRTRL-SIQTANLTKLSKSRAHNISKPPGVWDLLCRTY 182
            +L +GA  G       +P+D ++TR+ S  T    + S S    ISK   +        
Sbjct: 38  HQLLAGAFAGIMEHSTMFPIDALKTRIQSTTTKGTEQTSTSIIKQISKISTM-------- 89

Query: 183 KEEGGIKGLYRGVWPTSLGVVPYVALNFAVYEQFKEFMPEGTDNTLANFYKLSIGALSGG 242
             EG +  L++GV    LG  P  A+ FA YE  K  +   +        K+++   +  
Sbjct: 90  --EGSL-ALWKGVQSVILGAGPAHAVYFATYEFTKAHLIPDSQRETHQPIKVAVSGATAT 146

Query: 243 VAQT-VTYPFDLLRRRFQVLAMGGNELGFRYKSVMDALITIGKTEGFRGYYKGLTANLFK 301
           VA      PFD +++R Q+  +       + + V +    I   EG   +Y      +  
Sbjct: 147 VASDFFMNPFDTIKQRMQISDL-------KKEKVYNVAKKIYNLEGLSAFYYSYPTTIAM 199

Query: 302 VIPSTAVSWLVYE 314
            IP  A ++++YE
Sbjct: 200 NIPFAAFNFMIYE 212

 Score = 29.6 bits (65), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 20/84 (23%), Positives = 38/84 (45%), Gaps = 13/84 (15%)

Query: 35  VSRTVVSPFERVKILLQVQNSTTAYNQGI---------VGAVRQVYREEGTPGLFRGNGL 85
           ++  V +P + +K ++Q++ S+    + +           A+  VY   G  G +RG   
Sbjct: 239 IAAAVTTPLDCIKTVIQIRGSSVVSLEVMKKANTFKKATSAILMVY---GWKGFWRGLQP 295

Query: 86  NCIRIFPYSAVQFVVYEACKKHFF 109
             +   P +A+ +  YE C KHF 
Sbjct: 296 RILANMPATAISWTAYE-CAKHFL 318

>YGR257C (MTM1) [2204] chr7 complement(1006210..1007310) Member of
           the mitochondrial carrier family (MCF) of membrane
           transporters [1101 bp, 366 aa]
          Length = 366

 Score = 87.0 bits (214), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 80/278 (28%), Positives = 129/278 (46%), Gaps = 27/278 (9%)

Query: 50  LQVQNSTTAYNQGIVGAVRQVYREEGTPGLFRGNGLNCIRIFPYSAVQFVVYEACKKHFF 109
           L  +NS+  +N G + A  ++   EG   L+RG  L  +   P + V F  YE  +    
Sbjct: 93  LHCKNSSLKFN-GTLEAFTKIASVEGITSLWRGISLTLLMAIPANMVYFSGYEYIR---- 147

Query: 110 HVDGSKGREQLQNWQRLFSGALCGGCSVLATYPLDLVRTRLSIQTANLTKLSKSRAHNIS 169
             D S           LF GA+    +  +  PL+LV+T+L     ++ + SKS    + 
Sbjct: 148 --DVSPIASTYPTLNPLFCGAIARVFAATSIAPLELVKTKLQ----SIPRSSKSTKTWMM 201

Query: 170 KPPGVWDLLCRTYKEE---GGIKGLYRGVWPTSLGVVPYVALNFAVYEQFKEFMP----- 221
               V DLL  T +E    G  + L++G+  T    VP+ A+ ++ YE  KE +      
Sbjct: 202 ----VKDLLNETRQEMKMVGPSRALFKGLEITLWRDVPFSAIYWSSYELCKERLWLDSTR 257

Query: 222 -EGTDNTLANFYK-LSIGALSGGVAQTVTYPFDLLRRRFQVLAMGGNEL--GFRYKSVMD 277
               D    +F    + G +SG +A   T+PFD+ + R+Q+  M  ++   G R +++  
Sbjct: 258 FASKDANWVHFINSFASGCISGMIAAICTHPFDVGKTRWQISMMNNSDPKGGNRSRNMFK 317

Query: 278 ALITIGKTEGFRGYYKGLTANLFKVIPSTAVSWLVYEV 315
            L TI +TEG    Y GL A + K+ PS A+    YE+
Sbjct: 318 FLETIWRTEGLAALYTGLAARVIKIRPSCAIMISSYEI 355

 Score = 30.0 bits (66), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 16/62 (25%), Positives = 29/62 (46%), Gaps = 2/62 (3%)

Query: 258 FQVLAMGGNELGFRYKSVMDALITIGKTEGFRGYYKGLTANLFKVIPSTAVSWLVYEVVC 317
           FQ L    + L  ++   ++A   I   EG    ++G++  L   IP+  V +  YE + 
Sbjct: 90  FQELHCKNSSL--KFNGTLEAFTKIASVEGITSLWRGISLTLLMAIPANMVYFSGYEYIR 147

Query: 318 DL 319
           D+
Sbjct: 148 DV 149

>Scas_379.2
          Length = 301

 Score = 85.5 bits (210), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 69/286 (24%), Positives = 124/286 (43%), Gaps = 34/286 (11%)

Query: 35  VSRTVVSPFERVKILLQVQNSTTAYNQGIVGAVRQVYREEGTPGLFRGNGLNCIRIFPYS 94
           +  +V+ P + +K   ++Q+++      ++  + ++   EG+  L++G     +   P  
Sbjct: 36  MEHSVMFPIDALKT--RIQSTSAKSTSNMLSQMAKISTAEGSLALWKGVQSVILGAGPAH 93

Query: 95  AVQFVVYEACKKHFFHVDGSKGREQLQNWQRLFSGALCGGCSVLATYPLDLVRTRLSIQT 154
           AV F  YE  KK+       K  +  Q  +   SG +    +     P D ++ R+ + T
Sbjct: 94  AVYFATYEYTKKYLI---DEKDMQTHQPLKTALSGTVATIAADALMNPFDTLKQRMQLNT 150

Query: 155 ANLTKLSKSRAHNISKPPGVWDLLCRTYKEEGGIKGLYRGVWPTSLGV-VPYVALNFAVY 213
            N T               VW++  + YK EG     Y   +PT+L + +P+ A NF +Y
Sbjct: 151 -NTT---------------VWNVTKQIYKNEGFSAFYYS--YPTTLAMNIPFAAFNFMIY 192

Query: 214 EQFKEFM-PEGTDNTLANFYKLSIGALSGGVAQTVTYPFDLLRRRFQVLAMGGNELGFRY 272
           E   +F  P    N L +      G LSG     +T P D ++   QV   G   +  + 
Sbjct: 193 ESATKFFNPTNDYNPLVHCLS---GGLSGATCAAITTPLDCIKTVLQV--RGSESVSLQV 247

Query: 273 ----KSVMDALITIGKTEGFRGYYKGLTANLFKVIPSTAVSWLVYE 314
                +   A   I +  G +G+++GL   +F  +P+TA++W  YE
Sbjct: 248 MKEANTFQKATKAIYQVHGAKGFWRGLQPRVFANMPATAIAWTAYE 293

 Score = 65.9 bits (159), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 43/186 (23%), Positives = 78/186 (41%), Gaps = 17/186 (9%)

Query: 35  VSRTVVSPFERVKILLQVQNSTTAYNQGIVGAVRQVYREEGTPGLFRGNGLNCIRIFPYS 94
            +  +++PF+ +K  +Q+  +TT +N       +Q+Y+ EG    +           P++
Sbjct: 131 AADALMNPFDTLKQRMQLNTNTTVWN-----VTKQIYKNEGFSAFYYSYPTTLAMNIPFA 185

Query: 95  AVQFVVYEACKKHFFHVDGSKGREQLQNWQRLFSGALCGGCSVLATYPLDLVRTRLSIQT 154
           A  F++YE+  K F                   SG L G      T PLD ++T L ++ 
Sbjct: 186 AFNFMIYESATKFF------NPTNDYNPLVHCLSGGLSGATCAAITTPLDCIKTVLQVRG 239

Query: 155 ANLTKLSKSRAHNISKPPGVWDLLCRTYKEEGGIKGLYRGVWPTSLGVVPYVALNFAVYE 214
                 S+S +  + K    +    +   +  G KG +RG+ P     +P  A+ +  YE
Sbjct: 240 ------SESVSLQVMKEANTFQKATKAIYQVHGAKGFWRGLQPRVFANMPATAIAWTAYE 293

Query: 215 QFKEFM 220
             K F+
Sbjct: 294 CAKHFL 299

 Score = 60.1 bits (144), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 50/192 (26%), Positives = 87/192 (45%), Gaps = 24/192 (12%)

Query: 124 QRLFSGALCGGCSVLATYPLDLVRTRLSIQTANLTKLSKSRAHNISKPPGVWDLLCRTYK 183
            +L +GA  G       +P+D ++TR+   +A      KS ++ +S+       + +   
Sbjct: 25  HQLLAGAFAGIMEHSVMFPIDALKTRIQSTSA------KSTSNMLSQ-------MAKIST 71

Query: 184 EEGGIKGLYRGVWPTSLGVVPYVALNFAVYEQFKEFMPEGTDNTLANFYKLSI-GALSGG 242
            EG +  L++GV    LG  P  A+ FA YE  K+++ +  D       K ++ G ++  
Sbjct: 72  AEGSL-ALWKGVQSVILGAGPAHAVYFATYEYTKKYLIDEKDMQTHQPLKTALSGTVATI 130

Query: 243 VAQTVTYPFDLLRRRFQVLAMGGNELGFRYKSVMDALITIGKTEGFRGYYKGLTANLFKV 302
            A  +  PFD L++R Q   +  N       +V +    I K EGF  +Y      L   
Sbjct: 131 AADALMNPFDTLKQRMQ---LNTN------TTVWNVTKQIYKNEGFSAFYYSYPTTLAMN 181

Query: 303 IPSTAVSWLVYE 314
           IP  A ++++YE
Sbjct: 182 IPFAAFNFMIYE 193

>Scas_691.4
          Length = 334

 Score = 85.9 bits (211), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 76/289 (26%), Positives = 120/289 (41%), Gaps = 24/289 (8%)

Query: 42  PFERVKILLQVQNSTTAYN-QGIVGAVRQVYREEGTPGLFRGNGLNCIRIFPYSAVQFVV 100
           P + +K+ +Q+   T      G +   R +Y  EG   L++G G   I I P  A++F  
Sbjct: 33  PLDTIKVRMQIAKRTEGMRPHGFITTGRNIYSHEGFLALYKGLGAVVIGIIPKMAIRFSS 92

Query: 101 YEACKKHFFHVDGSKGREQLQNWQRLFSGALCGGC-SVLATYPLDLVRTRLSIQTAN--- 156
           YE     + +    K    +       +G   G   +VL   P+++V+ RL  Q  N   
Sbjct: 93  YE----FYRNALTDKETRTITTGNTFLAGVGAGITEAVLVVNPMEVVKIRLQAQHLNDLI 148

Query: 157 ---LTKLSKSRAHNISKPPGVWDL-LCRTYKEEGGIKGLYRGVWPTSLGVVPYVALNFAV 212
                  +   A  ++KP     +    T  +E G   LYRGV  T+         NF V
Sbjct: 149 PQPAGVSAAGTAATVTKPKYANAIHAAYTIVKEEGAGALYRGVSLTAARQATNQGANFTV 208

Query: 213 YEQFKEFMPE-GTDNTLANFYKLSIGALSGGVAQTVTYPFDLLRRRFQVLAMGGNELGFR 271
           Y   K+++ +     +L ++    IG +SG +      P D ++ R Q       +    
Sbjct: 209 YSYLKDYLQKYHNRESLPSWETSCIGLISGAIGPFSNAPLDTIKTRLQ------KDKSIS 262

Query: 272 YKSVMDALITIG----KTEGFRGYYKGLTANLFKVIPSTAVSWLVYEVV 316
             S    +  IG    K EGFR  YKG+T  + +V P  AV++ VYE V
Sbjct: 263 SNSAWKKIYIIGTQLIKEEGFRALYKGITPRVMRVAPGQAVTFTVYEFV 311

 Score = 65.5 bits (158), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 57/203 (28%), Positives = 85/203 (41%), Gaps = 36/203 (17%)

Query: 39  VVSPFERVKILLQVQN----------------STTAYNQGIVGAVRQVY---REEGTPGL 79
           VV+P E VKI LQ Q+                + T        A+   Y   +EEG   L
Sbjct: 128 VVNPMEVVKIRLQAQHLNDLIPQPAGVSAAGTAATVTKPKYANAIHAAYTIVKEEGAGAL 187

Query: 80  FRGNGLNCIRIFPYSAVQFVVYEACKKHF--FHVDGSKGREQLQNWQRLFSGALCGGCSV 137
           +RG  L   R        F VY   K +   +H      RE L +W+    G + G    
Sbjct: 188 YRGVSLTAARQATNQGANFTVYSYLKDYLQKYH-----NRESLPSWETSCIGLISGAIGP 242

Query: 138 LATYPLDLVRTRLSIQTANLTKLSKSRAHNISKPPGVWDLLCRTYKEEGGIKGLYRGVWP 197
            +  PLD ++TRL        +  KS + N S    ++ +  +  KEE G + LY+G+ P
Sbjct: 243 FSNAPLDTIKTRL--------QKDKSISSN-SAWKKIYIIGTQLIKEE-GFRALYKGITP 292

Query: 198 TSLGVVPYVALNFAVYEQFKEFM 220
             + V P  A+ F VYE  ++ +
Sbjct: 293 RVMRVAPGQAVTFTVYEFVRKHL 315

 Score = 48.9 bits (115), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 47/217 (21%), Positives = 91/217 (41%), Gaps = 33/217 (15%)

Query: 126 LFSGALCGGCSVLATYPLDLVRTRLSIQTANLTKLSKSRAHNISKPPGVWDLLCRTYKEE 185
           L +G   G    L  +PLD ++ R+ I           R   + +P G        Y  E
Sbjct: 17  LVAGGTAGLFEALCCHPLDTIKVRMQIA---------KRTEGM-RPHGFITTGRNIYSHE 66

Query: 186 GGIKGLYRGVWPTSLGVVPYVALNFAVYEQFKEFMPEGTDNTL--ANFYKLSIGALSGGV 243
           G +  LY+G+    +G++P +A+ F+ YE ++  + +    T+   N +   +GA   G+
Sbjct: 67  GFL-ALYKGLGAVVIGIIPKMAIRFSSYEFYRNALTDKETRTITTGNTFLAGVGA---GI 122

Query: 244 AQTV--TYPFDLLRRRFQVLAM--------GGNELGF-------RYKSVMDALITIGKTE 286
            + V    P ++++ R Q   +        G +  G        +Y + + A  TI K E
Sbjct: 123 TEAVLVVNPMEVVKIRLQAQHLNDLIPQPAGVSAAGTAATVTKPKYANAIHAAYTIVKEE 182

Query: 287 GFRGYYKGLTANLFKVIPSTAVSWLVYEVVCDLMHVW 323
           G    Y+G++    +   +   ++ VY  + D +  +
Sbjct: 183 GAGALYRGVSLTAARQATNQGANFTVYSYLKDYLQKY 219

>AAR036W [222] [Homologous to ScYGR096W - SH]
           complement(406887..407840) [954 bp, 317 aa]
          Length = 317

 Score = 85.5 bits (210), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 84/304 (27%), Positives = 126/304 (41%), Gaps = 51/304 (16%)

Query: 35  VSRTVVSPFERVKILLQVQNSTTAYNQGIVGAVRQVYREEGTPGLFRGNGLNCIRIFPYS 94
           V+R+V +P + VKI  Q+Q ++     GI+   R V REEG   L++GN         Y 
Sbjct: 37  VARSVTAPMDTVKIRRQLQLASEHKYHGILHTFRTVAREEGVRALWKGNVPASAMYVLYG 96

Query: 95  AVQFVVYEACKKHFFHVDGSKGREQLQNWQRLFSGALCGGCSVLATYPLDLVRTRLSIQT 154
           ++QF  Y      + +   +      Q    L  GAL G  S L TYPLDL+RTRL    
Sbjct: 97  SLQFGTYA-----WLNTAAASAGLPPQA-HSLAVGALAGLVSSLLTYPLDLLRTRL---- 146

Query: 155 ANLTKLSKSRAHNIS---KPPGVWDLLCRTYKEEGGIKGLYR-GVWPTSLGVVPYVALNF 210
                ++   AH  S   +   +WD          G  G +R G W  +   +    L F
Sbjct: 147 -----VANRSAHFFSLRRQARVIWD--------TEGPAGFFRGGAWAIAATTL-TTGLIF 192

Query: 211 AVYEQFKEFMPEGTDNTLANFYKL-----SIGALSGGVAQTVTYPFDLLRRRFQVLAMG- 264
            +YE         T    A+ Y L     +    +G V++   +P D +RRR Q++    
Sbjct: 193 GIYE---------TCTIAADTYGLPWLAAAASPTAGLVSKAAVFPLDTVRRRLQIVDAKH 243

Query: 265 --------GNELGFRYKSVMDALITIGKTEGFRGYYKGLTANLFKVIPSTAVSWLVYEVV 316
                   G     R    +   + + + EG    YKGLT  L K  P+T ++  VY+  
Sbjct: 244 IPFFTRDPGAYSALRGTRFLGLAVHMVRAEGIASLYKGLTMALCKSTPTTVITLWVYQRC 303

Query: 317 CDLM 320
             L+
Sbjct: 304 LRLL 307

 Score = 35.4 bits (80), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 19/71 (26%), Positives = 37/71 (52%), Gaps = 8/71 (11%)

Query: 226 NTLANFYKLSIGALSGGVAQTVTYPFDL--LRRRFQVLAMGGNELGFRYKSVMDALITIG 283
             ++  + +  G++SG VA++VT P D   +RR+ Q+ +        +Y  ++    T+ 
Sbjct: 20  EAVSGLHAVVAGSVSGLVARSVTAPMDTVKIRRQLQLASE------HKYHGILHTFRTVA 73

Query: 284 KTEGFRGYYKG 294
           + EG R  +KG
Sbjct: 74  REEGVRALWKG 84

>KLLA0E15532g complement(1383230..1384210) similar to sp|P23500
           Saccharomyces cerevisiae YKR052c MRS4 RNA splicing
           protein and member of the mitochondrial carrier family
           (MCF), start by similarity
          Length = 326

 Score = 85.5 bits (210), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 63/257 (24%), Positives = 107/257 (41%), Gaps = 23/257 (8%)

Query: 67  VRQVYREEGTPGLFRGNGLNCIRIFPYSAVQFVVYEACKKHFFHVDGSKGREQLQNWQRL 126
           + ++   EG+  L+RG     +   P  AV F  YE CK+           + L+     
Sbjct: 82  ISRISSTEGSLALWRGVQSMVMGAGPAHAVYFATYEFCKEQLIDAKDFNTHQPLKT---A 138

Query: 127 FSGALCGGCSVLATYPLDLVRTRLSIQTANLTKLSKSRAHNISKPPGVWDLLCRTYKEEG 186
            SG      +     P D ++ RL +Q+              S    +W +    YK EG
Sbjct: 139 VSGVAATVAADALMNPFDTIKQRLQLQSK-------------SSDSSMWRMAFNIYKNEG 185

Query: 187 GIKGLYRGVWPTSLGV-VPYVALNFAVYEQFKEFMPEGTDNTLANFYKLSIGALSGGVAQ 245
            +   Y   +PT+L + +P+ ALNF +YE   +F      N    +     G ++G    
Sbjct: 186 PMAFFYS--YPTTLAMNIPFAALNFVIYESSTKFF--NPTNAYNPWIHCLCGGIAGATCA 241

Query: 246 TVTYPFDLLRRRFQVLAMGGNEL-GFRYKSVMD-ALITIGKTEGFRGYYKGLTANLFKVI 303
            VT P D ++   Q+       +  F+  +    A   I ++ G++G+++GL   +   I
Sbjct: 242 AVTTPLDCIKTVLQIRGSDTVHVESFKTANTFKKAAQAIWQSYGWKGFWRGLQPRVISNI 301

Query: 304 PSTAVSWLVYEVVCDLM 320
           P+TA+SW  YE    L+
Sbjct: 302 PATAISWTSYEFAKHLL 318

 Score = 49.7 bits (117), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 45/197 (22%), Positives = 81/197 (41%), Gaps = 14/197 (7%)

Query: 125 RLFSGALCGGCSVLATYPLDLVRTRLS------IQTANLTKLSKSRAHNISKPPGVWDLL 178
           +L +GA  G       +P+D ++TR+          +         A   +    +   +
Sbjct: 23  QLIAGAFAGIMEHSIMFPIDALKTRMQAVSEIKAAASASASGGAGAASGGAGAGTLLQQI 82

Query: 179 CRTYKEEGGIKGLYRGVWPTSLGVVPYVALNFAVYEQFKEFMPEGTDNTLANFYKLSIGA 238
            R    EG +  L+RGV    +G  P  A+ FA YE  KE + +  D       K ++  
Sbjct: 83  SRISSTEGSL-ALWRGVQSMVMGAGPAHAVYFATYEFCKEQLIDAKDFNTHQPLKTAVSG 141

Query: 239 LSGGV-AQTVTYPFDLLRRRFQVLAMGGNELGFRYKSVMDALITIGKTEGFRGYYKGLTA 297
           ++  V A  +  PFD +++R Q+ +   +   +R          I K EG   ++     
Sbjct: 142 VAATVAADALMNPFDTIKQRLQLQSKSSDSSMWRMA------FNIYKNEGPMAFFYSYPT 195

Query: 298 NLFKVIPSTAVSWLVYE 314
            L   IP  A+++++YE
Sbjct: 196 TLAMNIPFAALNFVIYE 212

 Score = 31.6 bits (70), Expect = 0.74,   Method: Compositional matrix adjust.
 Identities = 24/106 (22%), Positives = 45/106 (42%), Gaps = 13/106 (12%)

Query: 222 EGTDNTLANFYKLSIGALSGGVAQTVTYPFDLLRRRFQVLA-------------MGGNEL 268
           E   +T    Y+L  GA +G +  ++ +P D L+ R Q ++              G    
Sbjct: 12  EALPDTAPLSYQLIAGAFAGIMEHSIMFPIDALKTRMQAVSEIKAAASASASGGAGAASG 71

Query: 269 GFRYKSVMDALITIGKTEGFRGYYKGLTANLFKVIPSTAVSWLVYE 314
           G    +++  +  I  TEG    ++G+ + +    P+ AV +  YE
Sbjct: 72  GAGAGTLLQQISRISSTEGSLALWRGVQSMVMGAGPAHAVYFATYE 117

>Scas_640.25
          Length = 306

 Score = 84.7 bits (208), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 82/290 (28%), Positives = 128/290 (44%), Gaps = 30/290 (10%)

Query: 39  VVSPFERVKILLQVQNSTTA------YNQGIVGAVRQVYREEGTPGLFRGNGLNCIRIFP 92
           V+ P + VK  +Q+Q ST A      + +G++  + Q+ ++EG   +++G     +   P
Sbjct: 30  VMYPLDVVKTRMQLQVSTGAAGASATHYKGVIDCLSQIVKKEGPMHMYKGISSPMLMEAP 89

Query: 93  YSAVQFVVYEACKKHFFHVDGSKGREQLQNWQRLFSGALCGGCSVLATYPLDLVRTRLSI 152
             AV+F   +   K +  V G+K   QL     + SGA  G    L   P +LV+ RL  
Sbjct: 90  KRAVKFASNDEFIKLWKSVFGTK---QLTQQISVLSGASAGITEALVIVPFELVKIRL-- 144

Query: 153 QTANLTKLSKSRAHNISKPPGVWDLLCRTYKEEGGIKGLYRGVWPTSLGVVPYVALNFAV 212
           Q  N            SK  G  ++L    K++G +KGLY GV  T      + A  F V
Sbjct: 145 QDVN------------SKFKGPVEVLKHIIKQDG-LKGLYSGVESTVWRNAVWNAGYFGV 191

Query: 213 YEQFKEFMPEGTDNTLANFYKLSIGALSGGVAQTVTYPFDLLRRRFQVLAMGGNEL--GF 270
             Q +E +P            L  G + G        PFD+++ R Q     GNE+  G 
Sbjct: 192 IFQVRELLPVAKSKQEKTRNDLCAGFVGGTFGVMFNTPFDVVKSRIQ---SDGNEIINGV 248

Query: 271 R-YKSVMDALITIGKTEGFRGYYKGLTANLFKVIPSTAVSWLVYEVVCDL 319
           R Y     +++ I   EGFR  YKG    + ++ P  AV  +V+  V ++
Sbjct: 249 RKYNWTWPSVMKIYHEEGFRALYKGFVPKVLRLGPGGAVLLVVFTNVMNV 298

 Score = 65.5 bits (158), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 47/179 (26%), Positives = 88/179 (49%), Gaps = 16/179 (8%)

Query: 125 RLFSGALCGGCSVLATYPLDLVRTRLSIQTANLTKLSKSRAHNISKPPGVWDLLCRTYKE 184
           +  +GA+ G   ++  YPLD+V+TR+ +Q +     + +   + +   GV D L +  K+
Sbjct: 16  QFMAGAIAGISELMVMYPLDVVKTRMQLQVS-----TGAAGASATHYKGVIDCLSQIVKK 70

Query: 185 EGGIKGLYRGVWPTSLGVVPYVALNFAVYEQFKEFMPE--GTDNTLANFYKLSIGALSGG 242
           EG +  +Y+G+    L   P  A+ FA  ++F +      GT         LS GA +G 
Sbjct: 71  EGPMH-MYKGISSPMLMEAPKRAVKFASNDEFIKLWKSVFGTKQLTQQISVLS-GASAGI 128

Query: 243 VAQTVTYPFDLLRRRFQVLAMGGNELGFRYKSVMDALITIGKTEGFRGYYKGLTANLFK 301
               V  PF+L++ R Q       ++  ++K  ++ L  I K +G +G Y G+ + +++
Sbjct: 129 TEALVIVPFELVKIRLQ-------DVNSKFKGPVEVLKHIIKQDGLKGLYSGVESTVWR 180

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 26/81 (32%), Positives = 39/81 (48%), Gaps = 2/81 (2%)

Query: 232 YKLSIGALSGGVAQTVTYPFDLLRRRFQVLAMGG--NELGFRYKSVMDALITIGKTEGFR 289
           Y+   GA++G     V YP D+++ R Q+    G        YK V+D L  I K EG  
Sbjct: 15  YQFMAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGVIDCLSQIVKKEGPM 74

Query: 290 GYYKGLTANLFKVIPSTAVSW 310
             YKG+++ +    P  AV +
Sbjct: 75  HMYKGISSPMLMEAPKRAVKF 95

>Kwal_26.8669
          Length = 296

 Score = 82.4 bits (202), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 71/289 (24%), Positives = 124/289 (42%), Gaps = 29/289 (10%)

Query: 39  VVSPFERVKILLQVQNSTTAYNQ--GIVGAVRQVYREEGTPGLFRGNGLNCIRIFPYSAV 96
           V+ P + VK  +Q+Q S     Q  G+V  ++Q+  +EG   L++G     +   P  A 
Sbjct: 26  VMYPLDVVKTRMQLQVSGGLGPQYKGVVDCIKQIVAKEGASRLYKGISSPVLMEAPKRAT 85

Query: 97  QFVVYEACKKHFFHVDGSK-GREQLQNWQRLFSGALCGGCSVLATYPLDLVRTRLSIQTA 155
           +F    AC   F  +   + G E+L     + SGA  G C      P +LV+ RL   ++
Sbjct: 86  KF----ACNDEFQKIYKREFGVEKLTQSLSILSGASAGCCEAFVVVPFELVKIRLQDVSS 141

Query: 156 NLTKLSKSRAHNISKPPGVWDLLCRTYKEEGGIKGLYRGVWPTSLGVVPYVALNFAVYEQ 215
           +                G  D++ +   +EG +  +Y G+  T      + A  F +  Q
Sbjct: 142 SYK--------------GPIDVVRKIIAQEG-VLAMYNGLESTLWRHGVWNAGYFGIIFQ 186

Query: 216 FKEFMPEGTDNTLANFYKLSIGALSGGVAQTVTYPFDLLRRRFQ---VLAMGGNELGFRY 272
            +  +PE    +      L  G++ G +   ++ PFD+++ R Q   V+A G  +  + +
Sbjct: 187 VRALLPEAKSKSQQTRNDLIAGSIGGTIGSLMSTPFDVVKSRIQNTAVVAGGARKYNWSW 246

Query: 273 KSVMDALITIGKTEGFRGYYKGLTANLFKVIPSTAVSWLVYEVVCDLMH 321
            S+     TI K EGFR  YKG    + ++ P   +  +V+    D   
Sbjct: 247 PSIF----TIYKEEGFRALYKGFVPKVLRLGPGGGILLVVFTGCMDFFR 291

 Score = 57.4 bits (137), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 50/177 (28%), Positives = 81/177 (45%), Gaps = 22/177 (12%)

Query: 128 SGALCGGCSVLATYPLDLVRTRLSIQ-TANLTKLSKSRAHNISKPPGVWDLLCRTYKEEG 186
           +GA+ G   +L  YPLD+V+TR+ +Q +  L    K          GV D + +   +EG
Sbjct: 15  AGAVAGISEILVMYPLDVVKTRMQLQVSGGLGPQYK----------GVVDCIKQIVAKEG 64

Query: 187 GIKGLYRGVWPTSLGVVPYVALNFAVYEQFKEFMPE--GTDNTLANFYKLSIGALSGGVA 244
             + LY+G+    L   P  A  FA  ++F++      G +    +   LS GA +G   
Sbjct: 65  ASR-LYKGISSPVLMEAPKRATKFACNDEFQKIYKREFGVEKLTQSLSILS-GASAGCCE 122

Query: 245 QTVTYPFDLLRRRFQVLAMGGNELGFRYKSVMDALITIGKTEGFRGYYKGLTANLFK 301
             V  PF+L++ R Q       ++   YK  +D +  I   EG    Y GL + L++
Sbjct: 123 AFVVVPFELVKIRLQ-------DVSSSYKGPIDVVRKIIAQEGVLAMYNGLESTLWR 172

 Score = 47.8 bits (112), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 28/83 (33%), Positives = 44/83 (53%), Gaps = 2/83 (2%)

Query: 228 LANFYKLSIGALSGGVAQTVTYPFDLLRRRFQVLAMGGNELGFRYKSVMDALITIGKTEG 287
           L  FY+ + GA++G     V YP D+++ R Q+   GG  LG +YK V+D +  I   EG
Sbjct: 7   LPFFYQFAAGAVAGISEILVMYPLDVVKTRMQLQVSGG--LGPQYKGVVDCIKQIVAKEG 64

Query: 288 FRGYYKGLTANLFKVIPSTAVSW 310
               YKG+++ +    P  A  +
Sbjct: 65  ASRLYKGISSPVLMEAPKRATKF 87

>CAGL0M05225g 563163..564308 highly similar to sp|P38127
           Saccharomyces cerevisiae YBR192w RIM2 mitochondrial
           carrier protein, start by similarity
          Length = 381

 Score = 83.6 bits (205), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 75/272 (27%), Positives = 129/272 (47%), Gaps = 32/272 (11%)

Query: 64  VGAVRQVYREEGTPGLFRGNGLNCIRIFPYSAVQFVVYEACKKHFFHVDGSKGREQLQNW 123
           V  +  VYR+EG   LF+G G N + + P  ++ F  Y    K  +    + G+E    W
Sbjct: 124 VSIIGNVYRQEGFRSLFKGLGPNLVGVIPARSINFFTY-GTTKDIYSKAFNNGQE--APW 180

Query: 124 QRLFSGALCGGCSVLATYPLDLVRTRLSIQTANLTKLSKSRAHNISKPPGVWDLLCRTYK 183
             L + A  G  +  AT P+ +V+TR+ +  A  T+  K+           +D L    +
Sbjct: 181 IHLMAAATAGWATATATNPIWMVKTRVQLDKAGKTRTYKNS----------YDCLKSILR 230

Query: 184 EEGGIKGLYRGVWPTSLGVVPYVALNFAVYEQFKEFMPE--------------GTDNTLA 229
            E GI GLYRG+  + LG V  + L + +YEQ K  + +               T + + 
Sbjct: 231 NE-GIYGLYRGLSASYLGSVEGI-LQWLLYEQLKHLIKKRSIEKFGAHDESTMTTTDKIK 288

Query: 230 NFYKLSIGA-LSGGVAQTVTYPFDLLRRRFQVLAMGGNELGFRYKSVMDALITIGKTEGF 288
            + + S GA L+  +A  VTYP +++R R +   +   ++  +Y  ++ +   I K EG 
Sbjct: 289 QWCQRSGGAGLAKFMASIVTYPHEVVRTRLRQSPLENGKV--KYTGLVQSFRVIIKEEGL 346

Query: 289 RGYYKGLTANLFKVIPSTAVSWLVYEVVCDLM 320
              Y GLT +L + +P++ + +  +EVV  L+
Sbjct: 347 ASMYSGLTPHLMRTVPNSIIMFGTWEVVIKLL 378

 Score = 56.2 bits (134), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 56/201 (27%), Positives = 95/201 (47%), Gaps = 25/201 (12%)

Query: 138 LATYPLDLVRTRLSIQTANLTKLSKSRAH----NISKPPGV-------------WDLLCR 180
           + T P DLV+TRL  Q+     + KS+A     N ++P  V               ++  
Sbjct: 72  VVTCPFDLVKTRL--QSDIYQNMYKSQAEALMMNTTRPRIVNLTLQAATHFKETVSIIGN 129

Query: 181 TYKEEGGIKGLYRGVWPTSLGVVPYVALNFAVYEQFKEFMPEGTDN-TLANFYKLSIGAL 239
            Y++E G + L++G+ P  +GV+P  ++NF  Y   K+   +  +N   A +  L   A 
Sbjct: 130 VYRQE-GFRSLFKGLGPNLVGVIPARSINFFTYGTTKDIYSKAFNNGQEAPWIHLMAAAT 188

Query: 240 SGGVAQTVTYPFDLLRRRFQVLAMGGNELGFRYKSVMDALITIGKTEGFRGYYKGLTANL 299
           +G    T T P  +++ R Q+   G       YK+  D L +I + EG  G Y+GL+A+ 
Sbjct: 189 AGWATATATNPIWMVKTRVQLDKAGKTRT---YKNSYDCLKSILRNEGIYGLYRGLSASY 245

Query: 300 FKVIPSTAVSWLVYEVVCDLM 320
              +    + WL+YE +  L+
Sbjct: 246 LGSVEGI-LQWLLYEQLKHLI 265

 Score = 30.8 bits (68), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 20/75 (26%), Positives = 36/75 (48%), Gaps = 4/75 (5%)

Query: 35  VSRTVVSPFERVKILLQ---VQNSTTAYNQGIVGAVRQVYREEGTPGLFRGNGLNCIRIF 91
           ++  V  P E V+  L+   ++N    Y  G+V + R + +EEG   ++ G   + +R  
Sbjct: 303 MASIVTYPHEVVRTRLRQSPLENGKVKYT-GLVQSFRVIIKEEGLASMYSGLTPHLMRTV 361

Query: 92  PYSAVQFVVYEACKK 106
           P S + F  +E   K
Sbjct: 362 PNSIIMFGTWEVVIK 376

>Scas_662.12
          Length = 308

 Score = 82.4 bits (202), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 78/300 (26%), Positives = 131/300 (43%), Gaps = 45/300 (15%)

Query: 39  VVSPFERVKILLQVQNSTTA--YNQGIVGAVRQVY---REEGTPG--------LFRGNGL 85
           +V P + +K+ LQ+  +TT   + +G    + ++    ++ G+ G         +RG  +
Sbjct: 24  IVHPLDLIKVRLQLLATTTTQQHQKGYTYLINELINNSKKMGSQGPIYNLIKESYRGLPI 83

Query: 86  NCIRIFPYSAVQFVVYEACKKHFFHVDGSKGREQLQNWQR---LFSGALCGGCSVLATYP 142
           N +      ++ F +Y + K + F          L N      L SG + G  + L T P
Sbjct: 84  NLLGNAVAWSLYFTIYNSTKDYMFQ------NNYLHNNNTTIFLTSGLISGISTTLLTNP 137

Query: 143 LDLVRTRLSIQTANLTKLSKSRAHNISKPP---GVWDLLCRTYKEEGGIKGLYRGVWPTS 199
           L +++TR+         +S SR H  S      G   LL +      G K ++ G+ P+ 
Sbjct: 138 LWVIKTRI---------MSTSRHHKDSYKSIRHGFKSLLTKE-----GPKAIWMGLLPSL 183

Query: 200 LGVVPYVALNFAVYEQFK-----EFMPEGTDNTLANFYKLSIGALSGGVAQTVTYPFDLL 254
           LGV    A+ F +Y+  K            DN  AN   + I +LS  ++    YPF LL
Sbjct: 184 LGV-SQGAIYFMIYDNLKLHFNVNLNKSKKDNANANLKIVLISSLSKMLSVMSVYPFQLL 242

Query: 255 RRRFQVLAMGGNELGFRYKSVMDALITIGKTEGFRGYYKGLTANLFKVIPSTAVSWLVYE 314
           +   Q      N +       +  +  I +  G +G YKGL+ANL + IPST +++ +YE
Sbjct: 243 KSNLQTFRSVTNNIPQNDYHFITLIRKIYRDNGIKGLYKGLSANLLRAIPSTCITFCIYE 302

 Score = 59.7 bits (143), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 51/207 (24%), Positives = 96/207 (46%), Gaps = 18/207 (8%)

Query: 18  LKNDSNVAFXXXXXXXXVSRTVVS-PFERVKILLQVQNSTTAYNQGIVGAVRQVYR---- 72
           L N++   F        +S T+++ P   +K  +    ST+ +++    ++R  ++    
Sbjct: 112 LHNNNTTIFLTSGLISGISTTLLTNPLWVIKTRIM---STSRHHKDSYKSIRHGFKSLLT 168

Query: 73  EEGTPGLFRGNGLNCIRIFPYSAVQFVVYEACKKHF-FHVDGSKGREQLQNWQRLFSGAL 131
           +EG   ++ G  L  +      A+ F++Y+  K HF  +++ SK      N + +   +L
Sbjct: 169 KEGPKAIWMG-LLPSLLGVSQGAIYFMIYDNLKLHFNVNLNKSKKDNANANLKIVLISSL 227

Query: 132 CGGCSVLATYPLDLVRTRLSIQTANLTKLSKSRAHNISKPPGVWDLLCRTYKEEGGIKGL 191
               SV++ YP  L+++ L  QT       +S  +NI +    +  L R    + GIKGL
Sbjct: 228 SKMLSVMSVYPFQLLKSNL--QTF------RSVTNNIPQNDYHFITLIRKIYRDNGIKGL 279

Query: 192 YRGVWPTSLGVVPYVALNFAVYEQFKE 218
           Y+G+    L  +P   + F +YE FK 
Sbjct: 280 YKGLSANLLRAIPSTCITFCIYENFKS 306

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 47/201 (23%), Positives = 84/201 (41%), Gaps = 22/201 (10%)

Query: 124 QRLFSGALCGGCSVLATYPLDLVRTRLSIQTANLTKLSK-------SRAHNISKPPGVWD 176
           + + SG   G  + L  +PLDL++ RL +     T+  +       +   N SK  G   
Sbjct: 9   KEIISGLSAGSLTTLIVHPLDLIKVRLQLLATTTTQQHQKGYTYLINELINNSKKMGSQG 68

Query: 177 LLCRTYKEEGGIKGLYRGVWPTSLGVVPYVALNFAVYEQFKEFMPEGT---DNTLANFYK 233
            +    KE       YRG+    LG     +L F +Y   K++M +     +N    F  
Sbjct: 69  PIYNLIKES------YRGLPINLLGNAVAWSLYFTIYNSTKDYMFQNNYLHNNNTTIF-- 120

Query: 234 LSIGALSGGVAQTVTYPFDLLRRRFQVLAMGGNELGFRYKSVMDALITIGKTEGFRGYYK 293
           L+ G +SG     +T P  +++ R    +    +    YKS+     ++   EG +  + 
Sbjct: 121 LTSGLISGISTTLLTNPLWVIKTRIMSTSRHHKD---SYKSIRHGFKSLLTKEGPKAIWM 177

Query: 294 GLTANLFKVIPSTAVSWLVYE 314
           GL  +L  V    A+ +++Y+
Sbjct: 178 GLLPSLLGV-SQGAIYFMIYD 197

>AFR131C [3323] [Homologous to ScYGR257C - SH] (672999..674033)
           [1035 bp, 344 aa]
          Length = 344

 Score = 82.8 bits (203), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 75/272 (27%), Positives = 117/272 (43%), Gaps = 32/272 (11%)

Query: 61  QGIVGAVRQVYREEGTPGLFRGNGLNCIRIFPYSAVQFVVYEACKKHFFHVDGSKGREQL 120
           QG +  +R++ + EG P L+RG G+  +   P + V F  YEA +      D S    +L
Sbjct: 81  QGTLEGLRKIAQLEGLPTLWRGLGITLVMAVPANVVYFSGYEALR------DNSPLASRL 134

Query: 121 QNWQRLFSGALCGGCSVLATYPLDLVRTRLSIQTANLTKLSKSRAHNISKPPGVWDLLCR 180
                L  GA     +     PL+L+RTRL          S  RA +  +   +   L R
Sbjct: 135 PVANPLVCGAFARILAATTIAPLELLRTRLQ---------SVPRARDTERTIYLIGDLLR 185

Query: 181 TYKEE---GGIKGLYRGVWPTSLGVVPYVALNFAVYE----QF--KEFMPEGTDNTLANF 231
             + E    G + L++G+  T    VP+ A+ +  YE    QF  +        N     
Sbjct: 186 EMRHEVSVMGYRALFKGLEITLWRDVPFSAIYWGTYEFCKTQFWARHAATHNASNWDHFI 245

Query: 232 YKLSIGALSGGVAQTVTYPFDLLRRRFQVLAMGGNEL--GFRYKSVMDA------LITIG 283
              + G++ G VA  +T+PFD+ + R Q+      +L  G +     D+      L  I 
Sbjct: 246 GSFACGSMGGAVAALLTHPFDVGKTRMQIAIASPQQLTVGGKATKTDDSRGMFSFLNAIR 305

Query: 284 KTEGFRGYYKGLTANLFKVIPSTAVSWLVYEV 315
           K+EG R  Y GL   + K+ PS A+    YE+
Sbjct: 306 KSEGIRALYTGLLPRVMKIAPSCAIMISTYEL 337

 Score = 70.9 bits (172), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 52/196 (26%), Positives = 90/196 (45%), Gaps = 14/196 (7%)

Query: 35  VSRTVVSPFERVKILLQV--QNSTTAYNQGIVGAVRQVYREE----GTPGLFRGNGLNCI 88
           ++ T ++P E ++  LQ   +   T     ++G + +  R E    G   LF+G  +   
Sbjct: 149 LAATTIAPLELLRTRLQSVPRARDTERTIYLIGDLLREMRHEVSVMGYRALFKGLEITLW 208

Query: 89  RIFPYSAVQFVVYEACKKHFFHVDGSKGREQLQNWQRLFS----GALCGGCSVLATYPLD 144
           R  P+SA+ +  YE CK  F+    +       NW         G++ G  + L T+P D
Sbjct: 209 RDVPFSAIYWGTYEFCKTQFWARHAAT--HNASNWDHFIGSFACGSMGGAVAALLTHPFD 266

Query: 145 LVRTRLSIQTANLTKLS-KSRAHNISKPPGVWDLLCRTYKEEGGIKGLYRGVWPTSLGVV 203
           + +TR+ I  A+  +L+   +A       G++  L    K EG I+ LY G+ P  + + 
Sbjct: 267 VGKTRMQIAIASPQQLTVGGKATKTDDSRGMFSFLNAIRKSEG-IRALYTGLLPRVMKIA 325

Query: 204 PYVALNFAVYEQFKEF 219
           P  A+  + YE  K+F
Sbjct: 326 PSCAIMISTYELSKKF 341

>KLLA0F04697g complement(461126..462049) similar to sp|P40464
           Saccharomyces cerevisiae YIL134w FLX1 FAD carrier
           protein (MCF), mitochondrial, start by similarity
          Length = 307

 Score = 81.3 bits (199), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 82/301 (27%), Positives = 139/301 (46%), Gaps = 45/301 (14%)

Query: 35  VSRTVVSPFERVKILLQVQ----NSTTAYNQGIVGAVRQVYRE-EGTPGL----FRGNGL 85
           ++  V  P + +K+ LQ+       ++ YNQ     V+++ ++  GT  L    +RG G+
Sbjct: 25  ITTIVTHPLDLIKLRLQLAAIDLKPSSYYNQ-----VQRIIKDGSGTQQLLKEAYRGLGI 79

Query: 86  NCIRIFPYSAVQFVVYEACKKHFFHVDGSKGRE-------QLQNWQRLFSGALCGGCSVL 138
           N I       + F +Y   K   + +      +       ++ +   L S    G  + L
Sbjct: 80  NIIGNAVAWGLYFGLYRCSKDVVYSLSSEPALQNKFMNDRKMTSSMYLVSAGASGLATAL 139

Query: 139 ATYPLDLVRTRLSIQTANLTKLSKSRAHNISKPPGVWDLLCRTYKEEGGIKGLYRGVWPT 198
            T P+ +++TR+       TK S+           + + + R Y EEG +K  +RG+ P+
Sbjct: 140 LTNPMWVIKTRIMS-----TKSSQGYT-------SILNAITRIYTEEG-LKTFWRGLVPS 186

Query: 199 SLGVVPYVALNFAVYEQFK-EFMPEGTD---NTLANFYKLSIGALSGGVAQTVTYPFDLL 254
             GV    AL FA+Y+  K +++ +  D     L     + I +LS  ++ +  YP  LL
Sbjct: 187 LFGVTQ-GALYFAIYDTLKLKYLHDRNDIQERRLNAVETIGIISLSKMISVSSVYPLQLL 245

Query: 255 RRRFQVLAMGGNELGFRYKSVMDALI-TIGKTEGFRGYYKGLTANLFKVIPSTAVSWLVY 313
           +   Q      NE      S M++LI +I  T G  G+YKGL ANL + IPST +++ VY
Sbjct: 246 KTNLQTFRTEHNE-----NSKMNSLIRSIWHTNGIAGFYKGLFANLVRAIPSTCITFGVY 300

Query: 314 E 314
           E
Sbjct: 301 E 301

 Score = 57.0 bits (136), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 44/181 (24%), Positives = 77/181 (42%), Gaps = 14/181 (7%)

Query: 39  VVSPFERVKILLQVQNSTTAYNQGIVGAVRQVYREEGTPGLFRGNGLNCIRIFPYSAVQF 98
           + +P   +K  +    S+  Y   I+ A+ ++Y EEG    +RG   +   +    A+ F
Sbjct: 140 LTNPMWVIKTRIMSTKSSQGYT-SILNAITRIYTEEGLKTFWRGLVPSLFGV-TQGALYF 197

Query: 99  VVYEACKKHFFHVDGSKGREQLQNWQRLFSGALCGGCSVLATYPLDLVRTRLSIQTANLT 158
            +Y+  K  + H        +L   + +   +L    SV + YPL L++T L  QT    
Sbjct: 198 AIYDTLKLKYLHDRNDIQERRLNAVETIGIISLSKMISVSSVYPLQLLKTNL--QTFRTE 255

Query: 159 KLSKSRAHNISKPPGVWDLLCRTYKEEGGIKGLYRGVWPTSLGVVPYVALNFAVYEQFKE 218
               S+ ++          L R+     GI G Y+G++   +  +P   + F VYE FK 
Sbjct: 256 HNENSKMNS----------LIRSIWHTNGIAGFYKGLFANLVRAIPSTCITFGVYEHFKH 305

Query: 219 F 219
            
Sbjct: 306 I 306

 Score = 48.9 bits (115), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 47/197 (23%), Positives = 87/197 (44%), Gaps = 38/197 (19%)

Query: 124 QRLFSGALCGGCSVLATYPLDLVRTRLSIQTANLTKLSKSRAHNISKPPGVWDLLCRTYK 183
           + + SG   G  + + T+PLDL++ RL +   +L            KP   ++ + R  K
Sbjct: 14  KEIISGLTAGTITTIVTHPLDLIKLRLQLAAIDL------------KPSSYYNQVQRIIK 61

Query: 184 EEGG----IKGLYRGVWPTSLGVVPYVALNFAVYEQFKE--------------FMPEGTD 225
           +  G    +K  YRG+    +G      L F +Y   K+              FM +   
Sbjct: 62  DGSGTQQLLKEAYRGLGINIIGNAVAWGLYFGLYRCSKDVVYSLSSEPALQNKFMND--R 119

Query: 226 NTLANFYKLSIGALSGGVAQTVTYPFDLLRRRFQVLAMGGNELGFRYKSVMDALITIGKT 285
              ++ Y +S GA SG     +T P  +++ R  +++   ++    Y S+++A+  I   
Sbjct: 120 KMTSSMYLVSAGA-SGLATALLTNPMWVIKTR--IMSTKSSQ---GYTSILNAITRIYTE 173

Query: 286 EGFRGYYKGLTANLFKV 302
           EG + +++GL  +LF V
Sbjct: 174 EGLKTFWRGLVPSLFGV 190

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 21/78 (26%), Positives = 36/78 (46%), Gaps = 4/78 (5%)

Query: 35  VSRTVVSPFERVKILLQVQNSTTAYNQGIVGAVRQVYREEGTPGLFRGNGLNCIRIFPYS 94
           +S + V P + +K  LQ   +    N  +   +R ++   G  G ++G   N +R  P +
Sbjct: 234 ISVSSVYPLQLLKTNLQTFRTEHNENSKMNSLIRSIWHTNGIAGFYKGLFANLVRAIPST 293

Query: 95  AVQFVVYEACKKHFFHVD 112
            + F VYE    HF H+ 
Sbjct: 294 CITFGVYE----HFKHIS 307

>Scas_718.5
          Length = 324

 Score = 81.3 bits (199), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 74/293 (25%), Positives = 130/293 (44%), Gaps = 27/293 (9%)

Query: 35  VSRTVV-SPFERVKILLQVQNSTTAYNQGIVGAVRQVYREEGTPGLFRGNGLNCIRIFPY 93
           +S+ +V  PF+  K+ +Q    T+A + G +  +R++ + EG    ++G+ +  + +   
Sbjct: 51  ISQVIVGQPFDTTKVRMQ----TSAKSVGALDIIRKLVKNEGVWAFYKGSLIPIVGVGAC 106

Query: 94  SAVQFVVYEACKKHFFHVDGSKGREQ----LQNWQRLFSGALCGGCSVLATYPLDLVRTR 149
            +VQF V EA K+ F   + S+G +     LQ  Q    G   G  +     P++ VR R
Sbjct: 107 VSVQFGVNEAMKRFFREWNTSRGTQHRDGTLQLGQYYICGLTGGVVNSFLASPIEHVRIR 166

Query: 150 LSIQTANLTKLSKSRAHNISKPPGVWDLLCRTYKEEGGIKGLYRGVWPTSLGVVPYVALN 209
           L  QT N          N  +  G  D + +  KE    K L RG+ P  L     +   
Sbjct: 167 LQTQTGN---------GNEREFKGPLDCIRKLVKE----KSLMRGLRPMMLRAGHGLGCY 213

Query: 210 FAVYEQF-KEFMPEGTDNTLANFYKL-SIGALSGGVAQTVTYPFDLLRRRFQVLAMGGNE 267
           F  YE      + +G D +    +KL S G+LSG V     YP D+++   Q   +    
Sbjct: 214 FLTYEALIANEIKKGKDRSEIASWKLCSYGSLSGVVLWLAIYPLDVVKSMIQTDTLRNPR 273

Query: 268 LGFRYKSVMDALITIGKTEGFRGYYKGLTANLFKVIPSTAVSWLVYEVVCDLM 320
                K+V++ L    + +G   ++KG    + +  P    +++ +E+V  L+
Sbjct: 274 FKNSMKNVINHLY---REQGISAFFKGFAPTMLRAAPVNGATFVTFELVMRLL 323

>Sklu_2037.2 YIL134W, Contig c2037 1645-2577 reverse complement
          Length = 310

 Score = 79.3 bits (194), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 78/290 (26%), Positives = 131/290 (45%), Gaps = 30/290 (10%)

Query: 42  PFERVKILLQVQNSTTAYNQGIVGAVRQVYREEGTPGLFR----GNGLNCIRIFPYSAVQ 97
           P + VK+ LQ+  +T    QG    V+++ ++      FR    G G+N +       + 
Sbjct: 28  PLDLVKVRLQLL-ATNKKPQGYYDVVKRIVKDSKQHSFFRETYRGLGVNLLGNSVAWGLY 86

Query: 98  FVVYEACKKHFF---HVDGSKGREQLQNWQR------LFSGALCGGCSVLATYPLDLVRT 148
           F +Y A K   F   + D  +    + N +       L + A+ G  + + T P+ +++T
Sbjct: 87  FGLYRASKDWVFQWCNTDVKRFNNTMNNDKEMTSLMYLLAAAMSGVATSVLTNPIWVIKT 146

Query: 149 RLSIQTANLTKLSKSRAHNISKPPGVWDLLCRTYKEEGGIKGLYRGVWPTSLGVVPYVAL 208
           R+       T    SR++  +      D + + Y+ EG + G +RG+ P+  GV    A+
Sbjct: 147 RIMS-----TSFVDSRSYRSTV-----DGIKKLYRIEG-LAGFWRGLVPSLFGV-SQGAI 194

Query: 209 NFAVYEQFKE--FMPEGTDNT--LANFYKLSIGALSGGVAQTVTYPFDLLRRRFQVLAMG 264
            F VY+  K   F  +  D    L+N   ++I +LS  V+ T  YP  LL+   Q   + 
Sbjct: 195 YFTVYDTLKYHYFAAKHVDKKKKLSNLEYITITSLSKMVSVTAVYPLQLLKSNLQSFEVS 254

Query: 265 GNELGFRYKSVMDALITIGKTEGFRGYYKGLTANLFKVIPSTAVSWLVYE 314
                     V   + TI   +G  G YKGL ANL + +PST +++ VYE
Sbjct: 255 TVINPKTSHRVWKLITTIYVRDGVTGLYKGLLANLIRAVPSTCITFCVYE 304

 Score = 73.6 bits (179), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 45/160 (28%), Positives = 75/160 (46%), Gaps = 9/160 (5%)

Query: 61  QGIVGAVRQVYREEGTPGLFRGNGLNCIRIFPYSAVQFVVYEACKKHFFHVDGSKGREQL 120
           +  V  ++++YR EG  G +RG   +   +    A+ F VY+  K H+F       +++L
Sbjct: 160 RSTVDGIKKLYRIEGLAGFWRGLVPSLFGV-SQGAIYFTVYDTLKYHYFAAKHVDKKKKL 218

Query: 121 QNWQRLFSGALCGGCSVLATYPLDLVRTRLSIQTANLTKLSKSRAHNISKPPGVWDLLCR 180
            N + +   +L    SV A YPL L++       +NL     S   N      VW L+  
Sbjct: 219 SNLEYITITSLSKMVSVTAVYPLQLLK-------SNLQSFEVSTVINPKTSHRVWKLITT 271

Query: 181 TYKEEGGIKGLYRGVWPTSLGVVPYVALNFAVYEQFKEFM 220
            Y  +G + GLY+G+    +  VP   + F VYE F+ ++
Sbjct: 272 IYVRDG-VTGLYKGLLANLIRAVPSTCITFCVYENFRHWL 310

 Score = 59.7 bits (143), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 49/209 (23%), Positives = 90/209 (43%), Gaps = 32/209 (15%)

Query: 124 QRLFSGALCGGCSVLATYPLDLVRTRLSIQTANLTKLSKSRAHNISKPPGVWDLLCRTYK 183
           + + SG   G  + ++T+PLDLV+ RL +   N             KP G +D++ R  K
Sbjct: 10  KEMISGLTAGTITTVSTHPLDLVKVRLQLLATN------------KKPQGYYDVVKRIVK 57

Query: 184 E---EGGIKGLYRGVWPTSLGVVPYVALNFAVYEQFKEFMPE-------------GTDNT 227
           +       +  YRG+    LG      L F +Y   K+++ +               D  
Sbjct: 58  DSKQHSFFRETYRGLGVNLLGNSVAWGLYFGLYRASKDWVFQWCNTDVKRFNNTMNNDKE 117

Query: 228 LANFYKLSIGALSGGVAQTVTYPFDLLRRRFQVLAMGGNELGFRYKSVMDALITIGKTEG 287
           + +   L   A+SG     +T P  +++ R    +   +     Y+S +D +  + + EG
Sbjct: 118 MTSLMYLLAAAMSGVATSVLTNPIWVIKTRIMSTSFVDSR---SYRSTVDGIKKLYRIEG 174

Query: 288 FRGYYKGLTANLFKVIPSTAVSWLVYEVV 316
             G+++GL  +LF V    A+ + VY+ +
Sbjct: 175 LAGFWRGLVPSLFGV-SQGAIYFTVYDTL 202

>KLLA0D07073g 606857..607750 similar to sp|Q03028 Saccharomyces
           cerevisiae YPL134c ODC1, start by similarity
          Length = 297

 Score = 78.6 bits (192), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 71/286 (24%), Positives = 122/286 (42%), Gaps = 23/286 (8%)

Query: 39  VVSPFERVKILLQVQNSTTAYNQ--GIVGAVRQVYREEGTPGLFRGNGLNCIRIFPYSAV 96
           V+ P + VK ++Q+Q S  +  Q  G+   ++Q+  +EG   L++G     +   P  A 
Sbjct: 26  VMYPLDMVKTVMQLQVSGGSGPQYKGVFDCLKQIAAKEGPSRLYKGISSPILMEAPKRAT 85

Query: 97  QFVVYEACKKHFFHV-DGSKGREQLQNWQRLFSGALCGGCSVLATYPLDLVRTRLSIQTA 155
           +F    AC   F  +     G E+L     + SGA  G C      P +LV+ RL   ++
Sbjct: 86  KF----ACNDEFQKIYKDLFGAEKLTQPLSILSGASAGICESFVVVPFELVKIRLQDVSS 141

Query: 156 NLTKLSKSRAHNISKPPGVWDLLCRTYKEEGGIKGLYRGVWPTSLGVVPYVALNFAVYEQ 215
             T            P  V     +   E+ GI  +Y G+  T      + A  F +  Q
Sbjct: 142 KFTS-----------PIAV----VKNIVEKEGILAMYNGLESTMWRHGIWNAGYFGIIFQ 186

Query: 216 FKEFMPEGTDNTLANFYKLSIGALSGGVAQTVTYPFDLLRRRFQVLAMGGNELGFRYKSV 275
            +  +P+ +  +      L  G + G ++  ++ PFD+++ R Q  A+    +  +Y   
Sbjct: 187 VRALLPKASTKSEQTRNDLLAGTVGGTLSSLLSTPFDVVKSRVQNTAVIPG-VPRKYNWS 245

Query: 276 MDALITIGKTEGFRGYYKGLTANLFKVIPSTAVSWLVYEVVCDLMH 321
             AL TI K EGF+  YKG    + ++ P   +  +V+  V D   
Sbjct: 246 WPALATIYKEEGFKALYKGFVPKVLRLGPGGGILLVVFTGVMDFFR 291

 Score = 54.3 bits (129), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 45/179 (25%), Positives = 83/179 (46%), Gaps = 20/179 (11%)

Query: 125 RLFSGALCGGCSVLATYPLDLVRTRLSIQTANLTKLSKSRAHNISKPPGVWDLLCRTYKE 184
           +  +GA+ G   +L  YPLD+V+T + +Q +           +  +  GV+D L +   +
Sbjct: 12  QFMAGAVAGVSEILVMYPLDMVKTVMQLQVS---------GGSGPQYKGVFDCLKQIAAK 62

Query: 185 EGGIKGLYRGVWPTSLGVVPYVALNFAVYEQFKEFMPE--GTDNTLANFYKLSIGALSGG 242
           EG  + LY+G+    L   P  A  FA  ++F++   +  G +        LS GA +G 
Sbjct: 63  EGPSR-LYKGISSPILMEAPKRATKFACNDEFQKIYKDLFGAEKLTQPLSILS-GASAGI 120

Query: 243 VAQTVTYPFDLLRRRFQVLAMGGNELGFRYKSVMDALITIGKTEGFRGYYKGLTANLFK 301
               V  PF+L++ R Q       ++  ++ S +  +  I + EG    Y GL + +++
Sbjct: 121 CESFVVVPFELVKIRLQ-------DVSSKFTSPIAVVKNIVEKEGILAMYNGLESTMWR 172

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 25/79 (31%), Positives = 39/79 (49%), Gaps = 2/79 (2%)

Query: 232 YKLSIGALSGGVAQTVTYPFDLLRRRFQVLAMGGNELGFRYKSVMDALITIGKTEGFRGY 291
           Y+   GA++G     V YP D+++   Q+   GG+  G +YK V D L  I   EG    
Sbjct: 11  YQFMAGAVAGVSEILVMYPLDMVKTVMQLQVSGGS--GPQYKGVFDCLKQIAAKEGPSRL 68

Query: 292 YKGLTANLFKVIPSTAVSW 310
           YKG+++ +    P  A  +
Sbjct: 69  YKGISSPILMEAPKRATKF 87

>KLLA0F03212g 302915..303832 highly similar to sp|P33303
           Saccharomyces cerevisiae YJR095w ACR1 succinate-fumarate
           transporter, start by similarity
          Length = 305

 Score = 78.2 bits (191), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 68/280 (24%), Positives = 118/280 (42%), Gaps = 19/280 (6%)

Query: 42  PFERVKILLQVQNSTTAYNQGIVGAVR---QVYREEGTPGLFRGNGLNCIRIFPYSAVQF 98
           P + +K+ +Q+  +         G ++   ++YR EG    ++G G   I I P  A++F
Sbjct: 30  PLDTIKVRMQIYKNAVGSGVKAPGFIKTGGEIYRNEGFLAFYKGLGAVVIGITPKMAIRF 89

Query: 99  VVYEACKKHFFHVDGSKGREQLQNWQRLFSGALCGGCSVLATYPLDLVRTRLSIQTANLT 158
             YE  +      D   G+    N    F   +  G +        +   ++ +Q  +L 
Sbjct: 90  SSYEFYRTLL--ADKETGKVSTGN---TFIAGVGAGITEAVVVVNPMEVVKIRLQAQHLN 144

Query: 159 KLSKSRAHNISKPPGVWDLLCRTYKEEGGIKGLYRGVWPTSLGVVPYVALNFAVYEQFKE 218
            +  +  +  +         C T  +E G   LYRGV  T+         NF VY + KE
Sbjct: 145 PVEGAPKYKNAVQA------CYTIVKEEGFSALYRGVSLTAARQATNQGANFTVYSKLKE 198

Query: 219 FMPEGTDN--TLANFYKLSIGALSGGVAQTVTYPFDLLRRRFQVLAMGGNELGFRYKSVM 276
           F+ +G  N   L ++    IG +SG +      P D ++ R Q      N  G +  +++
Sbjct: 199 FL-QGYHNQEMLPSWETSLIGLISGAIGPFSNAPLDTIKTRLQKDKSTKNMSGLKRITII 257

Query: 277 DALITIGKTEGFRGYYKGLTANLFKVIPSTAVSWLVYEVV 316
              +   + EGFR  YKG+T  + +V P  AV++  YE +
Sbjct: 258 GKQLI--QEEGFRALYKGITPRVMRVAPGQAVTFTAYEFI 295

 Score = 52.8 bits (125), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 47/202 (23%), Positives = 91/202 (45%), Gaps = 16/202 (7%)

Query: 126 LFSGALCGGCSVLATYPLDLVRTRLSIQTANLTKLSKSRAHNISKPPGVWDLLCRTYKEE 185
           L +G   G    L  +PLD ++ R+ I         K+   +  K PG        Y+ E
Sbjct: 14  LIAGGGAGLMEGLCCHPLDTIKVRMQIY--------KNAVGSGVKAPGFIKTGGEIYRNE 65

Query: 186 GGIKGLYRGVWPTSLGVVPYVALNFAVYEQFKEFMPEGTDNTLA--NFYKLSIGALSGGV 243
           G +   Y+G+    +G+ P +A+ F+ YE ++  + +     ++  N +   +GA   G+
Sbjct: 66  GFL-AFYKGLGAVVIGITPKMAIRFSSYEFYRTLLADKETGKVSTGNTFIAGVGA---GI 121

Query: 244 --AQTVTYPFDLLRRRFQVLAMGGNELGFRYKSVMDALITIGKTEGFRGYYKGLTANLFK 301
             A  V  P ++++ R Q   +   E   +YK+ + A  TI K EGF   Y+G++    +
Sbjct: 122 TEAVVVVNPMEVVKIRLQAQHLNPVEGAPKYKNAVQACYTIVKEEGFSALYRGVSLTAAR 181

Query: 302 VIPSTAVSWLVYEVVCDLMHVW 323
              +   ++ VY  + + +  +
Sbjct: 182 QATNQGANFTVYSKLKEFLQGY 203

 Score = 34.3 bits (77), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 35/72 (48%), Gaps = 6/72 (8%)

Query: 41  SPFERVKILLQVQNSTTAYNQ----GIVGAVRQVYREEGTPGLFRGNGLNCIRIFPYSAV 96
           +P + +K  LQ   ST   +      I+G  +Q+ +EEG   L++G     +R+ P  AV
Sbjct: 230 APLDTIKTRLQKDKSTKNMSGLKRITIIG--KQLIQEEGFRALYKGITPRVMRVAPGQAV 287

Query: 97  QFVVYEACKKHF 108
            F  YE  +K  
Sbjct: 288 TFTAYEFIRKEL 299

>Sklu_2430.10 YKL120W, Contig c2430 18856-19830
          Length = 324

 Score = 78.6 bits (192), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 91/338 (26%), Positives = 145/338 (42%), Gaps = 40/338 (11%)

Query: 1   MSELAQVLPQPSYVKSILKNDSNV-AFXXXXXXXXVSRTVVSPFERVKILLQVQNSTTAY 59
           MS   + +    + KS  +  S V +F        ++ TV +PFE VK  +Q+Q   +A 
Sbjct: 1   MSSENKPVATKEHEKSAAQKVSKVGSFIAGGLAACIAVTVTNPFELVKTRMQLQGEMSAT 60

Query: 60  NQGI----VGAVRQVYREEGTPGLFRG--------NGLNCIRIFPYSAVQFVVYEACKKH 107
           NQ I      A+  +++ EG  GL RG         GLN  R+  Y  ++ V+     K 
Sbjct: 61  NQRIYRNPFQALGVIFKNEGVKGLQRGLVSAYVYQIGLNGSRLGFYEPIRTVL----NKT 116

Query: 108 FFHVDGSKGREQLQNWQ-RLFSGALCGGCSVLATYPLDLVRTRLSIQTANLTKLSKSRAH 166
           FF         +LQN    + +GA  G    +   PL LV+TR+    +N  K+ + + H
Sbjct: 117 FFP---ESDPHKLQNVAVNVTAGATSGIIGAIVGSPLFLVKTRMQ-SYSNAIKIGE-QTH 171

Query: 167 NISKPPGVWDLLCRTYKEEGGIKGLYRGVWPTSLGVVPYVALNFAVYEQFKEFMPEGT-- 224
             S   G    L   +K+EG + GL+RGV    L      ++   +Y   K F+ +    
Sbjct: 172 YTSMSNG----LATIFKKEG-VLGLFRGVDAAILRTGAGSSVQLPIYNTTKNFLLQNDIM 226

Query: 225 -DNTLANFYKLSIGALSGGVAQTVTYPFDLLRRRFQVLAMGGNELGFRYKSVMDALITIG 283
            + T  +    ++  L  G+   V  P+D++  R        N+ G  YK  +D +    
Sbjct: 227 KEGTALHLLSSTVTGLGVGI---VMNPWDVVLTRVY------NQKGNTYKGPIDCMFKTI 277

Query: 284 KTEGFRGYYKGLTANLFKVIPSTAVSWLVYEVVCDLMH 321
           K EG    YKG  A LF++ P T +     E    L++
Sbjct: 278 KIEGIGALYKGFGAQLFRIAPHTILCLTFMEQTMKLVY 315

>YKL120W (OAC1) [3145] chr11 (216990..217964) Mitochondrial
           oxaloacetate transporter, member of the mitochondrial
           carrier (MCF) family of membrane transporters [975 bp,
           324 aa]
          Length = 324

 Score = 77.8 bits (190), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 77/300 (25%), Positives = 126/300 (42%), Gaps = 33/300 (11%)

Query: 35  VSRTVVSPFERVKILLQVQNSTTA-----YNQGIVGAVRQVYREEGTPGLFRG------- 82
           ++ TV +P E +KI +Q+Q   +A     Y   I G +  +++ EG  GL +G       
Sbjct: 35  IAVTVTNPIELIKIRMQLQGEMSASAAKVYKNPIQG-MAVIFKNEGIKGLQKGLNAAYIY 93

Query: 83  -NGLNCIRIFPYSAVQFVVYEACKKHFFHVDGSKGREQLQNWQRLFSGALCGGCSVLATY 141
             GLN  R+  Y  ++     +     F  D    + Q      +FSGA  G    +   
Sbjct: 94  QIGLNGSRLGFYEPIR-----SSLNQLFFPDQEPHKVQ-SVGVNVFSGAASGIIGAVIGS 147

Query: 142 PLDLVRTRLSIQTANLTKLSKSRAHNISKPPGVWDLLCRTYKEEGGIKGLYRGVWPTSLG 201
           PL LV+TRL    +   K+ +   +      GVW+ L   +K EG +KGL+RG+    L 
Sbjct: 148 PLFLVKTRLQ-SYSEFIKIGEQTHYT-----GVWNGLVTIFKTEG-VKGLFRGIDAAILR 200

Query: 202 VVPYVALNFAVYEQFKEFMPEGTDNTLANFYKLSIGALSGGVAQTVTYPFDLLRRRFQVL 261
                ++   +Y   K  + +           L+   +SG     V  P+D++  R    
Sbjct: 201 TGAGSSVQLPIYNTAKNILVKNDLMKDGPALHLTASTISGLGVAVVMNPWDVILTRIY-- 258

Query: 262 AMGGNELGFRYKSVMDALITIGKTEGFRGYYKGLTANLFKVIPSTAVSWLVYEVVCDLMH 321
               N+ G  YK  +D L+   + EG    YKG  A +F++ P T +     E    L++
Sbjct: 259 ----NQKGDLYKGPIDCLVKTVRIEGVTALYKGFAAQVFRIAPHTIMCLTFMEQTMKLVY 314

>YBR192W (RIM2) [375] chr2 (607609..608742) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters, required for respiration [1134 bp, 377 aa]
          Length = 377

 Score = 77.8 bits (190), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 75/273 (27%), Positives = 126/273 (46%), Gaps = 32/273 (11%)

Query: 64  VGAVRQVYREEGTPGLFRGNGLNCIRIFPYSAVQFVVYEACKKHFFHVDGSKGREQLQNW 123
           +G +  VY++EG   LF+G G N + + P  ++ F  Y    K  +    + G+E     
Sbjct: 120 LGIIGNVYKQEGFRSLFKGLGPNLVGVIPARSINFFTY-GTTKDMYAKAFNNGQETPM-- 176

Query: 124 QRLFSGALCGGCSVLATYPLDLVRTRLSIQTANLTKLSKSRAHNISKPPGVWDLLCRTYK 183
             L + A  G  +  AT P+ L++TR+ +  A  T + + +          WD L    +
Sbjct: 177 IHLMAAATAGWATATATNPIWLIKTRVQLDKAGKTSVRQYK--------NSWDCLKSVIR 228

Query: 184 EEGGIKGLYRGVWPTSLGVVPYVALNFAVYEQFKE-----------FMPEGTDNTLANFY 232
            E G  GLY+G+  + LG V  + L + +YEQ K            +  EGT +T     
Sbjct: 229 NE-GFTGLYKGLSASYLGSVEGI-LQWLLYEQMKRLIKERSIEKFGYQAEGTKSTSEKVK 286

Query: 233 KLSIGALSGGVAQTV----TYPFDLLRRRFQVLAMGGNELGFR-YKSVMDALITIGKTEG 287
           +    + S G+A+ V    TYP +++R R   L     E G R Y  ++ +   I K EG
Sbjct: 287 EWCQRSGSAGLAKFVASIATYPHEVVRTR---LRQTPKENGKRKYTGLVQSFKVIIKEEG 343

Query: 288 FRGYYKGLTANLFKVIPSTAVSWLVYEVVCDLM 320
               Y GLT +L + +P++ + +  +E+V  L+
Sbjct: 344 LFSMYSGLTPHLMRTVPNSIIMFGTWEIVIRLL 376

 Score = 66.2 bits (160), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 61/201 (30%), Positives = 97/201 (48%), Gaps = 23/201 (11%)

Query: 138 LATYPLDLVRTRLSIQTANLTKLSKSRAHNISK----PPGV-------------WDLLCR 180
           + T P DLV+TRL  Q+    K  KS+A NISK    P  +               ++  
Sbjct: 68  VVTCPFDLVKTRL--QSDIFLKAYKSQAVNISKGSTRPKSINYVIQAGTHFKETLGIIGN 125

Query: 181 TYKEEGGIKGLYRGVWPTSLGVVPYVALNFAVYEQFKEFMPEGTDNTLAN-FYKLSIGAL 239
            YK+E G + L++G+ P  +GV+P  ++NF  Y   K+   +  +N        L   A 
Sbjct: 126 VYKQE-GFRSLFKGLGPNLVGVIPARSINFFTYGTTKDMYAKAFNNGQETPMIHLMAAAT 184

Query: 240 SGGVAQTVTYPFDLLRRRFQVLAMGGNELGFRYKSVMDALITIGKTEGFRGYYKGLTANL 299
           +G    T T P  L++ R Q+   G   +  +YK+  D L ++ + EGF G YKGL+A+ 
Sbjct: 185 AGWATATATNPIWLIKTRVQLDKAGKTSVR-QYKNSWDCLKSVIRNEGFTGLYKGLSASY 243

Query: 300 FKVIPSTAVSWLVYEVVCDLM 320
              +    + WL+YE +  L+
Sbjct: 244 LGSVEGI-LQWLLYEQMKRLI 263

>Kwal_26.7653
          Length = 325

 Score = 77.0 bits (188), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 81/295 (27%), Positives = 127/295 (43%), Gaps = 53/295 (17%)

Query: 35  VSRTVVSPFERVKILLQVQNSTTAYNQGI----VGAVRQVYREEGTPGLFRG-------- 82
           ++ TV +P E VK  +Q+Q   +A  Q I    + A++ +++ EG  GL +G        
Sbjct: 37  IAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQALKVIFKNEGIRGLQKGLSCAYIYQ 96

Query: 83  NGLNCIRIFPYSAVQFVV----YEACKKHFFHVDGSKGREQLQNWQ-RLFSGALCGGCSV 137
            GLN  R+  Y  ++ V+    Y A   H           ++QN    + SGA  G    
Sbjct: 97  IGLNGSRLGFYEPIRSVLNKTFYPAMDPH-----------KVQNVAVNVVSGATSGIIGA 145

Query: 138 LATYPLDLVRTRLSIQTANLTKLSKSRAHNISKPPGVWDLLCRTYKEEGGIKGLYRGVWP 197
           +   PL L++TR+    +N  ++ + + H  S    +W+ L   Y+ EG  KGLYRGV  
Sbjct: 146 IMGSPLFLIKTRMQ-SYSNAIQIGQ-QTHYTS----IWNGLSSIYRAEG-FKGLYRGVDA 198

Query: 198 TSLGVVPYVALNFAVYEQFKEF------MPEGTDNTLANFYKLSIGALSGGVAQTVTYPF 251
             L      ++   +Y   K F      M EGT         L    +SG     V  P+
Sbjct: 199 AILRTGAGSSVQLPIYNTAKHFLLKHDLMKEGTG------LHLVASTVSGFGVGVVMNPW 252

Query: 252 DLLRRRFQVLAMGGNELGFRYKSVMDALITIGKTEGFRGYYKGLTANLFKVIPST 306
           D++  R        N+ G  YK  +D  +   + EG    YKG  A +F++ P T
Sbjct: 253 DVILTRVY------NQKGNLYKGPLDCFVKTVRIEGIGALYKGFEAQIFRIAPHT 301

 Score = 52.8 bits (125), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 51/202 (25%), Positives = 87/202 (43%), Gaps = 29/202 (14%)

Query: 126 LFSGALCGGCSVLATYPLDLVRTRLSIQTANLTKLSKSRAHNISKPPGVWDLLCRTYKEE 185
             +G +    +V  T P++LV+TR+ +Q         + A  I K P     L   +K E
Sbjct: 28  FIAGGMAACIAVTVTNPIELVKTRMQLQGE-----MSADAQRIYKNP--MQALKVIFKNE 80

Query: 186 GGIKGLYRGVWPTSLGVVPYVALN---FAVYEQFKEFM---------PEGTDNTLANFYK 233
           G I+GL +G+   S   +  + LN      YE  +  +         P    N   N   
Sbjct: 81  G-IRGLQKGL---SCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPHKVQNVAVNVVS 136

Query: 234 LSIGALSGGVAQTVTYPFDLLRRRFQVLAMGGNELG--FRYKSVMDALITIGKTEGFRGY 291
              GA SG +   +  P  L++ R Q  +    ++G    Y S+ + L +I + EGF+G 
Sbjct: 137 ---GATSGIIGAIMGSPLFLIKTRMQSYS-NAIQIGQQTHYTSIWNGLSSIYRAEGFKGL 192

Query: 292 YKGLTANLFKVIPSTAVSWLVY 313
           Y+G+ A + +    ++V   +Y
Sbjct: 193 YRGVDAAILRTGAGSSVQLPIY 214

>Kwal_23.4354
          Length = 343

 Score = 77.0 bits (188), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 71/277 (25%), Positives = 123/277 (44%), Gaps = 26/277 (9%)

Query: 50  LQVQNSTTAYNQGIVGAVRQVYREEGTPGLFRGNGLNCIRIFPYSAVQFVVYEACKKHFF 109
           ++ + S   YN     A  ++ + EG   L+RG  +  +   P + V F+ YE+ +    
Sbjct: 75  VRCKTSPVRYN-STWDAFGKIAKIEGVQSLWRGLSITLLMAAPANMVYFIGYESLR---- 129

Query: 110 HVDGSKGREQLQNWQRLFSGALCGGCSVLATYPLDLVRTRLSIQTANLTKLSKSRAHNIS 169
             D S+ +++      L  GAL    +     PL+L RTRL  Q+   +    + A  I 
Sbjct: 130 --DKSRLQDKYPTLNPLMCGALARVLAATTVAPLELFRTRL--QSIPRSSPKSTTAMMIK 185

Query: 170 KPPGVWDLLCRTYKE--EGGIKGLYRGVWPTSLGVVPYVALNFAVYEQFKEFMPEGTDNT 227
                 DL+  +  E  + G K L+RG+  T    VP+ ++ +  YE +K  +   ++ +
Sbjct: 186 ------DLIKESRYEISKVGYKALFRGLEITLWRDVPFSSIYWGCYEFYKSNVSIDSEKS 239

Query: 228 LAN--------FYKLSIG-ALSGGVAQTVTYPFDLLRRRFQVLAMGGNELGFRYKSVMDA 278
           + N        F    +G +  G VA  +T+PFD+ + R Q+  +         K++   
Sbjct: 240 IVNSSNSNWNHFVNSFVGGSFGGAVAAVLTHPFDVGKTRMQITYLNSTLEKKPSKNMFKY 299

Query: 279 LITIGKTEGFRGYYKGLTANLFKVIPSTAVSWLVYEV 315
           L  + K+EG    Y GL   + K+ PS A+    YEV
Sbjct: 300 LNQMRKSEGLAALYTGLVPRVIKIAPSCAIMISTYEV 336

 Score = 54.7 bits (130), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 50/197 (25%), Positives = 85/197 (43%), Gaps = 21/197 (10%)

Query: 35  VSRTVVSPFERVKILLQV------QNSTTAYNQGIVGAVRQVYREEGTPGLFRGNGLNCI 88
           ++ T V+P E  +  LQ       +++T    + ++   R    + G   LFRG  +   
Sbjct: 153 LAATTVAPLELFRTRLQSIPRSSPKSTTAMMIKDLIKESRYEISKVGYKALFRGLEITLW 212

Query: 89  RIFPYSAVQFVVYEACKKHFFHVDGSKG--REQLQNWQRLFS----GALCGGCSVLATYP 142
           R  P+S++ +  YE  K +   +D  K        NW    +    G+  G  + + T+P
Sbjct: 213 RDVPFSSIYWGCYEFYKSNV-SIDSEKSIVNSSNSNWNHFVNSFVGGSFGGAVAAVLTHP 271

Query: 143 LDLVRTRLSIQTANLTKLSKSRAHNISKPPGVWDLLCRTYKEEGGIKGLYRGVWPTSLGV 202
            D+ +TR+ I   N T L K  + N+ K       L +  K EG +  LY G+ P  + +
Sbjct: 272 FDVGKTRMQITYLNST-LEKKPSKNMFK------YLNQMRKSEG-LAALYTGLVPRVIKI 323

Query: 203 VPYVALNFAVYEQFKEF 219
            P  A+  + YE  K  
Sbjct: 324 APSCAIMISTYEVCKRL 340

 Score = 49.3 bits (116), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 53/218 (24%), Positives = 90/218 (41%), Gaps = 31/218 (14%)

Query: 124 QRLFSGALCGGCSVLATYPLDLVRTRLSIQ----------TANLTKLSKSRA---HNI-- 168
           +RL S  +    + L   P+D+VR RL  Q           A LT  + S+     +I  
Sbjct: 13  ERLLSAVVGSLLTSLILTPMDVVRIRLQQQKMLPDCGCETDAGLTSRASSKGVFWQDICF 72

Query: 169 ------SKP---PGVWDLLCRTYKEEGGIKGLYRGVWPTSLGVVPYVALNFAVYEQFKEF 219
                 + P      WD   +  K E G++ L+RG+  T L   P   + F  YE  ++ 
Sbjct: 73  EDVRCKTSPVRYNSTWDAFGKIAKIE-GVQSLWRGLSITLLMAAPANMVYFIGYESLRD- 130

Query: 220 MPEGTDNTLANFYKLSIGALSGGVAQTVTYPFDLLRRRFQVLAMGG--NELGFRYKSVM- 276
                 +       L  GAL+  +A T   P +L R R Q +      +      K ++ 
Sbjct: 131 -KSRLQDKYPTLNPLMCGALARVLAATTVAPLELFRTRLQSIPRSSPKSTTAMMIKDLIK 189

Query: 277 DALITIGKTEGFRGYYKGLTANLFKVIPSTAVSWLVYE 314
           ++   I K  G++  ++GL   L++ +P +++ W  YE
Sbjct: 190 ESRYEISKV-GYKALFRGLEITLWRDVPFSSIYWGCYE 226

 Score = 34.7 bits (78), Expect = 0.089,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 25/48 (52%)

Query: 271 RYKSVMDALITIGKTEGFRGYYKGLTANLFKVIPSTAVSWLVYEVVCD 318
           RY S  DA   I K EG +  ++GL+  L    P+  V ++ YE + D
Sbjct: 83  RYNSTWDAFGKIAKIEGVQSLWRGLSITLLMAAPANMVYFIGYESLRD 130

 Score = 34.7 bits (78), Expect = 0.089,   Method: Compositional matrix adjust.
 Identities = 22/78 (28%), Positives = 37/78 (47%), Gaps = 4/78 (5%)

Query: 35  VSRTVVSPFERVKILLQVQ--NSTTAY--NQGIVGAVRQVYREEGTPGLFRGNGLNCIRI 90
           V+  +  PF+  K  +Q+   NST     ++ +   + Q+ + EG   L+ G     I+I
Sbjct: 264 VAAVLTHPFDVGKTRMQITYLNSTLEKKPSKNMFKYLNQMRKSEGLAALYTGLVPRVIKI 323

Query: 91  FPYSAVQFVVYEACKKHF 108
            P  A+    YE CK+ F
Sbjct: 324 APSCAIMISTYEVCKRLF 341

>AGR383W [4694] [Homologous to ScYDL119C - SH]
           complement(1436769..1437650) [882 bp, 293 aa]
          Length = 293

 Score = 75.9 bits (185), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 73/283 (25%), Positives = 119/283 (42%), Gaps = 41/283 (14%)

Query: 57  TAYNQGIVGAVRQVYRE-EGTPGLFRGNGLNCIRIFPYSAVQFVVYEACKKHFFHVDGSK 115
           T   Q    ++R V RE   T  L+RG   + +R    SA+   +    +        ++
Sbjct: 34  TRLQQAQASSLRSVLREVRTTRELWRGTLPSALRTSIGSALYLSLLNYSRSALARGSEAR 93

Query: 116 GRE----QLQNWQRLFSGALCGGCSVLATYPLDLVRTRLSIQTANLTKLSKSRAHNISKP 171
            R     +LQ++Q L +GAL      L T P+ +++ R          L+++  H     
Sbjct: 94  TRSSLLPRLQSYQNLLTGALSRAAVGLVTMPITVIKVRYESTLYAYNGLAEATRH----- 148

Query: 172 PGVWDLLCRTYKEEGGIKGLYRGVWPTSLGVVPYVALNFAVYEQFKEFMPEGTDNTLANF 231
             +W       + EG  +G ++G   T+L   PY  L   +YEQ KE +P     TL   
Sbjct: 149 --IW-------RSEGA-RGFFKGAAATTLRDAPYAGLYVLLYEQAKEMLPRALPATLLGA 198

Query: 232 Y---KLSIGA----------LSGGVAQTVTYPFDLLRRRFQVLAMGGNELGFRYKSVMDA 278
               KL+  A          LS  +A T+T PFD ++ R Q   +  + +GF     +  
Sbjct: 199 DESGKLTAPASAMVNGVSAFLSASLATTLTAPFDTIKTRMQ---LQSHPVGF-----VQT 250

Query: 279 LITIGKTEGFRGYYKGLTANLFKVIPSTAVSWLVYEVVCDLMH 321
           L  I   E  R  + GL+  L +   S  ++W +YE +  L+H
Sbjct: 251 LRHIVCEERARTLFDGLSLRLCRKAMSACIAWGIYEELLKLLH 293

 Score = 53.1 bits (126), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 53/203 (26%), Positives = 88/203 (43%), Gaps = 35/203 (17%)

Query: 126 LFSGALCGGCSVLATYPLDLVRTRLSIQTANLTKLSKSRAHNISKPPGVWDLLCRTYKEE 185
           L SG   G  SV A  PLDL++TRL  Q A  + L +S    +           RT +E 
Sbjct: 12  LVSGFFGGLASVCALQPLDLLKTRL--QQAQASSL-RSVLREV-----------RTTRE- 56

Query: 186 GGIKGLYRGVWPTSLGVVPYVALNFAVYEQFKEFMPEGTDN--------TLANFYKLSIG 237
                L+RG  P++L      AL  ++    +  +  G++          L ++  L  G
Sbjct: 57  -----LWRGTLPSALRTSIGSALYLSLLNYSRSALARGSEARTRSSLLPRLQSYQNLLTG 111

Query: 238 ALSGGVAQTVTYPFDLLRRRFQVLAMGGNELGFRYKSVMDALITIGKTEGFRGYYKGLTA 297
           ALS      VT P  +++ R++          + Y  + +A   I ++EG RG++KG  A
Sbjct: 112 ALSRAAVGLVTMPITVIKVRYESTL-------YAYNGLAEATRHIWRSEGARGFFKGAAA 164

Query: 298 NLFKVIPSTAVSWLVYEVVCDLM 320
              +  P   +  L+YE   +++
Sbjct: 165 TTLRDAPYAGLYVLLYEQAKEML 187

 Score = 44.7 bits (104), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 30/125 (24%), Positives = 53/125 (42%), Gaps = 12/125 (9%)

Query: 39  VVSPFERVKILLQVQNSTTAYNQGIVGAVRQVYREEGTPGLFRGNGLNCIRIFPYSAVQF 98
           V  P   +K+  + +++  AYN G+  A R ++R EG  G F+G     +R  PY+ +  
Sbjct: 121 VTMPITVIKV--RYESTLYAYN-GLAEATRHIWRSEGARGFFKGAAATTLRDAPYAGLYV 177

Query: 99  VVYEACKKHFFHV---------DGSKGREQLQNWQRLFSGALCGGCSVLATYPLDLVRTR 149
           ++YE  K+              +  K            S  L    +   T P D ++TR
Sbjct: 178 LLYEQAKEMLPRALPATLLGADESGKLTAPASAMVNGVSAFLSASLATTLTAPFDTIKTR 237

Query: 150 LSIQT 154
           + +Q+
Sbjct: 238 MQLQS 242

 Score = 31.2 bits (69), Expect = 0.94,   Method: Compositional matrix adjust.
 Identities = 19/72 (26%), Positives = 35/72 (48%), Gaps = 4/72 (5%)

Query: 35  VSRTVVSPFERVKILLQVQNSTTAYNQGIVGAVRQVYREEGTPGLFRGNGLNCIRIFPYS 94
           ++ T+ +PF+ +K  +Q+Q+    +  G V  +R +  EE    LF G  L   R    +
Sbjct: 223 LATTLTAPFDTIKTRMQLQS----HPVGFVQTLRHIVCEERARTLFDGLSLRLCRKAMSA 278

Query: 95  AVQFVVYEACKK 106
            + + +YE   K
Sbjct: 279 CIAWGIYEELLK 290

>KLLA0A09383g complement(818752..819852) similar to sp|P53320
           Saccharomyces cerevisiae YGR257c, start by similarity
          Length = 366

 Score = 76.3 bits (186), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 78/294 (26%), Positives = 127/294 (43%), Gaps = 36/294 (12%)

Query: 50  LQVQNSTTAYNQGIVGAVRQVYREEGTPGLFRGNGLNCIRIFPYSAVQFVVYEACKKHFF 109
           +Q +NS   +N     A  ++   EG   L+RG  +  +   P + V F  YE  + H  
Sbjct: 88  IQCKNSALRFN-STWEAFTKISEVEGLATLWRGLSITLLMAIPANVVYFSGYEMFRDH-- 144

Query: 110 HVDGSKGREQLQNWQRLFSGALCGGCSVLATYPLDLVRTRLSIQTANLTKLSKSRAHNIS 169
               S  R+   +   LF GA     +     PL+L++TRL         + +SR    +
Sbjct: 145 ----SPMRDSYPSLNPLFCGATARMVAATTVAPLELIKTRLQ-------SIPRSRKDTTT 193

Query: 170 KPPGVWDLLCRTYKE--EGGIKGLYRGVWPTSLGVVPYVALNFAVYEQFKE-FMPEGTDN 226
           +     DLL  T  E   GG K L++G+  T    VP+ A+ +  YE +K+ F  + ++ 
Sbjct: 194 QM-MFKDLLKETRNEIRSGGYKVLFKGLEITLWRDVPFSAIYWGSYEFYKKNFWIDFSEQ 252

Query: 227 TLA-------NFYKLSI--GALSGGVAQTVTYPFDLLRRRFQVLAMGGNELG-------- 269
            L        +F+  S   G++SG  A  +T+PFD+ + R Q+     N+          
Sbjct: 253 CLRWNLSPNWDFFINSFIGGSVSGSSAALLTHPFDVGKTRMQITMDIENKQRNTLVSPKK 312

Query: 270 -FRYKSVMDALITIGKTEGFRGYYKGLTANLFKVIPSTAVSWLVYEVVCDLMHV 322
               + +   L  I +TEG+   Y GL   + K+ PS A+    YE+   L  V
Sbjct: 313 RVSARGMFKFLYNIKQTEGYGALYTGLIPRVMKIAPSCAIMISTYELSKRLFAV 366

 Score = 56.6 bits (135), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 53/200 (26%), Positives = 88/200 (44%), Gaps = 17/200 (8%)

Query: 35  VSRTVVSPFERVKILLQV------QNSTTAYNQGIVGAVRQVYREEGTPGLFRGNGLNCI 88
           V+ T V+P E +K  LQ         +T    + ++   R   R  G   LF+G  +   
Sbjct: 166 VAATTVAPLELIKTRLQSIPRSRKDTTTQMMFKDLLKETRNEIRSGGYKVLFKGLEITLW 225

Query: 89  RIFPYSAVQFVVYEACKKHFFHVDGSKG--REQLQ-NWQ----RLFSGALCGGCSVLATY 141
           R  P+SA+ +  YE  KK+F+ +D S+   R  L  NW         G++ G  + L T+
Sbjct: 226 RDVPFSAIYWGSYEFYKKNFW-IDFSEQCLRWNLSPNWDFFINSFIGGSVSGSSAALLTH 284

Query: 142 PLDLVRTRLSIQTANLTKLSKSRAHNISKPPGVWDLLCRTY--KEEGGIKGLYRGVWPTS 199
           P D+ +TR+ I T ++    ++   +  K      +    Y  K+  G   LY G+ P  
Sbjct: 285 PFDVGKTRMQI-TMDIENKQRNTLVSPKKRVSARGMFKFLYNIKQTEGYGALYTGLIPRV 343

Query: 200 LGVVPYVALNFAVYEQFKEF 219
           + + P  A+  + YE  K  
Sbjct: 344 MKIAPSCAIMISTYELSKRL 363

>AGL311C [4001] [Homologous to ScYJR095W (SFC1) - SH]
           (119645..120733) [1089 bp, 362 aa]
          Length = 362

 Score = 75.9 bits (185), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 77/288 (26%), Positives = 122/288 (42%), Gaps = 36/288 (12%)

Query: 42  PFERVKILLQVQNSTTAYNQ--GIVGAVRQVYREEGTPGLFRGNGLNCIRIFPYSAVQFV 99
           P + +K+ +Q+        +  G +     +Y  EG    ++G G   I I P  A++F 
Sbjct: 77  PLDTIKVRMQIYRRANEGTKPPGFLRTGANIYSGEGLLAFYKGLGAVVIGIIPKMAIRFS 136

Query: 100 VYEACKKHFFHVDGSKGREQLQNWQRLFSGALCGGCS--VLATYPLDLVRTRLSIQTANL 157
            YE     F+    +  +  + +    F   +  G +  VL   P+++V+ RL  Q    
Sbjct: 137 SYE-----FYRTLLADRQTGVVSTGNTFLAGVGAGVTEAVLVVNPMEVVKIRLQAQ---- 187

Query: 158 TKLSKSRAHNISKPPGVWDLLCRTY---KEEGGIKGLYRGVWPTSLGVVPYVALNFAVYE 214
                   H  ++     + +   Y   KEEG I  LYRGV  T+         NF VY 
Sbjct: 188 ------HLHGAAEQQKYRNAIQAAYLIVKEEG-IGALYRGVSLTAARQATNQGANFTVYS 240

Query: 215 QFKEFMPE--GTDNTLANFYKLSIGALSGGVAQTVTYPFDLLRRRFQVLAMGGNELGFRY 272
           +  E + E  G+ N L ++    IG +SG +      P D ++ R Q       +   R 
Sbjct: 241 KLMERLQEYHGSQN-LPSWETSLIGLVSGAIGPFSNAPLDTIKTRLQ------KDKSTRN 293

Query: 273 KSVMDALITIGK----TEGFRGYYKGLTANLFKVIPSTAVSWLVYEVV 316
            S    + TIG+     EGFR  YKG+T  + +V P  AV++ VYE V
Sbjct: 294 LSNWVRITTIGRQLVQEEGFRALYKGITPRVMRVAPGQAVTFTVYEFV 341

 Score = 68.6 bits (166), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 53/182 (29%), Positives = 76/182 (41%), Gaps = 21/182 (11%)

Query: 39  VVSPFERVKILLQVQNSTTAYNQ----GIVGAVRQVYREEGTPGLFRGNGLNCIRIFPYS 94
           VV+P E VKI LQ Q+   A  Q      + A   + +EEG   L+RG  L   R     
Sbjct: 173 VVNPMEVVKIRLQAQHLHGAAEQQKYRNAIQAAYLIVKEEGIGALYRGVSLTAARQATNQ 232

Query: 95  AVQFVVYEACKKHFFHVDGSKGREQLQNWQRLFSGALCGGCSVLATYPLDLVRTRL--SI 152
              F VY    +      GS   + L +W+    G + G     +  PLD ++TRL    
Sbjct: 233 GANFTVYSKLMERLQEYHGS---QNLPSWETSLIGLVSGAIGPFSNAPLDTIKTRLQKDK 289

Query: 153 QTANLTKLSKSRAHNISKPPGVWDLLCRTYKEEGGIKGLYRGVWPTSLGVVPYVALNFAV 212
            T NL+   +               + R   +E G + LY+G+ P  + V P  A+ F V
Sbjct: 290 STRNLSNWVR------------ITTIGRQLVQEEGFRALYKGITPRVMRVAPGQAVTFTV 337

Query: 213 YE 214
           YE
Sbjct: 338 YE 339

 Score = 39.3 bits (90), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 23/70 (32%), Positives = 35/70 (50%), Gaps = 2/70 (2%)

Query: 41  SPFERVKILLQVQNSTTAYNQ--GIVGAVRQVYREEGTPGLFRGNGLNCIRIFPYSAVQF 98
           +P + +K  LQ   ST   +    I    RQ+ +EEG   L++G     +R+ P  AV F
Sbjct: 276 APLDTIKTRLQKDKSTRNLSNWVRITTIGRQLVQEEGFRALYKGITPRVMRVAPGQAVTF 335

Query: 99  VVYEACKKHF 108
            VYE  ++H 
Sbjct: 336 TVYEFVRRHL 345

>AER366W [2867] [Homologous to ScYIL134W (FLX1) - SH]
           complement(1314627..1315508) [882 bp, 293 aa]
          Length = 293

 Score = 75.1 bits (183), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 75/267 (28%), Positives = 129/267 (48%), Gaps = 36/267 (13%)

Query: 60  NQGIVGAVRQVY-REEGTPGLFRGNGLNCIRIFPYSAVQFVVYEACKKHFFHVDGSKGRE 118
           N    G +R ++ R++    L+RG G+N +      A+ F  Y   K       G++   
Sbjct: 45  NTTYTGLIRDIFERQQWGRELYRGLGVNLLGNSVAWALYFGCYRCAKDIALRHLGNESAT 104

Query: 119 QLQNWQRLFSGA--LCGGCSVLATY----PLDLVRTRLSIQTANLTKLSKSRAHNISKPP 172
            + + +RL + A  L  G S +AT     P+ +++TR+         ++ SRA       
Sbjct: 105 GIMD-RRLPAHAYMLAAGSSGIATAVLTNPIWVIKTRI---------MATSRA---GPYK 151

Query: 173 GVWDLLCRTYKEEGGIKGLYRGVWPTSLGVVPYVALNFAVYEQFK-EFMPEGTDNT---L 228
             +D + + Y+ EG +   +RGV P+ LGV    A+ FA+Y+  K  ++   TD     L
Sbjct: 152 STFDGVYKLYQTEG-VLAFWRGVVPSLLGV-SQGAIYFALYDTLKFHYLHSSTDKAERRL 209

Query: 229 ANFYKLSIGALSGGVAQTVTYPFDLLRRRFQVLAMGGNELGFRYKSVMDALI-TIGKTEG 287
           +    + I  +S  ++ T  YPF LL+ + Q          F   S +  L+ T+   EG
Sbjct: 210 SVSEIIGITCISKMISVTSVYPFQLLKSKLQ---------DFGAPSGITQLVQTVYSREG 260

Query: 288 FRGYYKGLTANLFKVIPSTAVSWLVYE 314
            RG+Y+GL+ANL + +P+T +++ VYE
Sbjct: 261 IRGFYRGLSANLLRAVPATCITFFVYE 287

 Score = 56.2 bits (134), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 43/179 (24%), Positives = 74/179 (41%), Gaps = 18/179 (10%)

Query: 39  VVSPFERVKILLQVQNSTTAYNQGIVGAVRQVYREEGTPGLFRGNGLNCIRIFPYSAVQF 98
           + +P   +K  +   +    Y     G V ++Y+ EG    +RG   + + +    A+ F
Sbjct: 130 LTNPIWVIKTRIMATSRAGPYKSTFDG-VYKLYQTEGVLAFWRGVVPSLLGV-SQGAIYF 187

Query: 99  VVYEACKKHFFHVDGSKGREQLQNWQRLFSGALCGGCSVLATYPLDLVRTRLSIQTANLT 158
            +Y+  K H+ H    K   +L   + +    +    SV + YP  L++++L        
Sbjct: 188 ALYDTLKFHYLHSSTDKAERRLSVSEIIGITCISKMISVTSVYPFQLLKSKL-------- 239

Query: 159 KLSKSRAHNISKPPGVWDLLCRTYKEEGGIKGLYRGVWPTSLGVVPYVALNFAVYEQFK 217
                   +   P G+  L+   Y  EG I+G YRG+    L  VP   + F VYE  K
Sbjct: 240 -------QDFGAPSGITQLVQTVYSREG-IRGFYRGLSANLLRAVPATCITFFVYENIK 290

 Score = 42.4 bits (98), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 26/71 (36%), Positives = 36/71 (50%), Gaps = 4/71 (5%)

Query: 35  VSRTVVSPFERVKILLQVQNSTTAYNQGIVGAVRQVYREEGTPGLFRGNGLNCIRIFPYS 94
           +S T V PF+ +K  LQ   + +    GI   V+ VY  EG  G +RG   N +R  P +
Sbjct: 224 ISVTSVYPFQLLKSKLQDFGAPS----GITQLVQTVYSREGIRGFYRGLSANLLRAVPAT 279

Query: 95  AVQFVVYEACK 105
            + F VYE  K
Sbjct: 280 CITFFVYENIK 290

 Score = 32.0 bits (71), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 54/197 (27%), Positives = 87/197 (44%), Gaps = 31/197 (15%)

Query: 118 EQLQNWQR-LFSGALCGGCSVLATYPLDLVRTRLSIQTANLTKLSKSRAHNISKPPGVWD 176
            +L + QR + SG   G  + +A++PLDL++ RL +   N       RA N +    + D
Sbjct: 3   HELTSLQREVISGLTAGTITTIASHPLDLLKLRLQLSAGN-------RA-NTTYTGLIRD 54

Query: 177 LLCRTYKEEGGIKGLYRGVWPTSLGVVPYVALNFAVYEQFKEFMPEGTDNTL-------- 228
           +  R   ++ G + LYRG+    LG     AL F  Y   K+       N          
Sbjct: 55  IFER---QQWG-RELYRGLGVNLLGNSVAWALYFGCYRCAKDIALRHLGNESATGIMDRR 110

Query: 229 --ANFYKLSIGALSGGVAQTV-TYPFDLLRRRFQVLAMGGNELGFRYKSVMDALITIGKT 285
             A+ Y L+ G  S G+A  V T P  +++ R    +  G      YKS  D +  + +T
Sbjct: 111 LPAHAYMLAAG--SSGIATAVLTNPIWVIKTRIMATSRAGP-----YKSTFDGVYKLYQT 163

Query: 286 EGFRGYYKGLTANLFKV 302
           EG   +++G+  +L  V
Sbjct: 164 EGVLAFWRGVVPSLLGV 180

>Kwal_55.21338
          Length = 323

 Score = 74.7 bits (182), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 63/274 (22%), Positives = 124/274 (45%), Gaps = 22/274 (8%)

Query: 35  VSRTVVSPFERVKILLQVQNSTTAYNQGIVGAVRQVYREEGTPGLFRGNGLNCIRIFPYS 94
           +S T+  P   V   LQ Q++       +   ++ +YR++G  G F G           +
Sbjct: 35  ISMTLTYPLIVVTTKLQTQDAK-GEKLSLADTIKDIYRKDGAMGFFAGLESALFGTTLSN 93

Query: 95  AVQFVVYEACKKHFFHVDGSKGREQLQNWQRLFSGALCGGCSVLATYPLDLVRTRLSIQT 154
            V +  YEA  +       ++  ++L   + +  G++ G  +  A  PL +  TR+++Q 
Sbjct: 94  FVYYYCYEASSRCVLR---ARHTQRLTTAESMLVGSIAGSLNATAANPLWVANTRMTVQK 150

Query: 155 ANLTKLSKSRAHNISKPPGVWDLLCRTYKEEGGIKGLYRGVWPTSLGVVPYVALNFAVYE 214
           ++   LS            ++D++    K+EG I GL++G+ P  + V+  + + + VYE
Sbjct: 151 SDRGTLST-----------IFDIV----KDEG-ISGLFKGLNPALILVINPI-IQYTVYE 193

Query: 215 QFKEF-MPEGTDNTLANFYKLSIGALSGGVAQTVTYPFDLLRRRFQVLAMGGNELGFRYK 273
           Q K + +      TL+  +   +GA+    A   TYP+  ++ R  +L    +      +
Sbjct: 194 QLKNWILSSRQTRTLSPSWAFILGAVGKLAATGSTYPYVTMKARMHLLGEHKSSTAAPPR 253

Query: 274 SVMDALITIGKTEGFRGYYKGLTANLFKVIPSTA 307
           S++  +  I K +G  G Y+G+   L + I + A
Sbjct: 254 SLLSLMAEIIKKDGILGLYRGIGIKLVQSILTAA 287

 Score = 35.8 bits (81), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 42/180 (23%), Positives = 70/180 (38%), Gaps = 23/180 (12%)

Query: 136 SVLATYPLDLVRTRLSIQTANLTKLSKSRAHNISKPPGVWDLLCRTYKEEGGIKGLYRGV 195
           S+  TYPL +V T+L  Q A   KLS +            D +   Y+++G + G + G+
Sbjct: 36  SMTLTYPLIVVTTKLQTQDAKGEKLSLA------------DTIKDIYRKDGAM-GFFAGL 82

Query: 196 WPTSLGVVPYVALNFAVYEQFKEFMPEGTDNT-LANFYKLSIGALSGGVAQTVTYPFDLL 254
                G      + +  YE     +        L     + +G+++G +  T   P  + 
Sbjct: 83  ESALFGTTLSNFVYYYCYEASSRCVLRARHTQRLTTAESMLVGSIAGSLNATAANPLWVA 142

Query: 255 RRRFQVLAMGGNELGFRYKSVMDALITIGKTEGFRGYYKGLTANLFKVIPSTAVSWLVYE 314
             R  V            +  +  +  I K EG  G +KGL   L  VI +  + + VYE
Sbjct: 143 NTRMTVQKSD--------RGTLSTIFDIVKDEGISGLFKGLNPALILVI-NPIIQYTVYE 193

>YOR222W (ODC2) [5014] chr15 (758330..759253) 2-Oxodicarboxylate
           transporter, specific for 2-oxoadipate and
           2-oxoglutarate, member of the mitochondrial carrier
           family (MCF) of membrane transporters [924 bp, 307 aa]
          Length = 307

 Score = 74.3 bits (181), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 68/290 (23%), Positives = 125/290 (43%), Gaps = 38/290 (13%)

Query: 38  TVVSPFERVKILLQVQNSTTA----------YNQGIVGAVRQVYREEGTPGLFRGNGLNC 87
           TV+ P + VK   Q++ +T            YN G++  ++++ ++EG   L+RG     
Sbjct: 28  TVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYN-GVIDCLKKIVKKEGFSRLYRGISSPM 86

Query: 88  IRIFPYSAVQFVV---YEACKKHFFHVDGSKGREQLQNWQRLFSGALCGGCSVLATYPLD 144
           +   P  A +F     Y+   K+ F+ + +  +  +       +GA  G        P +
Sbjct: 87  LMEAPKRATKFACNDQYQKIFKNLFNTNETTQKISIA------AGASAGMTEAAVIVPFE 140

Query: 145 LVRTRL-SIQTANLTKLSKSRAHNISKPPGVWDLLCRTYKEEGGIKGLYRGVWPTSLGVV 203
           L++ R+  ++++ L               G  D L +T K EG I GLY+G+  T     
Sbjct: 141 LIKIRMQDVKSSYL---------------GPMDCLKKTIKNEG-IMGLYKGIESTMWRNA 184

Query: 204 PYVALNFAVYEQFKEFMPEGTDNTLANFYKLSIGALSGGVAQTVTYPFDLLRRRFQVLAM 263
            +    F V  Q +  MP            L  GA+ G V   +  PFD+++ R Q +  
Sbjct: 185 LWNGGYFGVIYQVRNSMPVAKTKGQKTRNDLIAGAIGGTVGTMLNTPFDVVKSRIQSVDA 244

Query: 264 GGNELGFRYKSVMDALITIGKTEGFRGYYKGLTANLFKVIPSTAVSWLVY 313
             + +  +Y   + +L+ I + EGFR  YKG    + ++ P  ++  +V+
Sbjct: 245 VSSAVK-KYNWCLPSLLVIYREEGFRALYKGFVPKVCRLAPGGSLMLVVF 293

 Score = 72.0 bits (175), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 54/179 (30%), Positives = 85/179 (47%), Gaps = 13/179 (7%)

Query: 125 RLFSGALCGGCSVLATYPLDLVRTRLSIQTANLTKLSKSRAHNISKPPGVWDLLCRTYKE 184
           +  SGA+ G   +   YPLD+V+TR  ++    T  + +    + +  GV D L +  K+
Sbjct: 15  QFISGAVAGISELTVMYPLDVVKTRFQLEVT--TPTAAAVGKQVERYNGVIDCLKKIVKK 72

Query: 185 EGGIKGLYRGVWPTSLGVVPYVALNFAVYEQFKEFMPEGTDNTLANFYKLSI--GALSGG 242
           E G   LYRG+    L   P  A  FA  +Q+++   +   NT     K+SI  GA +G 
Sbjct: 73  E-GFSRLYRGISSPMLMEAPKRATKFACNDQYQKIF-KNLFNTNETTQKISIAAGASAGM 130

Query: 243 VAQTVTYPFDLLRRRFQVLAMGGNELGFRYKSVMDALITIGKTEGFRGYYKGLTANLFK 301
               V  PF+L++ R Q       ++   Y   MD L    K EG  G YKG+ + +++
Sbjct: 131 TEAAVIVPFELIKIRMQ-------DVKSSYLGPMDCLKKTIKNEGIMGLYKGIESTMWR 182

 Score = 45.1 bits (105), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 28/86 (32%), Positives = 44/86 (51%), Gaps = 7/86 (8%)

Query: 231 FYKLSIGALSGGVAQTVTYPFDLLRRRFQV------LAMGGNELGFRYKSVMDALITIGK 284
            Y+   GA++G    TV YP D+++ RFQ+       A  G ++  RY  V+D L  I K
Sbjct: 13  IYQFISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVE-RYNGVIDCLKKIVK 71

Query: 285 TEGFRGYYKGLTANLFKVIPSTAVSW 310
            EGF   Y+G+++ +    P  A  +
Sbjct: 72  KEGFSRLYRGISSPMLMEAPKRATKF 97

 Score = 28.5 bits (62), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 20/72 (27%), Positives = 35/72 (48%), Gaps = 5/72 (6%)

Query: 41  SPFERVKILLQ----VQNSTTAYNQGIVGAVRQVYREEGTPGLFRGNGLNCIRIFPYSAV 96
           +PF+ VK  +Q    V ++   YN   + ++  +YREEG   L++G      R+ P  ++
Sbjct: 230 TPFDVVKSRIQSVDAVSSAVKKYNW-CLPSLLVIYREEGFRALYKGFVPKVCRLAPGGSL 288

Query: 97  QFVVYEACKKHF 108
             VV+      F
Sbjct: 289 MLVVFTGMMNFF 300

>CAGL0K12210g 1193771..1194706 similar to sp|P38087 Saccharomyces
           cerevisiae YBR104w YMC2 or sp|P32331 Saccharomyces
           cerevisiae YPR058w YMC1, start by similarity
          Length = 311

 Score = 74.3 bits (181), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 74/290 (25%), Positives = 124/290 (42%), Gaps = 30/290 (10%)

Query: 39  VVSPFERVKILLQVQNSTTAYNQGIVGAVRQVYREEGTPGLFRGNGLNCIRIFPYSAVQF 98
           V  PF+  K+ LQ    T+    G++  V+ + R EG    ++G     + +    +VQF
Sbjct: 43  VGQPFDTTKVRLQ----TSKTKIGVIEVVQNLLRNEGALAFYKGMLTPLLGVGICVSVQF 98

Query: 99  VVYEACKKHFFHVDGSKGREQLQNWQRLFSGALCGGC-----SVLATYPLDLVRTRLSIQ 153
            V E+ K+ F   +  +   Q      L    LCG       S LA  P++ VR RL  Q
Sbjct: 99  GVNESMKRFFAAYNADRVDPQKHVPLPLHQYYLCGLTGGVVNSFLAA-PIEHVRIRLQTQ 157

Query: 154 TANLTKLSKSRAHNISKPPGVWDLLCRTYKEEGGIKGLYRGVWPTSLGVVPYVALNFAVY 213
           T+           N  +  G +D + +  K     K L RG+ PT +     +   FA Y
Sbjct: 158 TSQ---------GNERQFKGPFDCIKKLAKA----KALMRGLLPTMIRAGHGLGTYFAAY 204

Query: 214 EQF--KEFMPEGTDNTLANFYKLSIGALSGGVAQTVTYPFDLLRRRFQVLAMGGNELGFR 271
           E    KEF      N +  +   S GALSG +     YP D+++   Q  ++       +
Sbjct: 205 EALVVKEFEKGTPRNQIPAWKLCSFGALSGTILWLTVYPVDVVKSVLQTDSIENP----K 260

Query: 272 YK-SVMDALITIGKTEGFRGYYKGLTANLFKVIPSTAVSWLVYEVVCDLM 320
           YK S++ A   + K  G   ++KG    + +  P+ A +++ +E+   ++
Sbjct: 261 YKNSIIKATRALYKQHGIPAFFKGFVPTMIRAAPANAATFVSFEMTMRVL 310

 Score = 47.4 bits (111), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 48/182 (26%), Positives = 72/182 (39%), Gaps = 18/182 (9%)

Query: 35  VSRTVVSPFERVKILLQVQNSTTAYNQ--GIVGAVRQVYREEGTPGLFRGNGLNCIRIFP 92
           V+  + +P E V+I LQ Q S     Q  G    ++++ + +    L RG     IR   
Sbjct: 139 VNSFLAAPIEHVRIRLQTQTSQGNERQFKGPFDCIKKLAKAKA---LMRGLLPTMIRAGH 195

Query: 93  YSAVQFVVYEACKKHFFHVDGSKGREQLQNWQRLFSGALCGGCSVLATYPLDLVRTRLSI 152
                F  YEA     F  +    R Q+  W+    GAL G    L  YP+D+V++ L  
Sbjct: 196 GLGTYFAAYEALVVKEF--EKGTPRNQIPAWKLCSFGALSGTILWLTVYPVDVVKSVLQT 253

Query: 153 QTANLTKLSKSRAHNISKPPGVWDLLCRTYKEEGGIKGLYRGVWPTSLGVVPYVALNFAV 212
            +    K   S    I K         R   ++ GI   ++G  PT +   P  A  F  
Sbjct: 254 DSIENPKYKNS----IIK-------ATRALYKQHGIPAFFKGFVPTMIRAAPANAATFVS 302

Query: 213 YE 214
           +E
Sbjct: 303 FE 304

 Score = 41.6 bits (96), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 46/201 (22%), Positives = 82/201 (40%), Gaps = 29/201 (14%)

Query: 124 QRLFSGALCGGCSVLATYPLDLVRTRLSIQTANLTKLSKSRAHNISKPPGVWDLLCRTYK 183
           + +F+G + G   VL   P D  + RL  QT+  TK+            GV +++    +
Sbjct: 28  KDIFAGTMGGVAQVLVGQPFDTTKVRL--QTSK-TKI------------GVIEVVQNLLR 72

Query: 184 EEGGIKGLYRGVWPTSLGVVPYVALNFAVYEQFKEFMP-------EGTDNTLANFYKLSI 236
            EG +   Y+G+    LGV   V++ F V E  K F         +   +     ++  +
Sbjct: 73  NEGAL-AFYKGMLTPLLGVGICVSVQFGVNESMKRFFAAYNADRVDPQKHVPLPLHQYYL 131

Query: 237 GALSGGVAQT-VTYPFDLLRRRFQVLAMGGNELGFRYKSVMDALITIGKTEGFRGYYKGL 295
             L+GGV  + +  P + +R R Q     GNE   ++K   D +  + K    +   +GL
Sbjct: 132 CGLTGGVVNSFLAAPIEHVRIRLQTQTSQGNER--QFKGPFDCIKKLAKA---KALMRGL 186

Query: 296 TANLFKVIPSTAVSWLVYEVV 316
              + +        +  YE +
Sbjct: 187 LPTMIRAGHGLGTYFAAYEAL 207

>Scas_667.22
          Length = 306

 Score = 73.9 bits (180), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 74/286 (25%), Positives = 122/286 (42%), Gaps = 26/286 (9%)

Query: 39  VVSPFERVKILLQVQNSTTAYNQGIVGAVRQVYREEGTPGLFRGNGLNCIRIFPYSAVQF 98
           V  PF+  K+ LQ  ++ T   +     +R++ + EG  G ++G     I +    ++QF
Sbjct: 42  VGQPFDTTKVRLQTSSTPTTAME----VIRKLLKNEGPKGFYKGTLTPLIGVGACVSLQF 97

Query: 99  VVYEACKKHFFHVDGSKGREQLQNWQRLFSGALCGGC--SVLATYPLDLVRTRLSIQTAN 156
            V EA K+ FFH        Q+ +  + +   L GG   S LA+ P++ VR RL  QT +
Sbjct: 98  GVNEAMKR-FFHSRNPDSTSQILSLPQYYICGLTGGITNSFLAS-PIEHVRIRLQTQTGS 155

Query: 157 LTKLSKSRAHNISKPPGVWDLLCRTYKEEGGIKGLYRGVWPTSLGVVPYVALNFAVYEQF 216
              +            G  D + R  + +G   G  RG+ PT L         F VYE  
Sbjct: 156 GPNVEFK---------GPLDCI-RKLRAQG---GFMRGLTPTMLREGHGCGTYFLVYEAM 202

Query: 217 -KEFMPEGTDNTLANFYKLSI-GALSGGVAQTVTYPFDLLRRRFQVLAMGGNELGFRYKS 274
               + +G   T    +KL + GALSG     + YP D+++   Q   +   + G    S
Sbjct: 203 VANEINKGFKRTEVPAWKLCLFGALSGTTLWMMVYPLDVIKSVMQTDNLKSPKYGNSISS 262

Query: 275 VMDALITIGKTEGFRGYYKGLTANLFKVIPSTAVSWLVYEVVCDLM 320
           V   L   G   G   ++KG    + +  P+   ++  +E+   L+
Sbjct: 263 VAKTLYAKG---GLGAFFKGFGPTMLRAAPANGATFATFELAMRLL 305

 Score = 32.7 bits (73), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 27/98 (27%), Positives = 42/98 (42%), Gaps = 11/98 (11%)

Query: 225 DNTLANFYKLSIGALSGGVAQT-VTYPFDLLRRRFQVLAMGGNELGFRYKSVMDALITIG 283
           DN  A   K  +   +GG+AQ  V  PFD  + R Q  +           + M+ +  + 
Sbjct: 21  DN--ARVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSST--------PTTAMEVIRKLL 70

Query: 284 KTEGFRGYYKGLTANLFKVIPSTAVSWLVYEVVCDLMH 321
           K EG +G+YKG    L  V    ++ + V E +    H
Sbjct: 71  KNEGPKGFYKGTLTPLIGVGACVSLQFGVNEAMKRFFH 108

>Scas_632.9
          Length = 292

 Score = 73.9 bits (180), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 75/290 (25%), Positives = 128/290 (44%), Gaps = 46/290 (15%)

Query: 42  PFERVKILLQVQNS---TTAYNQGIVGAVRQVYREEGT-PGLFRGNGLNCIRIFPYSAVQ 97
           PF+ VK+ LQ Q S    T ++      ++  Y  EG   G F+G G         +A  
Sbjct: 37  PFDTVKVRLQTQGSHIFPTTWS-----CIKYTYHNEGVWRGFFQGIGSPLFGAALENATL 91

Query: 98  FVVYEACK---KHFFHVDGSKGREQLQNWQRLFSGALCGGCSVLATYPLDLVRTRLSIQT 154
           FV Y  C    + F +V        L N   L SGA  G C+     P++L++ +L  Q 
Sbjct: 92  FVSYNQCSNVLEKFTNVS------PLSN--ILLSGAFAGSCASFVLTPVELIKCKL--QV 141

Query: 155 ANLTKLSKSRAHNISKPPGVWDLLCRTYKEEGGIKGLYRGVWPT----SLGVVPYVALNF 210
           +NL    + +  +    P +  +L      E GI GL++G   T    SLG V +    F
Sbjct: 142 SNLQTAVEGQIKHTKIIPTLMYVL-----REKGILGLWQGQSSTFIRESLGGVAW----F 192

Query: 211 AVYEQFKEFMPEGTDNTLANFYKLSIGALSGGVAQTVT-YPFDLLRRRFQVLAMGGNELG 269
           A YE  K+ + +   +T    ++L +   S G+A   + +P D ++   Q          
Sbjct: 193 ATYEVMKQGLKDRRKDTENKTWELLVSGASAGLAFNASIFPADTVKSMMQT--------- 243

Query: 270 FRYKSVMDALITIGKTEGFRGYYKGLTANLFKVIPSTAVSWLVYEVVCDL 319
             + ++++A+  +  T G  G+Y+GL   L + +P+ A  + +YE +  +
Sbjct: 244 -EHITLINAVKKVLTTYGITGFYRGLGITLIRAVPANATVFYMYETLSKM 292

 Score = 56.2 bits (134), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 54/186 (29%), Positives = 81/186 (43%), Gaps = 26/186 (13%)

Query: 39  VVSPFERVKILLQVQNSTTAY-----NQGIVGAVRQVYREEGTPGLFRGNGLNCIRIFPY 93
           V++P E +K  LQV N  TA      +  I+  +  V RE+G  GL++G     IR    
Sbjct: 128 VLTPVELIKCKLQVSNLQTAVEGQIKHTKIIPTLMYVLREKGILGLWQGQSSTFIRESLG 187

Query: 94  SAVQFVVYEACKKHFFHVDGSKGREQLQNWQRLFSGALCGGCSVLATYPLDLVRTRLSIQ 153
               F  YE  K+     D  K  E  + W+ L SGA  G     + +P D V++ +  Q
Sbjct: 188 GVAWFATYEVMKQGL--KDRRKDTEN-KTWELLVSGASAGLAFNASIFPADTVKSMM--Q 242

Query: 154 TANLTKLSKSRAHNISKPPGVWDLLCRTYKEEGGIKGLYRGVWPTSLGVVPYVALNFAVY 213
           T ++T ++  +             +  TY    GI G YRG+  T +  VP  A  F +Y
Sbjct: 243 TEHITLINAVKK------------VLTTY----GITGFYRGLGITLIRAVPANATVFYMY 286

Query: 214 EQFKEF 219
           E   + 
Sbjct: 287 ETLSKM 292

 Score = 28.9 bits (63), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 18/86 (20%), Positives = 41/86 (47%), Gaps = 7/86 (8%)

Query: 237 GALSGGVAQTVTYPFDLLRRRFQVLAMGGNELGFRYKSVMDALITIGKTEG-FRGYYKGL 295
           G+++G   + + YPFD ++ R Q     G+ +   + +    +      EG +RG+++G+
Sbjct: 24  GSIAGAFGKIIEYPFDTVKVRLQT---QGSHI---FPTTWSCIKYTYHNEGVWRGFFQGI 77

Query: 296 TANLFKVIPSTAVSWLVYEVVCDLMH 321
            + LF      A  ++ Y    +++ 
Sbjct: 78  GSPLFGAALENATLFVSYNQCSNVLE 103

>Sklu_1275.1 , Contig c1275 314-1249
          Length = 311

 Score = 73.2 bits (178), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 68/284 (23%), Positives = 123/284 (43%), Gaps = 27/284 (9%)

Query: 42  PFERVKILLQVQNSTTAYNQGIVGAVRQVYREEGTPGLFRGNGLNCIRIFPYSAVQFVVY 101
           PF+  K+ +Q    T++ +   +  ++ + + EG    ++G  +  I +    + QF V 
Sbjct: 43  PFDITKVRMQ----TSSGSPTAIEVIKNLVKNEGLLAFYKGTLVPLIGVGACVSCQFGVN 98

Query: 102 EACKKHFFHVDGSKGREQLQNWQRLFSGALCGGCSVLATYPLDLVRTRLSIQTANLTKLS 161
           EA K++F  V+G K  + L   Q    G + G  +     P++ VR RL +QT  L K  
Sbjct: 99  EAMKRYFLRVNGYKD-QHLSLLQYYTCGFVSGSANAFLATPIEHVRIRLQLQTKALAK-- 155

Query: 162 KSRAHNISKPPGVWDLLCRTYKEEGGIKGLYRGVWPTSLGVVPYVALNFAVYEQFKEFMP 221
                  ++  G  D + +  K++  ++G    +  TS G   Y    F  YE     M 
Sbjct: 156 -------AEYRGSLDCMKKLLKQKALMRGFTATLMRTSHGFGVY----FLTYEAL--IMN 202

Query: 222 EGTDNTLANF---YKLSI-GALSGGVAQTVTYPFDLLRRRFQVLAMGGNELGFRYKSVMD 277
           +  +  L      +K+ + GA SG     +TYPFD+++   Q   +     G   K+V  
Sbjct: 203 QNKNGVLRKDIPPWKVCVFGAFSGAFFWAMTYPFDVVKSIMQADRLVSPVHG---KNVFQ 259

Query: 278 ALITIGKTEGFRGYYKGLTANLFKVIPSTAVSWLVYEVVCDLMH 321
              +I  T G+  + KG    + + +P    ++  +EV   L+ 
Sbjct: 260 VAKSIHATRGWGAFVKGFVPTMLRSLPVNGATFATFEVTMRLLE 303

>Sklu_1149.2 YBR291C, Contig c1149 2019-2909 reverse complement
          Length = 296

 Score = 72.4 bits (176), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 80/328 (24%), Positives = 135/328 (41%), Gaps = 41/328 (12%)

Query: 1   MSELAQVLPQPSYVKSILKNDSNVAFXXXXXXXXVSRTVVSPFERVKILLQVQNSTTAYN 60
           MS+  QV P  S++   L                V  +V  PFE  K  LQ+ +  +  +
Sbjct: 1   MSQSKQVDPSKSFIAGCLAG-------------AVEASVTYPFEFAKTRLQLLDKASKAS 47

Query: 61  QGIVGAVRQVYREEGTPGLFRGNGLNCIRIFPYSAVQFVVYEACKKHFFHVDGSKGREQL 120
           +  +  +    + +G   ++ G     +     + V+F+ ++  K      D   G  +L
Sbjct: 48  RNPLVLIYNTAKTQGIGSVYVGCPAFIVGNTAKAGVRFLGFDTIKNLLR--DPKTG--EL 103

Query: 121 QNWQRLFSGALCGGC-SVLATYPLDLVRTRLSIQTANLTKLSKSRAHNISKPPGVWDLLC 179
              + + +G   G   SV+A  P + ++T L     + T     + HN  K       + 
Sbjct: 104 SGPRGVIAGLGAGLLESVVAVTPFEAIKTALIDDKQSAT----PKYHNNGKG------ML 153

Query: 180 RTYK---EEGGIKGLYRGVWPTSLGVVPYVALNFAVYEQFKEFMPEGT----DNTLANFY 232
           R Y     + G+ GLYRGV P S+      A+    Y + K  + + T    D  L++  
Sbjct: 154 RNYTALVRKQGLSGLYRGVLPVSMRQAANQAVRLGCYNKIKVMVQDYTNAPKDKPLSSGL 213

Query: 233 KLSIGALSGGVAQTVTYPFDLLRRRFQVLAMGGNELGFRYKSVMDALITIGKTEGFRGYY 292
              +GA SG V    T P D ++ R Q L         RY S ++   TI K EG + ++
Sbjct: 214 TFVVGAFSGIVTVYTTMPIDTVKTRMQSLDSK------RYSSTINCFTTIFKEEGLKAFW 267

Query: 293 KGLTANLFKVIPSTAVSWLVYEVVCDLM 320
           KG T  L ++  S  + + VYE V  ++
Sbjct: 268 KGATPRLGRLFLSGGIVFTVYEKVLTVL 295

>KLLA0E08877g complement(791157..792041) similar to sgd|S0002277
           Saccharomyces cerevisiae YDL119c, start by similarity
          Length = 294

 Score = 71.6 bits (174), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 69/302 (22%), Positives = 123/302 (40%), Gaps = 50/302 (16%)

Query: 35  VSRTVVSPFERVKILLQVQNSTTAYNQGIVGAVRQVYREEGTPG-LFRGNGLNCIRIFPY 93
           VS  ++ PF+ +K  LQ   ++T +         +  +   TP  L+RG   +CIR    
Sbjct: 20  VSAIILQPFDLLKTRLQQDKTSTLW---------KTLKSIETPSQLWRGALPSCIRTSVG 70

Query: 94  SAVQFVVYEACKKHFFH-----VDGSKGREQLQNWQRLFSGALCGGCSVLATYPLDLVRT 148
           SA+   +  + ++           GS    QL  ++ +FSGA+    + L T P+ +++ 
Sbjct: 71  SAMYLTMLNSIRQAISKGKNTGSTGSSYLPQLNMYENMFSGAVTRALTGLITMPITVIKV 130

Query: 149 RLSIQTANLTKLSKSRAHNISKPPGVWDLLCRTYKEEGGIKGLYRGVWPTSLGVVPYVAL 208
           R        T L  + +H               ++ EG ++G +RG   T+L   PY  L
Sbjct: 131 RYESTLYQYTSLRYATSH--------------IFRTEG-LRGFFRGFGATALRDAPYAGL 175

Query: 209 NFAVYEQFKEFMPE---------GTDNTLANFYKLSI---GALSGGV-AQTVTYPFDLLR 255
               Y++ K  +P           +DN  + +    I    A S  V A ++T PFD ++
Sbjct: 176 YMLFYDRMKVLVPTLLPSNVVKLNSDNRYSTYASTLINGSSAFSAAVIATSITAPFDTVK 235

Query: 256 RRFQVLAMGGNELGFRYKSVMDALITIGKTEGFRGYYKGLTANLFKVIPSTAVSWLVYEV 315
            R Q+          ++ S       I   E  R  + G++  L +   S  ++W +YE 
Sbjct: 236 TRMQLEPA-------KFHSFTSTFWHIATKESVRNLFAGISLRLTRKAFSAGIAWGIYEE 288

Query: 316 VC 317
           + 
Sbjct: 289 IV 290

 Score = 43.9 bits (102), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 48/207 (23%), Positives = 85/207 (41%), Gaps = 38/207 (18%)

Query: 118 EQLQNWQRLFSGALCGGCSVLATYPLDLVRTRLS-IQTANLTKLSKSRAHNISKPPGVWD 176
           EQ +    L  G   G  S +   P DL++TRL   +T+ L K  KS    I  P  +W 
Sbjct: 3   EQRRATTHLIGGFSGGLVSAIILQPFDLLKTRLQQDKTSTLWKTLKS----IETPSQLW- 57

Query: 177 LLCRTYKEEGGIKGLYRGVWP----TSLGVVPYVALNFAVYEQFKEFMPEGTDNT----- 227
                           RG  P    TS+G   Y+ +  ++ +   +    G+  +     
Sbjct: 58  ----------------RGALPSCIRTSVGSAMYLTMLNSIRQAISKGKNTGSTGSSYLPQ 101

Query: 228 LANFYKLSIGALSGGVAQTVTYPFDLLRRRFQVLAMGGNELGFRYKSVMDALITIGKTEG 287
           L  +  +  GA++  +   +T P  +++ R++          ++Y S+  A   I +TEG
Sbjct: 102 LNMYENMFSGAVTRALTGLITMPITVIKVRYESTL-------YQYTSLRYATSHIFRTEG 154

Query: 288 FRGYYKGLTANLFKVIPSTAVSWLVYE 314
            RG+++G  A   +  P   +  L Y+
Sbjct: 155 LRGFFRGFGATALRDAPYAGLYMLFYD 181

>KLLA0C13431g 1145919..1146905 similar to sgd|S0005626 Saccharomyces
           cerevisiae YOR100c CRC1 mitochondrial carnitine carrier,
           member of the mitochondrial carrier (MCF) family, start
           by similarity
          Length = 328

 Score = 72.0 bits (175), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 56/192 (29%), Positives = 83/192 (43%), Gaps = 24/192 (12%)

Query: 39  VVSPFERVKILLQVQNSTTAYNQGIVGAVRQVYREEGTPGLFRGNGLNCIRIFPYSAVQF 98
           V +P ERVK++LQ    TT      + A +Q+ R +G   LF+G+     R  P SA+ F
Sbjct: 156 VTAPTERVKVVLQ----TTQGKASFLDAAKQIVRTQGFQSLFKGSLATLSRDGPGSALYF 211

Query: 99  VVYEACKKHFFHVDGSKGREQLQNWQRLFSGALCGGCSVLATYPLDLVRTRLSIQTANLT 158
             YE CK++     G    E L       SG + G    +  +P+D V+T+L        
Sbjct: 212 ASYEICKEYLNKASGHTSGE-LSITNVCISGGMAGVSMWVVVFPIDTVKTQL-------- 262

Query: 159 KLSKSRAHNISKPPGVWDLLCRTYKEEGGIKGLYRGVWPTSLGVVPYVALNF----AVYE 214
                   + SK   + ++    Y   GGIKG + GV P  L   P  A  F      + 
Sbjct: 263 -------QSSSKRQSMLEVTRMIYNTRGGIKGFFPGVGPAILRSFPANAATFLGVELTHS 315

Query: 215 QFKEFMPEGTDN 226
            FK+F  + T +
Sbjct: 316 LFKKFEQQKTSS 327

 Score = 58.2 bits (139), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 61/234 (26%), Positives = 100/234 (42%), Gaps = 47/234 (20%)

Query: 110 HV-DGSKGREQL-QNWQRLFSGALCGGCSVLATYPLDLVRTRLSIQTANLTKLSKSRAHN 167
           HV D S+ + QL +N + L +G + G C+VL  +P DLV+ R     A            
Sbjct: 14  HVNDVSQTKSQLTENLKSLAAGGVGGVCAVLTGHPFDLVKVRCQSNQAR----------- 62

Query: 168 ISKPPGVWDLLCRTYKEEG-----GIKGLYRGVWPTSLGVVPYVALNFAVYEQFKEFM-- 220
            S    V  +L    +  G      ++G Y+GV P  LGV P  A++F  Y+  K+ +  
Sbjct: 63  -SAMDAVSHILQAARQAAGPTSLNAVRGFYKGVVPPLLGVTPIFAVSFWGYDVGKKLVTS 121

Query: 221 -------------PEGTDNTLANFYKLSIGALSGGVAQTVTYPFDLLRRRFQVLAMGGNE 267
                        PE T + +A     + G +S      VT P + ++   Q        
Sbjct: 122 VPSSAASGAAAVEPELTLSQMA-----AAGFISAIPTTLVTAPTERVKVVLQTTQ----- 171

Query: 268 LGFRYKSVMDALITIGKTEGFRGYYKGLTANLFKVIPSTAVSWLVYEVVCDLMH 321
                 S +DA   I +T+GF+  +KG  A L +  P +A+ +  YE+  + ++
Sbjct: 172 ---GKASFLDAAKQIVRTQGFQSLFKGSLATLSRDGPGSALYFASYEICKEYLN 222

 Score = 47.0 bits (110), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 65/296 (21%), Positives = 119/296 (40%), Gaps = 45/296 (15%)

Query: 42  PFERVKILLQVQNSTTAYNQGIVGAVRQVYREEGTP-------GLFRGNGLNCIRIFPYS 94
           PF+ VK+  Q   + +A +   V  + Q  R+   P       G ++G     + + P  
Sbjct: 48  PFDLVKVRCQSNQARSAMDA--VSHILQAARQAAGPTSLNAVRGFYKGVVPPLLGVTPIF 105

Query: 95  AVQFVVYEACKKHFFHVDGSKG------REQLQNWQRLFSGALCGGCSVLATYPLDLVRT 148
           AV F  Y+  KK    V  S          +L   Q   +G +    + L T P + V+ 
Sbjct: 106 AVSFWGYDVGKKLVTSVPSSAASGAAAVEPELTLSQMAAAGFISAIPTTLVTAPTERVKV 165

Query: 149 RLSIQTANLTKLSKSRAHNISKPPGVWDLLCRTYKEEGGIKGLYRGVWPTSLGVVPYVAL 208
            L       + L  ++             + RT     G + L++G   T     P  AL
Sbjct: 166 VLQTTQGKASFLDAAKQ------------IVRTQ----GFQSLFKGSLATLSRDGPGSAL 209

Query: 209 NFAVYEQFKEFMPEGTDNTLANFYKLSIGALSGGVAQ----TVTYPFDLLRRRFQVLAMG 264
            FA YE  KE++ + + +T       ++  +SGG+A      V +P D ++ + Q  +  
Sbjct: 210 YFASYEICKEYLNKASGHTSGELSITNV-CISGGMAGVSMWVVVFPIDTVKTQLQSSS-- 266

Query: 265 GNELGFRYKSVMDALITIGKTE-GFRGYYKGLTANLFKVIPSTAVSWLVYEVVCDL 319
                 + +S+++    I  T  G +G++ G+   + +  P+ A ++L  E+   L
Sbjct: 267 ------KRQSMLEVTRMIYNTRGGIKGFFPGVGPAILRSFPANAATFLGVELTHSL 316

>YOR130C (ORT1) [4932] chr15 complement(569929..570807) Ornithine
           transport protein of mitochondria involved in arginine
           metabolism, member of the mitochondrial carrier family
           (MCF) of membrane transporters [879 bp, 292 aa]
          Length = 292

 Score = 71.2 bits (173), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 76/292 (26%), Positives = 122/292 (41%), Gaps = 46/292 (15%)

Query: 42  PFERVKILLQVQNST---TAYNQGIVGAVRQVYREEGTP-GLFRGNGLNCIRIFPYSAVQ 97
           PF+ VK+ LQ Q S    T ++      ++  Y+ EG   G F+G     +     +A  
Sbjct: 33  PFDTVKVRLQTQASNVFPTTWS-----CIKFTYQNEGIARGFFQGIASPLVGACLENATL 87

Query: 98  FVVYEACKKHFFHVDGSKGREQLQNWQRLFSGALCGGCSVLATYPLDLVRTRLSIQTANL 157
           FV Y  C K        K        Q L SG + G C+ L   P++LV+ +L  Q ANL
Sbjct: 88  FVSYNQCSKFL-----EKHTNVFPLGQILISGGVAGSCASLVLTPVELVKCKL--QVANL 140

Query: 158 TKLSKSRAHNISKPPGVWDLLCRTYKEEGGIKGLYRGVWPT----SLGVVPYVALNFAVY 213
              S    H    P        +    E G+ GL++G   T    S G V +    FA Y
Sbjct: 141 QVASAKTKHTKVLPT------IKAIITERGLAGLWQGQSGTFIRESFGGVAW----FATY 190

Query: 214 EQFKEFMPE-----GTDNTLANFYKLSIGALSGGVAQTVT-YPFDLLRRRFQVLAMGGNE 267
           E  K+ + +           +  ++L I   S G+A   + +P D ++   Q        
Sbjct: 191 EIVKKSLKDRHSLDDPKRDESKIWELLISGGSAGLAFNASIFPADTVKSVMQT------- 243

Query: 268 LGFRYKSVMDALITIGKTEGFRGYYKGLTANLFKVIPSTAVSWLVYEVVCDL 319
               + S+ +A+  I    G +G+Y+GL   LF+ +P+ A  + ++E +  L
Sbjct: 244 ---EHISLTNAVKKIFGKFGLKGFYRGLGITLFRAVPANAAVFYIFETLSAL 292

 Score = 60.1 bits (144), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 45/192 (23%), Positives = 81/192 (42%), Gaps = 16/192 (8%)

Query: 126 LFSGALCGGCSVLATYPLDLVRTRLSIQTANLTKLSKSRAHNISKPPGVWDLLCRTYKEE 185
           + +G++ G C  +  +P D V+ RL  Q +N+              P  W  +  TY+ E
Sbjct: 17  IINGSIAGACGKVIEFPFDTVKVRLQTQASNVF-------------PTTWSCIKFTYQNE 63

Query: 186 GGIKGLYRGVWPTSLGVVPYVALNFAVYEQFKEFMPEGTDNTLANFYKLSIGALSGGVAQ 245
           G  +G ++G+    +G     A  F  Y Q  +F+ + T N       L  G ++G  A 
Sbjct: 64  GIARGFFQGIASPLVGACLENATLFVSYNQCSKFLEKHT-NVFPLGQILISGGVAGSCAS 122

Query: 246 TVTYPFDLLRRRFQVLAMGGNELGFRYKSVMDALITIGKTEGFRGYYKGLTANLFKVIPS 305
            V  P +L++ + QV  +       ++  V+  +  I    G  G ++G +    +    
Sbjct: 123 LVLTPVELVKCKLQVANLQVASAKTKHTKVLPTIKAIITERGLAGLWQGQSGTFIRE-SF 181

Query: 306 TAVSWLV-YEVV 316
             V+W   YE+V
Sbjct: 182 GGVAWFATYEIV 193

>Kwal_26.7967
          Length = 297

 Score = 70.5 bits (171), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 75/324 (23%), Positives = 138/324 (42%), Gaps = 41/324 (12%)

Query: 1   MSELAQVLPQPSYVKSILKNDSNVAFXXXXXXXXVSRTVVSPFERVKILLQVQNSTTAYN 60
           MS+  QV P  S++   L                V  ++  PFE  K  LQ+ + ++  +
Sbjct: 1   MSQKKQVDPLHSFLAGSLAG-------------AVEASITYPFEFAKTRLQLVDKSSTAS 47

Query: 61  QGIVGAVRQVYREEGTPGLFRGNGLNCIRIFPYSAVQFVVYEACKKHFFHVDGSKGREQL 120
           +  +  + +  + +G   ++ G     +     + V+F+ ++A K      D + G  +L
Sbjct: 48  RNPLTLIYRTAKVQGLGAVYVGCPAFIVGNTAKAGVRFLGFDAIKNIL--RDPTTG--EL 103

Query: 121 QNWQRLFSGALCGGC-SVLATYPLDLVRTRLSIQTANLTKLSKSRAHNISKPPGVWDLLC 179
              + + +G   G   SV+A  P + ++T L     +  + +  + HN  +       + 
Sbjct: 104 SGPRGIVAGLGAGLLESVVAVTPFEAIKTAL----IDDKQSASPKYHNNGRG------ML 153

Query: 180 RTYKE---EGGIKGLYRGVWPTSLGVVPYVALNFAVYEQFKEFMPEGT----DNTLANFY 232
           R Y     + G  GLYRGV P S+      A+    Y + K  + + T    D  L++  
Sbjct: 154 RNYSSLVYDKGFSGLYRGVLPVSMRQAANQAVRLGCYNKIKTMIQDYTNSAKDKPLSSGM 213

Query: 233 KLSIGALSGGVAQTVTYPFDLLRRRFQVLAMGGNELGFRYKSVMDALITIGKTEGFRGYY 292
              +GA SG V    T P D ++ R Q L         +Y S ++   T+ + EG + ++
Sbjct: 214 TFVVGAFSGIVTVYTTMPIDTVKTRMQSLDSS------KYSSTINCFATVFREEGLKTFW 267

Query: 293 KGLTANLFKVIPSTAVSWLVYEVV 316
           KG T  L ++I S  + + +YE V
Sbjct: 268 KGATPRLGRLILSGGIVFTIYEKV 291

 Score = 31.2 bits (69), Expect = 0.97,   Method: Compositional matrix adjust.
 Identities = 17/85 (20%), Positives = 40/85 (47%), Gaps = 4/85 (4%)

Query: 237 GALSGGVAQTVTYPFDLLRRRFQVLAMGGNELGFRYKSVMDALITIGKTEGFRGYYKGLT 296
           G+L+G V  ++TYPF+  + R Q++    ++     ++ +  +    K +G    Y G  
Sbjct: 16  GSLAGAVEASITYPFEFAKTRLQLV----DKSSTASRNPLTLIYRTAKVQGLGAVYVGCP 71

Query: 297 ANLFKVIPSTAVSWLVYEVVCDLMH 321
           A +        V +L ++ + +++ 
Sbjct: 72  AFIVGNTAKAGVRFLGFDAIKNILR 96

>KLLA0E02772g complement(261895..262749) similar to sp|Q12375
           Saccharomyces cerevisiae YOR130c ARG11 ornithine
           transport protein of mitochondria involved in arginine
           metabolism, member of the mitochondrial carrier family
           (MCF), start by similarity
          Length = 284

 Score = 70.1 bits (170), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 72/292 (24%), Positives = 129/292 (44%), Gaps = 41/292 (14%)

Query: 35  VSRTVVSPFERVKILLQVQNS---TTAYNQGIVGAVRQVYREEGT-PGLFRGNGLNCIRI 90
           + + +  PF+ VK+ LQ Q +    T ++      +R  Y +EG   G ++G        
Sbjct: 20  IGKVIEYPFDTVKVRLQTQPAHLYPTTWS-----CIRSTYTDEGIWKGFYQGIASPLFGA 74

Query: 91  FPYSAVQFVVYEACKKHFFHVDGSKGREQLQNWQRLFSGALCGGCSVLATYPLDLVRTRL 150
              +AV FV +  C      +D     + L   + ++SGA  G C+     P++LV+ +L
Sbjct: 75  ALENAVLFVSFNQCTNF---LDEFTQLKPLT--KTIYSGAFAGACASFILTPVELVKCKL 129

Query: 151 SIQTANLTK-LSKSRAHNISKPPGVWDLLCRTYKEEGGIKGLYRGVWPTSLGVVPYVALN 209
             Q +N++  LS++  H       VW  +    KE+G + GL++G   T +      A+ 
Sbjct: 130 --QVSNISNSLSQTTRHT-----SVWPTIKSVIKEKG-LLGLWQGQLSTFVRECLGGAVW 181

Query: 210 FAVYE----QFKEFMPEGTDNTLANFYKLSIGALSGGVA-QTVTYPFDLLRRRFQVLAMG 264
           F  YE    +F    P   +N   + ++L +   S GV      +P D ++   Q     
Sbjct: 182 FTTYEIMKMKFASLHPAEKEN---HTWELLVSGASAGVLFNASVFPADTVKSVCQT---- 234

Query: 265 GNELGFRYKSVMDALITIGKTEGFRGYYKGLTANLFKVIPSTAVSWLVYEVV 316
                  + S+++AL  + +T G  G+Y+GL   L +  P+ A  +  YE +
Sbjct: 235 ------EHVSIVNALKKVLRTHGITGFYRGLGITLIRAAPANATVFYTYETL 280

 Score = 61.2 bits (147), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 51/191 (26%), Positives = 83/191 (43%), Gaps = 19/191 (9%)

Query: 129 GALCGGCSVLATYPLDLVRTRLSIQTANLTKLSKSRAHNISKPPGVWDLLCRTYKEEGGI 188
           G++ G    +  YP D V+ RL  Q A+L              P  W  +  TY +EG  
Sbjct: 14  GSVAGAIGKVIEYPFDTVKVRLQTQPAHLY-------------PTTWSCIRSTYTDEGIW 60

Query: 189 KGLYRGVWPTSLGVVPYVALNFAVYEQFKEFMPEGTDNTLANFYK-LSIGALSGGVAQTV 247
           KG Y+G+     G     A+ F  + Q   F+ E T   L    K +  GA +G  A  +
Sbjct: 61  KGFYQGIASPLFGAALENAVLFVSFNQCTNFLDEFTQ--LKPLTKTIYSGAFAGACASFI 118

Query: 248 TYPFDLLRRRFQVLAMGGNELG--FRYKSVMDALITIGKTEGFRGYYKGLTANLFKVIPS 305
             P +L++ + QV  +  N L    R+ SV   + ++ K +G  G ++G  +   +    
Sbjct: 119 LTPVELVKCKLQVSNI-SNSLSQTTRHTSVWPTIKSVIKEKGLLGLWQGQLSTFVRECLG 177

Query: 306 TAVSWLVYEVV 316
            AV +  YE++
Sbjct: 178 GAVWFTTYEIM 188

 Score = 55.5 bits (132), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 49/185 (26%), Positives = 79/185 (42%), Gaps = 25/185 (13%)

Query: 39  VVSPFERVKILLQVQN-----STTAYNQGIVGAVRQVYREEGTPGLFRGNGLNCIRIFPY 93
           +++P E VK  LQV N     S T  +  +   ++ V +E+G  GL++G     +R    
Sbjct: 118 ILTPVELVKCKLQVSNISNSLSQTTRHTSVWPTIKSVIKEKGLLGLWQGQLSTFVRECLG 177

Query: 94  SAVQFVVYEACKKHFFHVDGSKGREQLQNWQRLFSGALCGGCSVLATYPLDLVRTRLSIQ 153
            AV F  YE  K  F  +  ++  ++   W+ L SGA  G     + +P D V++    +
Sbjct: 178 GAVWFTTYEIMKMKFASLHPAE--KENHTWELLVSGASAGVLFNASVFPADTVKSVCQTE 235

Query: 154 TANLTKLSKSRAHNISKPPGVWDLLCRTYKEEGGIKGLYRGVWPTSLGVVPYVALNFAVY 213
             ++    K               + RT+    GI G YRG+  T +   P  A  F  Y
Sbjct: 236 HVSIVNALKK--------------VLRTH----GITGFYRGLGITLIRAAPANATVFYTY 277

Query: 214 EQFKE 218
           E  K+
Sbjct: 278 ETLKK 282

 Score = 44.3 bits (103), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 25/69 (36%), Positives = 36/69 (52%), Gaps = 6/69 (8%)

Query: 40  VSPFERVKILLQVQNSTTAYNQGIVGAVRQVYREEGTPGLFRGNGLNCIRIFPYSAVQFV 99
           V P + VK + Q ++ +      IV A+++V R  G  G +RG G+  IR  P +A  F 
Sbjct: 222 VFPADTVKSVCQTEHVS------IVNALKKVLRTHGITGFYRGLGITLIRAAPANATVFY 275

Query: 100 VYEACKKHF 108
            YE  KK F
Sbjct: 276 TYETLKKMF 284

 Score = 34.3 bits (77), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 18/76 (23%), Positives = 38/76 (50%), Gaps = 7/76 (9%)

Query: 234 LSIGALSGGVAQTVTYPFDLLRRRFQVLAMGGNELGFRYKSVMDALITIGKTEG-FRGYY 292
           ++ G+++G + + + YPFD ++ R Q       +    Y +    + +    EG ++G+Y
Sbjct: 11  IAYGSVAGAIGKVIEYPFDTVKVRLQ------TQPAHLYPTTWSCIRSTYTDEGIWKGFY 64

Query: 293 KGLTANLFKVIPSTAV 308
           +G+ + LF      AV
Sbjct: 65  QGIASPLFGAALENAV 80

>CAGL0D01606g complement(169066..169983) highly similar to sp|P32331
           Saccharomyces cerevisiae YPR058w YMC1 or sp|P38087
           Saccharomyces cerevisiae YBR104w YMC2, start by
           similarity
          Length = 305

 Score = 70.1 bits (170), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 70/281 (24%), Positives = 117/281 (41%), Gaps = 23/281 (8%)

Query: 42  PFERVKILLQVQNSTTAYNQGIVGAVRQVYREEGTPGLFRGNGLNCIRIFPYSAVQFVVY 101
           PF+  K+ LQ     T+  +     V+ + + EG  G ++G     + +    ++QF V 
Sbjct: 45  PFDTTKVRLQTSKVPTSAAE----VVKNLLKNEGPKGFYKGTLTPLVGVGACVSIQFGVN 100

Query: 102 EACKKHFFHVDGSKGREQLQNWQRLFSGALCGGCSVLATYPLDLVRTRLSIQTANLTKLS 161
           EA K+ FFH         L   Q    G   G  +     P++ VR RL  QT       
Sbjct: 101 EAMKR-FFHARNVDHNATLSLSQYYLCGLTGGMTNSFLASPIEHVRIRLQTQTG------ 153

Query: 162 KSRAHNISKPPGVWDLLCRTYKEEGGIKGLYRGVWPTSLGVVPYVALNFAVYEQF-KEFM 220
            S A    K P   D + +   +    KGL RG+ PT L         F VYE    + +
Sbjct: 154 -SGAQAEFKGP--IDCIKKLRSQ----KGLMRGLIPTMLREGHGCGTYFLVYEALVSKQI 206

Query: 221 PEGTDNTLANFYKLSI-GALSGGVAQTVTYPFDLLRRRFQVLAMGGNELGFRYKSVMDAL 279
            +G   T    +KL + GALSG     + YP D+++   Q   +   + G   K+++   
Sbjct: 207 NQGLKRTEIPPWKLCLYGALSGTALWLMVYPIDVVKSVMQTDNLNKPQNG---KNMIQVA 263

Query: 280 ITIGKTEGFRGYYKGLTANLFKVIPSTAVSWLVYEVVCDLM 320
             +   EG + ++KG    + +  P+   ++  +E+   L+
Sbjct: 264 RNLYAREGLKAFFKGFGPTMLRAAPANGGTFATFELAMRLL 304

 Score = 56.6 bits (135), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 48/176 (27%), Positives = 75/176 (42%), Gaps = 14/176 (7%)

Query: 39  VVSPFERVKILLQVQNSTTAYNQGIVGAVRQVYREEGTPGLFRGNGLNCIRIFPYSAVQF 98
           + SP E V+I LQ Q  + A  +   G +  + +     GL RG     +R        F
Sbjct: 137 LASPIEHVRIRLQTQTGSGAQAE-FKGPIDCIKKLRSQKGLMRGLIPTMLREGHGCGTYF 195

Query: 99  VVYEACKKHFFHVDGSKGREQLQNWQRLFSGALCGGCSVLATYPLDLVRTRLSIQTANLT 158
           +VYEA       ++    R ++  W+    GAL G    L  YP+D+V++   +QT NL 
Sbjct: 196 LVYEALVSK--QINQGLKRTEIPPWKLCLYGALSGTALWLMVYPIDVVKS--VMQTDNLN 251

Query: 159 KLSKSRAHNISKPPGVWDLLCRTYKEEGGIKGLYRGVWPTSLGVVPYVALNFAVYE 214
           K    +  N+ +       + R      G+K  ++G  PT L   P     FA +E
Sbjct: 252 KPQNGK--NMIQ-------VARNLYAREGLKAFFKGFGPTMLRAAPANGGTFATFE 298

 Score = 42.4 bits (98), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 51/212 (24%), Positives = 87/212 (41%), Gaps = 30/212 (14%)

Query: 111 VDGSKGREQLQNWQRLFSGALCGGCSVLATYPLDLVRTRLSIQTANLTKLSKSRAHNISK 170
           ++   G++  +  + L +G   G   VL   P D  + RL  QT+ +             
Sbjct: 14  LEDHPGQDNGRVVKDLLAGTAGGIAQVLIGQPFDTTKVRL--QTSKV------------- 58

Query: 171 PPGVWDLLCRTYKEEGGIKGLYRGVWPTSLGVVPYVALNFAVYEQFKEFM-PEGTDN--- 226
           P    +++    K EG  KG Y+G     +GV   V++ F V E  K F      D+   
Sbjct: 59  PTSAAEVVKNLLKNEG-PKGFYKGTLTPLVGVGACVSIQFGVNEAMKRFFHARNVDHNAT 117

Query: 227 -TLANFYKLSIGALSGGVAQT-VTYPFDLLRRRFQVLAMGGNELGFRYKSVMDALITIGK 284
            +L+ +Y   +  L+GG+  + +  P + +R R Q     G +  F  K  +D    I K
Sbjct: 118 LSLSQYY---LCGLTGGMTNSFLASPIEHVRIRLQTQTGSGAQAEF--KGPIDC---IKK 169

Query: 285 TEGFRGYYKGLTANLFKVIPSTAVSWLVYEVV 316
               +G  +GL   + +        +LVYE +
Sbjct: 170 LRSQKGLMRGLIPTMLREGHGCGTYFLVYEAL 201

 Score = 31.6 bits (70), Expect = 0.84,   Method: Compositional matrix adjust.
 Identities = 26/101 (25%), Positives = 41/101 (40%), Gaps = 11/101 (10%)

Query: 223 GTDNTLANFYKLSIGALSGGVAQT-VTYPFDLLRRRFQVLAMGGNELGFRYKSVMDALIT 281
           G DN      K  +   +GG+AQ  +  PFD  + R Q   +          S  + +  
Sbjct: 19  GQDN--GRVVKDLLAGTAGGIAQVLIGQPFDTTKVRLQTSKV--------PTSAAEVVKN 68

Query: 282 IGKTEGFRGYYKGLTANLFKVIPSTAVSWLVYEVVCDLMHV 322
           + K EG +G+YKG    L  V    ++ + V E +    H 
Sbjct: 69  LLKNEGPKGFYKGTLTPLVGVGACVSIQFGVNEAMKRFFHA 109

>Scas_721.129
          Length = 323

 Score = 70.1 bits (170), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 71/299 (23%), Positives = 123/299 (41%), Gaps = 31/299 (10%)

Query: 35  VSRTVVSPFERVKILLQVQNSTTAYNQGI----VGAVRQVYREEGTPGLFRG-------- 82
           ++ T  +P E VKI +Q+Q    A  Q +    +  +  ++R EG  GL +G        
Sbjct: 34  IAVTFTNPIELVKIRMQLQGELAAVGQKVYRNPIQGMGVIFRNEGIRGLQKGLVAAYIYQ 93

Query: 83  NGLNCIRIFPYSAVQFVVYEACKKHFFHVDGSKGREQLQNWQRLFSGALCGGCSVLATYP 142
            GLN  R+  Y  ++     A    F+  + S   +++     + +GA  G    +   P
Sbjct: 94  IGLNGSRLGFYEPIR----NALNSTFYPNEESHKIQKVS--INVAAGASSGIIGAVIGSP 147

Query: 143 LDLVRTRLSIQTANLTKLSKSRAHNISKPPGVWDLLCRTYKEEGGIKGLYRGVWPTSLGV 202
           L LV+TR+   +  +    ++   N      VW+ L    + EG  KGL+RG+    L  
Sbjct: 148 LFLVKTRMQSYSDAIKIGEQTHYRN------VWNGLSTIARTEG-FKGLFRGIDAAILRT 200

Query: 203 VPYVALNFAVYEQFKEFMPEGTDNTLANFYKLSIGALSGGVAQTVTYPFDLLRRRFQVLA 262
               ++   +Y   K F+ +           L+   +SG     V  P+D++  R     
Sbjct: 201 GAGSSVQLPIYNTAKNFLLKNDLMKDGPGLHLTASTISGLGVAVVMNPWDVILTRIY--- 257

Query: 263 MGGNELGFRYKSVMDALITIGKTEGFRGYYKGLTANLFKVIPSTAVSWLVYEVVCDLMH 321
              N+ G  YK  +D  +   +TEG    YKG  A + ++ P T +     E    L++
Sbjct: 258 ---NQKGNLYKGPVDCFVKTVRTEGISALYKGFQAQILRIAPHTIICLTFMEQTMKLVY 313

 Score = 52.4 bits (124), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 45/213 (21%), Positives = 93/213 (43%), Gaps = 21/213 (9%)

Query: 118 EQLQNWQRLFSGALCGGCSVLATYPLDLVRTRLSIQTANLTKLSKSRAHNISKPPGVWDL 177
           +++  +    +G +    +V  T P++LV+ R+ +Q   L  + +    N  +  GV   
Sbjct: 17  QKVSKFGSFIAGGMAACIAVTFTNPIELVKIRMQLQ-GELAAVGQKVYRNPIQGMGV--- 72

Query: 178 LCRTYKEEGGIKGLYRGVWPTSLGVVPYVALNFAVYEQFKE-----FMPEGTDNTLANF- 231
               ++ EG I+GL +G+    +  +         YE  +      F P    + +    
Sbjct: 73  ---IFRNEG-IRGLQKGLVAAYIYQIGLNGSRLGFYEPIRNALNSTFYPNEESHKIQKVS 128

Query: 232 YKLSIGALSGGVAQTVTYPFDLLRRRFQ----VLAMGGNELGFRYKSVMDALITIGKTEG 287
             ++ GA SG +   +  P  L++ R Q     + +G       Y++V + L TI +TEG
Sbjct: 129 INVAAGASSGIIGAVIGSPLFLVKTRMQSYSDAIKIGEQT---HYRNVWNGLSTIARTEG 185

Query: 288 FRGYYKGLTANLFKVIPSTAVSWLVYEVVCDLM 320
           F+G ++G+ A + +    ++V   +Y    + +
Sbjct: 186 FKGLFRGIDAAILRTGAGSSVQLPIYNTAKNFL 218

>YBR291C (CTP1) [469] chr2 complement(783631..784530) Mitochondrial
           inner membrane citrate transport protein, member of the
           mitochondrial carrier family (MCF) of membrane
           transporters [900 bp, 299 aa]
          Length = 299

 Score = 69.7 bits (169), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 71/283 (25%), Positives = 122/283 (43%), Gaps = 28/283 (9%)

Query: 42  PFERVKILLQVQNSTTAYNQGIVGAVRQVYREEGTPGLFRGNGLNCIRIFPYSAVQFVVY 101
           PFE  K  LQ+ +  +  ++  +  + +  + +G   ++ G     I     + ++F+ +
Sbjct: 32  PFEFAKTRLQLIDKASKASRNPLVLIYKTAKTQGIGSIYVGCPAFIIGNTAKAGIRFLGF 91

Query: 102 EACKKHFFHVDGSKGREQLQNWQRLFSGALCGGC-SVLATYPLDLVRTRLSIQTANLTKL 160
           +  K      D   G  +L   + + +G   G   SV A  P + ++T L     + T  
Sbjct: 92  DTIKDML--RDSETG--ELSGTRGVIAGLGAGLLESVAAVTPFEAIKTALIDDKQSAT-- 145

Query: 161 SKSRAHNISKPPGVWDLLCRTYKE---EGGIKGLYRGVWPTSLGVVPYVALNFAVYEQFK 217
              + HN  +  GV     R Y     + G  GLYRGV P S+      A+    Y + K
Sbjct: 146 --PKYHNNGR--GV----VRNYSSLVRDKGFSGLYRGVLPVSMRQAANQAVRLGCYNKIK 197

Query: 218 EFMPEGTDNT----LANFYKLSIGALSGGVAQTVTYPFDLLRRRFQVLAMGGNELGFRYK 273
             + + TD+     L++     +GA SG V    T P D ++ R Q L         +Y 
Sbjct: 198 TLIQDYTDSPKDKPLSSGLTFLVGAFSGIVTVYSTMPLDTVKTRMQSLD------STKYS 251

Query: 274 SVMDALITIGKTEGFRGYYKGLTANLFKVIPSTAVSWLVYEVV 316
           S M+   TI K EG + ++KG T  L +++ S  + + +YE V
Sbjct: 252 STMNCFATIFKEEGLKTFWKGATPRLGRLVLSGGIVFTIYEKV 294

 Score = 34.7 bits (78), Expect = 0.087,   Method: Compositional matrix adjust.
 Identities = 44/213 (20%), Positives = 87/213 (40%), Gaps = 22/213 (10%)

Query: 117 REQLQNWQRLFSGALCGGCSVLATYPLDLVRTRLSIQTANLTKLSKSRAHNISKPPGVWD 176
           +  +       +G+L G      TYP +  +TRL +    + K SK+     S+ P V  
Sbjct: 7   KSDVDPLHSFLAGSLAGAAEACITYPFEFAKTRLQL----IDKASKA-----SRNPLV-- 55

Query: 177 LLCRTYKEEGGIKGLYRGVWPTSLGVVPYVALNFAVYEQFKEFMPEGTDNTLANFYKLSI 236
           L+ +T K + GI  +Y G     +G      + F  ++  K+ + +     L+    + I
Sbjct: 56  LIYKTAKTQ-GIGSIYVGCPAFIIGNTAKAGIRFLGFDTIKDMLRDSETGELSGTRGV-I 113

Query: 237 GALSGGVAQTVT--YPFDLLRRRFQVLAMGGNELGFRY----KSVMDALITIGKTEGFRG 290
             L  G+ ++V    PF+ ++     L         +Y    + V+    ++ + +GF G
Sbjct: 114 AGLGAGLLESVAAVTPFEAIK---TALIDDKQSATPKYHNNGRGVVRNYSSLVRDKGFSG 170

Query: 291 YYKGLTANLFKVIPSTAVSWLVYEVVCDLMHVW 323
            Y+G+     +   + AV    Y  +  L+  +
Sbjct: 171 LYRGVLPVSMRQAANQAVRLGCYNKIKTLIQDY 203

 Score = 33.9 bits (76), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 22/104 (21%), Positives = 43/104 (41%), Gaps = 12/104 (11%)

Query: 222 EGTDNTLANFYKLSIGALSGGVAQTVTYPFDLLRRRFQVLAMGG----NELGFRYKSVMD 277
           + T + +   +    G+L+G     +TYPF+  + R Q++        N L   YK+   
Sbjct: 4   KATKSDVDPLHSFLAGSLAGAAEACITYPFEFAKTRLQLIDKASKASRNPLVLIYKTA-- 61

Query: 278 ALITIGKTEGFRGYYKGLTANLFKVIPSTAVSWLVYEVVCDLMH 321
                 KT+G    Y G  A +        + +L ++ + D++ 
Sbjct: 62  ------KTQGIGSIYVGCPAFIIGNTAKAGIRFLGFDTIKDMLR 99

>YMR166C (YMR166C) [4121] chr13 complement(593366..594472) Member of
           the mitochondrial carrier (MCF) protein family of
           membrane transporters [1107 bp, 368 aa]
          Length = 368

 Score = 70.1 bits (170), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 57/197 (28%), Positives = 90/197 (45%), Gaps = 20/197 (10%)

Query: 123 WQRLFSGALCGGCSVLATYPLDLVRTRLSIQTANLTKLSKSRAHNISKPPGVWDLLCRTY 182
           W  + SG + G     A + LD V+TR            +  A N+ K   +       +
Sbjct: 54  WHCVVSGGIGGKIGDSAMHSLDTVKTR------------QQGAPNVKKYRNMISAYRTIW 101

Query: 183 KEEGGIKGLYRGVWPTSLGVVPYVALNFAVYEQFKEFMPEG--TDNTLANFYKLSIGALS 240
            EEG  +GLY G     LG  P  A+ F  YE  K  M E    ++T+ +   LS G L 
Sbjct: 102 LEEGVRRGLYGGYMAAMLGSFPSAAIFFGTYEYTKRTMIEDWQINDTITH---LSAGFLG 158

Query: 241 GGVAQTVTYPFDLLRRRFQVLAMGGN---ELGFRYKSVMDALITIGKTEGFRGYYKGLTA 297
             ++  V  P ++L+ R Q+     N   + G+ Y ++ +A+ T+ K EGFR  + G  A
Sbjct: 159 DFISSFVYVPSEVLKTRLQLQGRFNNPFFQSGYNYSNLRNAIKTVIKEEGFRSLFFGYKA 218

Query: 298 NLFKVIPSTAVSWLVYE 314
            L + +P +A+ +  YE
Sbjct: 219 TLARDLPFSALQFAFYE 235

 Score = 68.9 bits (167), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 52/178 (29%), Positives = 83/178 (46%), Gaps = 15/178 (8%)

Query: 35  VSRTVVSPFERVKILLQVQNS------TTAYN-QGIVGAVRQVYREEGTPGLFRGNGLNC 87
           +S  V  P E +K  LQ+Q         + YN   +  A++ V +EEG   LF G     
Sbjct: 161 ISSFVYVPSEVLKTRLQLQGRFNNPFFQSGYNYSNLRNAIKTVIKEEGFRSLFFGYKATL 220

Query: 88  IRIFPYSAVQFVVYEACKKHFFHVDGSKGRE-QLQNWQRLFSGALCGGCSVLATYPLDLV 146
            R  P+SA+QF  YE  ++  F ++   GR+ +L     + +GA  GG + + T P+D+V
Sbjct: 221 ARDLPFSALQFAFYEKFRQLAFKIEQKDGRDGELSIPNEILTGACAGGLAGIITTPMDVV 280

Query: 147 RTRLSIQ---TANLTKLSKSRAHNISKPPGVW----DLLCRTYKEEGGIKGLYRGVWP 197
           +TR+  Q   + +    S +  H  +  P        L  RT  +  G+ G + GV P
Sbjct: 281 KTRVQTQQPPSQSNKSYSVTHPHVTNGRPAALSNSISLSLRTVYQSEGVLGFFSGVGP 338

 Score = 64.7 bits (156), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 71/309 (22%), Positives = 132/309 (42%), Gaps = 44/309 (14%)

Query: 35  VSRTVVSPFERVKILLQVQNSTTAYNQGIVGAVRQVYREEGTP-GLFRGNGLNCIRIFPY 93
           +  + +   + VK   Q   +   Y + ++ A R ++ EEG   GL+ G     +  FP 
Sbjct: 66  IGDSAMHSLDTVKTRQQGAPNVKKY-RNMISAYRTIWLEEGVRRGLYGGYMAAMLGSFPS 124

Query: 94  SAVQFVVYEACKKHFFHVDGSKGREQLQNWQ------RLFSGALCGGCSVLATYPLDLVR 147
           +A+ F  YE  K           R  +++WQ       L +G L    S     P ++++
Sbjct: 125 AAIFFGTYEYTK-----------RTMIEDWQINDTITHLSAGFLGDFISSFVYVPSEVLK 173

Query: 148 TRLSIQTANLTKLSKSRAHNISKPPGVWDLLCRTYKEEGGIKGLYRGVWPTSLGVVPYVA 207
           TRL +Q        +S  +N S    + + +    KEEG  + L+ G   T    +P+ A
Sbjct: 174 TRLQLQGRFNNPFFQS-GYNYSN---LRNAIKTVIKEEG-FRSLFFGYKATLARDLPFSA 228

Query: 208 LNFAVYEQFKEF-----MPEGTDNTLANFYKLSIGALSGGVAQTVTYPFDLLRRRFQVL- 261
           L FA YE+F++        +G D  L+   ++  GA +GG+A  +T P D+++ R Q   
Sbjct: 229 LQFAFYEKFRQLAFKIEQKDGRDGELSIPNEILTGACAGGLAGIITTPMDVVKTRVQTQQ 288

Query: 262 --AMGGNELGFRYKSVMD------------ALITIGKTEGFRGYYKGLTANLFKVIPSTA 307
             +         +  V +            +L T+ ++EG  G++ G+          ++
Sbjct: 289 PPSQSNKSYSVTHPHVTNGRPAALSNSISLSLRTVYQSEGVLGFFSGVGPRFVWTSVQSS 348

Query: 308 VSWLVYEVV 316
           +  L+Y++ 
Sbjct: 349 IMLLLYQMT 357

>Scas_589.10
          Length = 316

 Score = 69.3 bits (168), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 52/180 (28%), Positives = 84/180 (46%), Gaps = 12/180 (6%)

Query: 125 RLFSGALCGGCSVLATYPLDLVRTRLSIQTANLTKLSKSRAHNISKP--PGVWDLLCRTY 182
           +  SGA+ G    +  YPLD+V+TR  +Q  N   L+ S      +P    +   L +  
Sbjct: 16  QFISGAVAGMSETIMMYPLDVVKTRFQLQI-NKKALATSSVAVPKQPEHSSILSCLSKIL 74

Query: 183 KEEGGIKGLYRGVWPTSLGVVPYVALNFAVYEQFKEFMPEGTD-NTLANFYKLSIGALSG 241
           KEEG  K LY+G+ P  L  VP  A+ FA  EQF++ M +      + +   L  G  +G
Sbjct: 75  KEEG-FKNLYKGMSPPLLMEVPKRAVKFASNEQFQQIMMKKFKLKEVTSTVTLLAGTFAG 133

Query: 242 GVAQTVTYPFDLLRRRFQVLAMGGNELGFRYKSVMDALITIGKTEGFRGYYKGLTANLFK 301
                +  PF+L++ R Q       +    Y+S +    TI + +G  G Y G  + +++
Sbjct: 134 ITESLIVVPFELVKIRLQ-------DAQSDYRSPIRCTRTIIENQGLFGIYAGFESTIWR 186

 Score = 63.2 bits (152), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 70/300 (23%), Positives = 123/300 (41%), Gaps = 44/300 (14%)

Query: 42  PFERVKILLQVQNSTTAY------------NQGIVGAVRQVYREEGTPGLFRGNGLNCIR 89
           P + VK   Q+Q +  A             +  I+  + ++ +EEG   L++G     + 
Sbjct: 33  PLDVVKTRFQLQINKKALATSSVAVPKQPEHSSILSCLSKILKEEGFKNLYKGMSPPLLM 92

Query: 90  IFPYSAVQFVVYEACKKHFFHVDGSKGR-EQLQNWQRLFSGALCGGCSVLATYPLDLVRT 148
             P  AV+F    A  + F  +   K + +++ +   L +G   G    L   P +LV+ 
Sbjct: 93  EVPKRAVKF----ASNEQFQQIMMKKFKLKEVTSTVTLLAGTFAGITESLIVVPFELVKI 148

Query: 149 RLSIQTANLTKLSKSRAHNISKPPGVWDLLCRTYKEEGGIKGLYRG----VWPTSLGVVP 204
           RL  Q A     S  R               RT  E  G+ G+Y G    +W  ++    
Sbjct: 149 RL--QDAQSDYRSPIRC-------------TRTIIENQGLFGIYAGFESTIWRNTIWNAS 193

Query: 205 YVALNFAVYEQFKEFMPEGTDNTLANFYK--LSIGALSGGVAQTVTYPFDLLRRRFQVLA 262
           Y  L F    Q K+F+P     T     +    +GA++G ++  ++ PFD+++ R Q   
Sbjct: 194 YFGLIF----QVKKFIPRAKSTTKFQGIRNDFLVGAIAGCMSCFLSVPFDVVKTRMQ--G 247

Query: 263 MGGNELGFRYKSVMDALITIGKTEGFRGYYKGLTANLFKVIPSTAVSWLVYEVVCDLMHV 322
                 G  Y     ++  I +TEG +G YKG+   + +  P   +  +V+  V +L  +
Sbjct: 248 SKKTSSGMCYGWAWQSVFLIYRTEGIKGIYKGILPIICRYGPGGGLLLVVFNGVNELFRM 307

 Score = 43.9 bits (102), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 28/101 (27%), Positives = 48/101 (47%), Gaps = 8/101 (7%)

Query: 228 LANFYKLSIGALSGGVAQTVTYPFDLLRRRFQVL----AMGGNELGF----RYKSVMDAL 279
           L   Y+   GA++G     + YP D+++ RFQ+     A+  + +       + S++  L
Sbjct: 11  LPFIYQFISGAVAGMSETIMMYPLDVVKTRFQLQINKKALATSSVAVPKQPEHSSILSCL 70

Query: 280 ITIGKTEGFRGYYKGLTANLFKVIPSTAVSWLVYEVVCDLM 320
             I K EGF+  YKG++  L   +P  AV +   E    +M
Sbjct: 71  SKILKEEGFKNLYKGMSPPLLMEVPKRAVKFASNEQFQQIM 111

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 41/159 (25%), Positives = 68/159 (42%), Gaps = 15/159 (9%)

Query: 39  VVSPFERVKILLQVQNSTTAYNQGIVGAVRQVYREEGTPGLFRGNGLNCIRIFPYSAVQF 98
           +V PFE VKI L  Q++ + Y   I    R +   +G  G++ G      R   ++A  F
Sbjct: 139 IVVPFELVKIRL--QDAQSDYRSPI-RCTRTIIENQGLFGIYAGFESTIWRNTIWNASYF 195

Query: 99  VVYEACKKHFFHVDGSKGREQLQNWQRLFSGALCGGCSVLATYPLDLVRTRLSIQTANLT 158
            +    KK       +   + ++N      GA+ G  S   + P D+V+TR+       +
Sbjct: 196 GLIFQVKKFIPRAKSTTKFQGIRN--DFLVGAIAGCMSCFLSVPFDVVKTRMQGSKKTSS 253

Query: 159 KLSKSRAHNISKPPGVWDLLCRTYKEEGGIKGLYRGVWP 197
            +    A         W  +   Y+ E GIKG+Y+G+ P
Sbjct: 254 GMCYGWA---------WQSVFLIYRTE-GIKGIYKGILP 282

>YJR077C (MIR1) [2970] chr10 complement(577169..578104) Phosphate
           transporter of the mitochondrial carrier (MCF) family
           [936 bp, 311 aa]
          Length = 311

 Score = 68.9 bits (167), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 74/284 (26%), Positives = 114/284 (40%), Gaps = 29/284 (10%)

Query: 36  SRTVVSPFERVKILLQVQNSTTAYNQGIVGAVRQVYREEGTPGLFRGNGLNCIRIFPYSA 95
           + + + P + VK  +Q++   T YN+G+VG+ +Q+   EG   L  G G   +      A
Sbjct: 31  THSSMVPIDVVKTRIQLE--PTVYNKGMVGSFKQIIAGEGAGALLTGFGPTLLGYSIQGA 88

Query: 96  VQFVVYEACKKHFFHVDGSKGREQLQNWQRLFSGALCGGCSVLATYPLDLVRTRLSIQTA 155
            +F  YE  KK F    G     + +N   + S A+    + +A  PL+  R RL     
Sbjct: 89  FKFGGYEVFKKFFIDNLGYDTASRYKNSVYMGSAAMAEFLADIALCPLEATRIRL----- 143

Query: 156 NLTKLSKSRAHNISKPPGVWDLLCRTYKEEGGIKGLYRGVWPTSLGVVPYVALNFAVYEQ 215
               +S+ +  N     G+     R  KEE GI   Y G  P     +PY    F V+E+
Sbjct: 144 ----VSQPQFAN-----GLVGGFSRILKEE-GIGSFYSGFTPILFKQIPYNIAKFLVFER 193

Query: 216 FKEFM------PEGTDNTLANFYKLSIGALSGGVAQTVTYPFDLLRRRFQVLAMGGNELG 269
             EF        E   +T      L  G  +G  A  V+ P D L  +         +  
Sbjct: 194 ASEFYYGFAGPKEKLSSTSTTLLNLLSGLTAGLAAAIVSQPADTLLSKVNKTKKAPGQ-- 251

Query: 270 FRYKSVMDALITIGKTEGFRGYYKGLTANLFKVIPSTAVSWLVY 313
               S +  L  + K  GF G + GL   L  V   T++ + +Y
Sbjct: 252 ----STVGLLAQLAKQLGFFGSFAGLPTRLVMVGTLTSLQFGIY 291

 Score = 47.8 bits (112), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 50/199 (25%), Positives = 76/199 (38%), Gaps = 25/199 (12%)

Query: 127 FSGALCGGCSVLATYPLDLVRTRLSIQTANLTKLSKSRAHNISKPPGVWDLLCRTYKEEG 186
            +GA+  G +  +  P+D+V+TR+ ++     K        I    G   LL        
Sbjct: 22  LAGAIGCGSTHSSMVPIDVVKTRIQLEPTVYNKGMVGSFKQIIAGEGAGALLT------- 74

Query: 187 GIKGLYRGVWPTSLGVVPYVALNFAVYEQFKEFMPEGTDNTLANFYKLSI----GALSGG 242
                  G  PT LG     A  F  YE FK+F  +      A+ YK S+     A++  
Sbjct: 75  -------GFGPTLLGYSIQGAFKFGGYEVFKKFFIDNLGYDTASRYKNSVYMGSAAMAEF 127

Query: 243 VAQTVTYPFDLLRRRFQVLAMGGNELGFRYKSVMDALITIGKTEGFRGYYKGLTANLFKV 302
           +A     P +  R R        N L   +  ++       K EG   +Y G T  LFK 
Sbjct: 128 LADIALCPLEATRIRLVSQPQFANGLVGGFSRIL-------KEEGIGSFYSGFTPILFKQ 180

Query: 303 IPSTAVSWLVYEVVCDLMH 321
           IP     +LV+E   +  +
Sbjct: 181 IPYNIAKFLVFERASEFYY 199

>KLLA0E18810g 1663220..1664353 some similarities with sp|P38152
           Saccharomyces cerevisiae YBR291c CTP1 citrate transport
           protein, mitochondrial (MCF), hypothetical start
          Length = 377

 Score = 69.3 bits (168), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 72/301 (23%), Positives = 126/301 (41%), Gaps = 42/301 (13%)

Query: 35  VSRTVVSPFERVKILLQVQNSTTA---------YNQGIVGAVRQVYREEGTPGLFRGNGL 85
           +  ++  PFE  K  LQ+ +  +          YN G    +  +Y   G P    GN  
Sbjct: 103 IEASITYPFEFAKTRLQLVDKASKASRNPLVLIYNTGKNYGISSIY--VGCPAFIVGNTA 160

Query: 86  NCIRIFPYSAVQFVVYEACKKHFFHVDGSKGREQLQNWQRLFSGALCGGC-SVLATYPLD 144
                   + ++F+ ++  K    ++   K   +L  ++ + +G   G   SV+A  P +
Sbjct: 161 K-------AGIRFLGFDTIK----NLLRDKKTGELSGFRGVVAGLGAGLLESVVAVTPFE 209

Query: 145 LVRTRL-SIQTANLTKLSKSRAHNISKPPGVWDLLCRTYKEEGGIKGLYRGVWPTSLGVV 203
            ++T L   + A + K   +    +S    +          + G  GLYRGV P S+   
Sbjct: 210 AIKTALIDDKQAAVPKYQNNGKGMVSNYAKLL--------SDQGFSGLYRGVLPVSMRQA 261

Query: 204 PYVALNFAVYEQFKEFMPEGT----DNTLANFYKLSIGALSGGVAQTVTYPFDLLRRRFQ 259
              A+    Y + K  + + T    D  L++     +GA SG V    T P D ++ R Q
Sbjct: 262 ANQAVRLGCYNKIKTLVQDYTNVPKDKPLSSGLTFIVGAFSGIVTVYTTMPIDTVKTRMQ 321

Query: 260 VLAMGGNELGFRYKSVMDALITIGKTEGFRGYYKGLTANLFKVIPSTAVSWLVYEVVCDL 319
            L  G      +Y S ++   TI K EG + ++KG T  L ++I S  + + +YE V  +
Sbjct: 322 SLNAG------QYSSTINCFATIFKEEGLKTFWKGATPRLGRLILSGGIVFTIYEKVLTV 375

Query: 320 M 320
           +
Sbjct: 376 L 376

 Score = 33.1 bits (74), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 20/94 (21%), Positives = 42/94 (44%), Gaps = 10/94 (10%)

Query: 231 FYKLSIGALSGGVAQTVTYPFDLLRRRFQVLAMGGNELGFRYKSVMDALITI---GKTEG 287
           F+    G+++G +  ++TYPF+  + R Q++           K+  + L+ I   GK  G
Sbjct: 91  FHSFLAGSIAGAIEASITYPFEFAKTRLQLVDKAS-------KASRNPLVLIYNTGKNYG 143

Query: 288 FRGYYKGLTANLFKVIPSTAVSWLVYEVVCDLMH 321
               Y G  A +        + +L ++ + +L+ 
Sbjct: 144 ISSIYVGCPAFIVGNTAKAGIRFLGFDTIKNLLR 177

 Score = 32.0 bits (71), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 30/144 (20%), Positives = 58/144 (40%), Gaps = 15/144 (10%)

Query: 114 SKGREQLQNWQRLFSGALCGGCSVLATYPLDLVRTRLSIQTANLTKLSKSRAHNISKPPG 173
           S  +  +  +    +G++ G      TYP +  +TRL +           +A   S+ P 
Sbjct: 82  SSNKPAVDPFHSFLAGSIAGAIEASITYPFEFAKTRLQLV---------DKASKASRNPL 132

Query: 174 VWDLLCRTYKEEGGIKGLYRGVWPTSLGVVPYVALNFAVYEQFKEFMPEGTDNTLANFYK 233
           V  L+  T K   GI  +Y G     +G      + F  ++  K  + +     L+ F  
Sbjct: 133 V--LIYNTGKNY-GISSIYVGCPAFIVGNTAKAGIRFLGFDTIKNLLRDKKTGELSGFRG 189

Query: 234 LSIGALSGGVAQTV--TYPFDLLR 255
           + +  L  G+ ++V    PF+ ++
Sbjct: 190 V-VAGLGAGLLESVVAVTPFEAIK 212

>AFR147C [3339] [Homologous to NOHBY] (703270..704217) [948 bp, 315
           aa]
          Length = 315

 Score = 68.9 bits (167), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 61/244 (25%), Positives = 114/244 (46%), Gaps = 25/244 (10%)

Query: 66  AVRQVYREEGTPGLFRGNGLNCIRIFPYSAVQFVVYEACKKHFFHVDGSKGREQLQNWQR 125
           AVR++YR+EG  G + G       +   S   +  YE   +    V GS+   +L   + 
Sbjct: 63  AVREIYRKEGVVGFYYGLESAMYGMAANSLNYYYFYELAARATMRVRGSR---RLNTSEA 119

Query: 126 LFSGALCGGCSVLATYPLDLVRTRLSIQTANLTKLSKSRAHNISKPPGVWDLLCRTYKEE 185
           + S A+ G  + +A+ P+ +V TR+++  +  + L+               +L    +++
Sbjct: 120 ILSSAVAGSMTAIASNPIWVVNTRMTVAKSEQSTLA---------------VLLDIVRKD 164

Query: 186 GGIKGLYRGVWPTSLGVVPYVALNFAVYEQFKEFMPE--GTDNTLANFYKLSIGALSGGV 243
            G+  L+ G+ P +L +V    + + V+EQ K  + +  G+D  L ++  L +GA+    
Sbjct: 165 -GVTALFNGLRP-ALMLVSNPIIQYTVFEQLKNVVLKWSGSDVLLPSWAFL-LGAVGKLA 221

Query: 244 AQTVTYPFDLLRRRFQVLAMGGNELGFRYKSVMDALITIGKTEGFRGYYKGLTANLFKVI 303
           A   TYP+  L+ R  +    G E     +S+   ++ I K EG +G Y G+   L + I
Sbjct: 222 ATGSTYPYITLKTRMHL--AKGKEDADTQQSMWSLMVDIVKKEGIQGLYHGIGVKLTQSI 279

Query: 304 PSTA 307
            + A
Sbjct: 280 LTAA 283

 Score = 32.3 bits (72), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 21/75 (28%), Positives = 38/75 (50%), Gaps = 1/75 (1%)

Query: 243 VAQTVTYPFDLLRRRFQVLAMGGNELGFRYKSVMDALITIGKTEGFRGYYKGLTANLFKV 302
           ++  +T P   L  R QV +    E G R KS ++A+  I + EG  G+Y GL + ++ +
Sbjct: 29  LSMALTMPLVTLATRMQV-SEQDKEPGTRSKSKLEAVREIYRKEGVVGFYYGLESAMYGM 87

Query: 303 IPSTAVSWLVYEVVC 317
             ++   +  YE+  
Sbjct: 88  AANSLNYYYFYELAA 102

>Scas_669.6
          Length = 373

 Score = 68.9 bits (167), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 51/181 (28%), Positives = 87/181 (48%), Gaps = 18/181 (9%)

Query: 35  VSRTVVSPFERVKILLQVQNST------TAYN-QGIVGAVRQVYREEGTPGLFRGNGLNC 87
           VS  V  P E +K  LQ+Q         + YN + +  A+R +   EG   LF G     
Sbjct: 159 VSSFVYVPSEVLKTRLQLQGRVNNPFFQSGYNYRSLRTAIRIIVNTEGVKALFFGYKATL 218

Query: 88  IRIFPYSAVQFVVYEACKKHFFHVDGSK-GREQLQNWQRLFSGALCGGCSVLATYPLDLV 146
            R  P+SA+QF  YE  ++  F ++     +  L     +F+GA+ GG + + T P+D++
Sbjct: 219 ARDLPFSALQFGFYEKFRQTAFKLEKKDITKHNLSIPNEIFTGAIAGGLAGIITTPMDVI 278

Query: 147 RTRLSIQTANLTKLS-------KSRAHNISKPPGVWDLLCRTYK---EEGGIKGLYRGVW 196
           +TRL  Q A++   S        ++ +  S+P  + + + R+ K   +  G+ G + GV 
Sbjct: 279 KTRLQTQQADINPNSATTVGAISAKTNKKSRPIVLSNSIFRSLKLVYQSEGVIGFFSGVG 338

Query: 197 P 197
           P
Sbjct: 339 P 339

 Score = 61.6 bits (148), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 72/293 (24%), Positives = 123/293 (41%), Gaps = 42/293 (14%)

Query: 53  QNSTTAYNQGIVGAVRQVYREEGTP-GLFRGNGLNCIRIFPYSAVQFVVYEACKKHFFHV 111
           +N TTAY        R ++ EEG   GL+ G     +  FP +A+ F  YE CK+     
Sbjct: 89  KNMTTAY--------RTIFLEEGIARGLYGGYFAAMLGSFPSAAIFFGTYEWCKRKMI-- 138

Query: 112 DGSKGREQLQNWQRLFSGALCGGCSVLATYPLDLVRTRLSIQTANLTKLSKSRAHNISKP 171
            G  G         L +G L    S     P ++++TRL +Q        +S  +N    
Sbjct: 139 -GDLGFND--TVSHLSAGLLGDFVSSFVYVPSEVLKTRLQLQGRVNNPFFQS-GYNYRSL 194

Query: 172 PGVWDLLCRTYKEEGGIKGLYRGVWPTSLGVVPYVALNFAVYEQFKE--FMPEGTDNTLA 229
                ++  T     G+K L+ G   T    +P+ AL F  YE+F++  F  E  D T  
Sbjct: 195 RTAIRIIVNTE----GVKALFFGYKATLARDLPFSALQFGFYEKFRQTAFKLEKKDITKH 250

Query: 230 NFY---KLSIGALSGGVAQTVTYPFDLLRRRFQV----------LAMGGNELGFRYK--- 273
           N     ++  GA++GG+A  +T P D+++ R Q             +G        K   
Sbjct: 251 NLSIPNEIFTGAIAGGLAGIITTPMDVIKTRLQTQQADINPNSATTVGAISAKTNKKSRP 310

Query: 274 -----SVMDALITIGKTEGFRGYYKGLTANLFKVIPSTAVSWLVYEVVCDLMH 321
                S+  +L  + ++EG  G++ G+          +++  L+Y++   L++
Sbjct: 311 IVLSNSIFRSLKLVYQSEGVIGFFSGVGPRFVWTSVQSSIMLLLYQMTLRLLN 363

>CAGL0L02079g 243467..244360 highly similar to sp|P38152
           Saccharomyces cerevisiae YBR291c CTP1 citrate transport
           protein, hypothetical start
          Length = 297

 Score = 68.2 bits (165), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 68/303 (22%), Positives = 129/303 (42%), Gaps = 22/303 (7%)

Query: 19  KNDSNVAFXXXXXXXXVSRTVVSPFERVKILLQVQNSTTAYNQGIVGAVRQVYREEGTPG 78
           K D   +F        V  ++  PFE  K  LQ+ + ++  ++  +  +    + +G   
Sbjct: 7   KVDPTKSFVAGALAGAVEASITYPFEFAKTRLQLIDKSSKASRNPLVLIYNTAKTQGVGA 66

Query: 79  LFRGNGLNCIRIFPYSAVQFVVYEACKKHFFHVDGSKGREQLQNWQRLFSGALCGGC-SV 137
           ++ G     +     +A +F+ Y+  +    ++   K   +L   + + +G   G   SV
Sbjct: 67  IYVGCPAFIVGNTAKAATRFLGYDTIR----NLLKDKKTGELSGPRGVLAGLGAGLLESV 122

Query: 138 LATYPLDLVRTRLSIQTANLTKLSKSRAHNISKPPGVWDLLCRTYKEEGGIKGLYRGVWP 197
           +A  P + ++T L     ++    ++   ++++            K+EG  +GLY GV P
Sbjct: 123 VAVTPFEAIKTVLIDDKQSVRPKYQNNGRSMARN------YISLVKDEG-FRGLYGGVLP 175

Query: 198 TSLGVVPYVALNFAVYEQFKEFMPEGT----DNTLANFYKLSIGALSGGVAQTVTYPFDL 253
            S+      A+    Y + K  + + T    D  L +     +GA SG V    T P D 
Sbjct: 176 VSMRQAANQAVRLGCYNKIKVLVQDYTGAPKDKPLTSGLTFIVGAFSGVVTVYATMPIDT 235

Query: 254 LRRRFQVLAMGGNELGFRYKSVMDALITIGKTEGFRGYYKGLTANLFKVIPSTAVSWLVY 313
           ++ R Q L         +Y S ++   TI K EG + ++KG T  L ++I S  + + +Y
Sbjct: 236 VKTRMQSLTAS------KYSSTLNCFTTIYKEEGLKTFWKGATPRLGRLILSGGIVFTIY 289

Query: 314 EVV 316
           E V
Sbjct: 290 ENV 292

 Score = 41.2 bits (95), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 50/190 (26%), Positives = 81/190 (42%), Gaps = 26/190 (13%)

Query: 114 SKGREQLQNWQRLFSGALCGGCSVLATYPLDLVRTRLSIQTANLTKLSKSRAHNISKPPG 173
           SK  +++   +   +GAL G      TYP +  +TRL +    + K SK+     S+ P 
Sbjct: 2   SKDSKKVDPTKSFVAGALAGAVEASITYPFEFAKTRLQL----IDKSSKA-----SRNPL 52

Query: 174 VWDLLCRTYKEEGGIKGLYRGVWPTSLGVVPYVALNFAVYEQFKEFMPEGTDNTLAN--- 230
           V  L+  T K + G+  +Y G     +G     A  F  Y+  +  + +     L+    
Sbjct: 53  V--LIYNTAKTQ-GVGAIYVGCPAFIVGNTAKAATRFLGYDTIRNLLKDKKTGELSGPRG 109

Query: 231 -FYKLSIGALSGGVAQTVTYPFDLLRRRFQVLAMGGNELGFRY----KSVMDALITIGKT 285
               L  G L   VA T   PF+ ++    VL      +  +Y    +S+    I++ K 
Sbjct: 110 VLAGLGAGLLESVVAVT---PFEAIK---TVLIDDKQSVRPKYQNNGRSMARNYISLVKD 163

Query: 286 EGFRGYYKGL 295
           EGFRG Y G+
Sbjct: 164 EGFRGLYGGV 173

>CAGL0F00231g 29705..30628 highly similar to sp|P23641 Saccharomyces
           cerevisiae YJR077c MIR1, hypothetical start
          Length = 307

 Score = 68.2 bits (165), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 76/281 (27%), Positives = 115/281 (40%), Gaps = 35/281 (12%)

Query: 42  PFERVKILLQVQNSTTAYNQGIVGAVRQVYREEGTPGLFRGNGLNCIRIFPYSAVQFVVY 101
           P + VK  +Q++   T YN+G+VG+ R++  EEG   L  G G   +      A +F  Y
Sbjct: 33  PIDVVKTRIQLE--PTVYNKGMVGSFRKIIAEEGAGALLTGFGPTLLGYSIQGAFKFGGY 90

Query: 102 EACKKHFFHVDGSKGREQLQNWQRLFSGALCGGCSVLATYPLDLVRTRLSIQTANLTKLS 161
           E  KK F    G     + +N   + S A     + +A  PL+  R RL           
Sbjct: 91  EVFKKFFIDTLGYDTAARYKNSVYIGSAAAAEFLADIALCPLEATRIRL----------- 139

Query: 162 KSRAHNISKPP---GVWDLLCRTYKEEGGIKGLYRGVWPTSLGVVPYVALNFAVYEQFKE 218
                 +S+P    G+     R  KEE G+   Y G  P     +PY    F V+E+  E
Sbjct: 140 ------VSQPTFANGLVGGFSRILKEE-GVGSFYSGFTPILFKQIPYNIAKFLVFERASE 192

Query: 219 --FMPEGTDNTLANFYKLSIGALSG---GVAQT-VTYPFDLLRRRFQVLAMGGNELGFRY 272
             F      +TL+     +I  LSG   G+A   V+ P D L  +    +    +     
Sbjct: 193 LYFSLAPPKDTLSQTSLTAINLLSGLTAGLAAAIVSQPADTLLSKVNKTSKAPGQ----- 247

Query: 273 KSVMDALITIGKTEGFRGYYKGLTANLFKVIPSTAVSWLVY 313
            S +  L  + K  GF G + GL   L  V   T++ + +Y
Sbjct: 248 -STVGLLFQLAKQLGFVGSFAGLPTRLVMVGTLTSLQFGIY 287

 Score = 48.9 bits (115), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 52/197 (26%), Positives = 77/197 (39%), Gaps = 25/197 (12%)

Query: 127 FSGALCGGCSVLATYPLDLVRTRLSIQTANLTKLSKSRAHNISKPPGVWDLLCRTYKEEG 186
            +GA+  G +  +  P+D+V+TR+ ++     K             G+     +   EEG
Sbjct: 18  LAGAIGCGSTHSSMVPIDVVKTRIQLEPTVYNK-------------GMVGSFRKIIAEEG 64

Query: 187 GIKGLYRGVWPTSLGVVPYVALNFAVYEQFKEFMPEGTDNTLANFYKLSI----GALSGG 242
               L  G  PT LG     A  F  YE FK+F  +      A  YK S+     A +  
Sbjct: 65  A-GALLTGFGPTLLGYSIQGAFKFGGYEVFKKFFIDTLGYDTAARYKNSVYIGSAAAAEF 123

Query: 243 VAQTVTYPFDLLRRRFQVLAMGGNELGFRYKSVMDALITIGKTEGFRGYYKGLTANLFKV 302
           +A     P +  R R        N L   +  ++       K EG   +Y G T  LFK 
Sbjct: 124 LADIALCPLEATRIRLVSQPTFANGLVGGFSRIL-------KEEGVGSFYSGFTPILFKQ 176

Query: 303 IPSTAVSWLVYEVVCDL 319
           IP     +LV+E   +L
Sbjct: 177 IPYNIAKFLVFERASEL 193

>AFR146W [3338] [Homologous to ScYOR130C (ORT1) - SH]
           complement(702404..703249) [846 bp, 281 aa]
          Length = 281

 Score = 67.8 bits (164), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 76/289 (26%), Positives = 129/289 (44%), Gaps = 32/289 (11%)

Query: 35  VSRTVVSPFERVKILLQVQNSTTAYNQGIVGAVRQVYREEGT-PGLFRGNGLNCIRIFPY 93
           + + V  PF+ VK+ LQ Q++  A        V   Y++EG   G ++G        F  
Sbjct: 21  LGKLVEYPFDTVKVRLQTQSA--ALFPTTWSCVSHTYKQEGLWRGFYQGMASPVFGAFLE 78

Query: 94  SAVQFVVYEACKKHFFHVDGSKGREQLQNWQRLFSGALCGGCSVLATYPLDLVRTRLSIQ 153
            AV FV +   +    +       E++     +F+GA+ G C+     P++LV+ +L  Q
Sbjct: 79  HAVLFVSFNRAQAVLENCYSCGPLEKV-----VFAGAIAGACTSYVLTPVELVKCKL--Q 131

Query: 154 TANLTKLSKSRAHNISKPPGVWDLLCRTYKEEGGIKGLYRGVWPTSLGVVPYVALNFAVY 213
            +NLT +S  R   +           R   ++ G+ GL++G   T +      A+ F  Y
Sbjct: 132 VSNLTGVSGPRYTAVLPT-------LRAIVKQNGLGGLWQGQSGTFIRESAGGAVWFTAY 184

Query: 214 EQFKEFMPE---GTDNTLANFYKLSIGALSGGVAQTVTYPFDLLRRRFQVLAMGGNELGF 270
           E  K ++      T+NT+     L+ GA +G       +P D ++   Q   +G   LG 
Sbjct: 185 EVLKGWLARRRGSTENTVWEL--LASGAGAGAAFHASIFPADTVKSTMQTEHLG---LG- 238

Query: 271 RYKSVMDALITIGKTEGFRGYYKGLTANLFKVIPSTAVSWLVYEVVCDL 319
                  A+ T+ K  G  G+Y+G+   L + +P+ AV + VYE +C L
Sbjct: 239 ------PAVRTVLKKHGPTGFYRGVGITLLRALPANAVIFYVYESLCGL 281

 Score = 63.2 bits (152), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 53/203 (26%), Positives = 82/203 (40%), Gaps = 29/203 (14%)

Query: 121 QNWQRLFSGALCGGCSVLATYPLDLVRTRLSIQTANLTKLSKSRAHNISKPPGVWDLLCR 180
           + ++ L  G + G    L  YP D V+ RL  Q+A L              P  W  +  
Sbjct: 7   KAYKDLLYGGVAGSLGKLVEYPFDTVKVRLQTQSAALF-------------PTTWSCVSH 53

Query: 181 TYKEEGGIKGLYRGVWPTSLGVVPYVALNFAVYEQFKEFMPEGTDNTLANFYKLS----- 235
           TYK+EG  +G Y+G+     G     A+ F  + +            L N Y        
Sbjct: 54  TYKQEGLWRGFYQGMASPVFGAFLEHAVLFVSFNR--------AQAVLENCYSCGPLEKV 105

Query: 236 --IGALSGGVAQTVTYPFDLLRRRFQVLAMGGNELGFRYKSVMDALITIGKTEGFRGYYK 293
              GA++G     V  P +L++ + QV  + G   G RY +V+  L  I K  G  G ++
Sbjct: 106 VFAGAIAGACTSYVLTPVELVKCKLQVSNLTGVS-GPRYTAVLPTLRAIVKQNGLGGLWQ 164

Query: 294 GLTANLFKVIPSTAVSWLVYEVV 316
           G +    +     AV +  YEV+
Sbjct: 165 GQSGTFIRESAGGAVWFTAYEVL 187

>Scas_489.4
          Length = 297

 Score = 67.8 bits (164), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 68/297 (22%), Positives = 125/297 (42%), Gaps = 22/297 (7%)

Query: 25  AFXXXXXXXXVSRTVVSPFERVKILLQVQNSTTAYNQGIVGAVRQVYREEGTPGLFRGNG 84
           +F        +  ++  PFE  K  LQ+ + T+  ++  +  +    + +GT  ++ G  
Sbjct: 13  SFIAGALAGAIEASITYPFEFAKTRLQLIDKTSTASRNPLVLIYNTAKTQGTGAIYVGCP 72

Query: 85  LNCIRIFPYSAVQFVVYEACKKHFFHVDGSKGREQLQNWQRLFSGALCGGC-SVLATYPL 143
              +     + ++F+ ++  K      D   G  +L   + + +G   G   SV+A  P 
Sbjct: 73  AFIVGNTAKAGIRFLGFDTIKNMLR--DPVTG--ELSGPRGVVAGLGAGLLESVVAVTPF 128

Query: 144 DLVRTRLSIQTANLTKLSKSRAHNISKPPGVWDLLCRTYKEEGGIKGLYRGVWPTSLGVV 203
           + ++T L      L    ++    + +  G       +   + GI GLYRGV P S+   
Sbjct: 129 EAIKTALIDDKQALKPKYQNNGRGMLRNYG-------SLVRDQGIMGLYRGVLPVSMRQA 181

Query: 204 PYVALNFAVYEQFKEFMPEGT----DNTLANFYKLSIGALSGGVAQTVTYPFDLLRRRFQ 259
              A+    Y + K  + + T    D  L++     +GA SG V    T P D ++ R Q
Sbjct: 182 ANQAVRLGCYNKIKTMVQDYTNAPKDRPLSSGLTFIVGAFSGVVTVYTTMPIDTVKTRMQ 241

Query: 260 VLAMGGNELGFRYKSVMDALITIGKTEGFRGYYKGLTANLFKVIPSTAVSWLVYEVV 316
            L         +Y S ++    I K EG + ++KG T  L ++I S  + + +YE V
Sbjct: 242 SLD------ATKYTSTVNCFAKIFKEEGLKTFWKGATPRLGRLILSGGIVFTIYENV 292

 Score = 33.1 bits (74), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 17/85 (20%), Positives = 41/85 (48%), Gaps = 4/85 (4%)

Query: 237 GALSGGVAQTVTYPFDLLRRRFQVLAMGGNELGFRYKSVMDALITIGKTEGFRGYYKGLT 296
           GAL+G +  ++TYPF+  + R Q++    ++     ++ +  +    KT+G    Y G  
Sbjct: 17  GALAGAIEASITYPFEFAKTRLQLI----DKTSTASRNPLVLIYNTAKTQGTGAIYVGCP 72

Query: 297 ANLFKVIPSTAVSWLVYEVVCDLMH 321
           A +        + +L ++ + +++ 
Sbjct: 73  AFIVGNTAKAGIRFLGFDTIKNMLR 97

>Sklu_1926.2 YPR058W, Contig c1926 347-1264 reverse complement
          Length = 305

 Score = 67.8 bits (164), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 78/325 (24%), Positives = 134/325 (41%), Gaps = 29/325 (8%)

Query: 4   LAQVLPQPSYVKSIL-KNDSNVAFXXXXXXXX--VSRTVVS-PFERVKILLQVQN-STTA 58
           + + LP P  +  +   +DS   F          VS+ ++  PF+  K+ LQ  +  TTA
Sbjct: 1   MTEELPTPLIIDDLDGAHDSTRVFKDLLAGTAGGVSQVLIGQPFDTTKVRLQTSSVPTTA 60

Query: 59  YNQGIVGAVRQVYREEGTPGLFRGNGLNCIRIFPYSAVQFVVYEACKKHFFHVDGSKG-R 117
            +      V+++ + EG  G ++G     + +    +VQF V EA K+ F   +G+ G  
Sbjct: 61  LD-----VVKKLVKNEGFRGFYKGTLTPLVGVGACVSVQFGVNEAMKRFFHSRNGNSGPN 115

Query: 118 EQLQNWQRLFSGALCGGCSVLATYPLDLVRTRLSIQTANLTKLSKSRAHNISKPPGVWDL 177
           E L   Q    G   G  +     P++ VR RL  QT          A     P     L
Sbjct: 116 ETLGLLQYYLCGFAGGTANSFLASPIEHVRIRLQTQTGT------GAAAQFHGP-----L 164

Query: 178 LCRTYKEEGGIKGLYRGVWPTSLGVVPYVALNFAVYEQF-KEFMPEGTDNTLANFYKLSI 236
            C   K+      L RG+ PT L       + F  YE      + +G   +    +KL +
Sbjct: 165 DC--IKKLTANNSLMRGLTPTMLRESHGCGVYFLTYEALIANELHKGVSRSEIPTWKLCL 222

Query: 237 -GALSGGVAQTVTYPFDLLRRRFQVLAMGGNELGFRYKSVMDALITIGKTEGFRGYYKGL 295
            GA SG     + YP D+++   Q  ++   + G   K+++    TI  T G   ++KG 
Sbjct: 223 FGATSGTTLWLMIYPLDVIKSVMQTDSLLQPKQG---KNMLQVAKTIYSTRGLSSFFKGF 279

Query: 296 TANLFKVIPSTAVSWLVYEVVCDLM 320
              + +  P+   ++  +E+   ++
Sbjct: 280 GPTMLRAAPANGATFATFELAMRVL 304

 Score = 38.5 bits (88), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 26/91 (28%), Positives = 42/91 (46%), Gaps = 9/91 (9%)

Query: 232 YKLSIGALSGGVAQT-VTYPFDLLRRRFQVLAMGGNELGFRYKSVMDALITIGKTEGFRG 290
           +K  +   +GGV+Q  +  PFD  + R Q  ++          + +D +  + K EGFRG
Sbjct: 24  FKDLLAGTAGGVSQVLIGQPFDTTKVRLQTSSV--------PTTALDVVKKLVKNEGFRG 75

Query: 291 YYKGLTANLFKVIPSTAVSWLVYEVVCDLMH 321
           +YKG    L  V    +V + V E +    H
Sbjct: 76  FYKGTLTPLVGVGACVSVQFGVNEAMKRFFH 106

>CAGL0F07711g complement(751794..752900) similar to sp|Q03829
           Saccharomyces cerevisiae YMR166c, hypothetical start
          Length = 368

 Score = 68.2 bits (165), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 46/145 (31%), Positives = 73/145 (50%), Gaps = 9/145 (6%)

Query: 36  SRTVVSPFERVKILLQVQ------NSTTAYN-QGIVGAVRQVYREEGTPGLFRGNGLNCI 88
           S  V  P E +K  LQ+Q      +  + YN + +  A+  +YR EG   LF G      
Sbjct: 162 SSFVYVPSEVLKTRLQLQGCYNNPHFNSGYNYKSLRNAIATIYRTEGVAALFFGYKATLA 221

Query: 89  RIFPYSAVQFVVYEACKKHFFHVDGSK-GREQLQNWQRLFSGALCGGCSVLATYPLDLVR 147
           R  P+SA+QF  YE  ++  F ++G    +  L     + +GA  GG + + T PLD+V+
Sbjct: 222 RDLPFSALQFAFYEKFRQWAFLLEGKDIYKHDLSISNEIVTGACAGGLAGILTTPLDVVK 281

Query: 148 TRLSIQTANLTKLS-KSRAHNISKP 171
           TR+  Q  +   +S  ++  N+SKP
Sbjct: 282 TRVQTQLPSQIDISTDTKIKNVSKP 306

 Score = 65.9 bits (159), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 57/196 (29%), Positives = 86/196 (43%), Gaps = 18/196 (9%)

Query: 123 WQRLFSGALCGGCSVLATYPLDLVRTRLSIQTANLTKLSKSRAHNISKPPGVWDLLCRTY 182
           W    +G + G     A + LD V+TR            +  A N+ K   +       +
Sbjct: 54  WHCFLAGGVGGIIGDSAMHSLDTVKTR------------QQGAPNVHKYKHMLQAYRTMF 101

Query: 183 KEEGGIKGLYRGVWPTSLGVVPYVALNFAVYEQFKEFMPEGTDNTLAN-FYKLSIGALSG 241
            EEG  +GLY G     LG  P  A+ F+ YE  K  M    D  L + F  L+ G L  
Sbjct: 102 IEEGFRRGLYGGYCAAMLGSFPSAAIFFSTYEFTKRTMIN--DYHLNDTFSHLTAGFLGD 159

Query: 242 GVAQTVTYPFDLLRRRFQVLAMGGN---ELGFRYKSVMDALITIGKTEGFRGYYKGLTAN 298
             +  V  P ++L+ R Q+     N     G+ YKS+ +A+ TI +TEG    + G  A 
Sbjct: 160 FFSSFVYVPSEVLKTRLQLQGCYNNPHFNSGYNYKSLRNAIATIYRTEGVAALFFGYKAT 219

Query: 299 LFKVIPSTAVSWLVYE 314
           L + +P +A+ +  YE
Sbjct: 220 LARDLPFSALQFAFYE 235

 Score = 59.3 bits (142), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 54/207 (26%), Positives = 99/207 (47%), Gaps = 22/207 (10%)

Query: 63  IVGAVRQVYREEG-TPGLFRGNGLNCIRIFPYSAVQFVVYEACKKHF---FHVDGSKGRE 118
           ++ A R ++ EEG   GL+ G     +  FP +A+ F  YE  K+     +H++ +    
Sbjct: 93  MLQAYRTMFIEEGFRRGLYGGYCAAMLGSFPSAAIFFSTYEFTKRTMINDYHLNDT---- 148

Query: 119 QLQNWQRLFSGALCGGCSVLATYPLDLVRTRLSIQTANLTKLSKSRAHNISKPPGVWDLL 178
               +  L +G L    S     P ++++TRL +Q       +    ++      + + +
Sbjct: 149 ----FSHLTAGFLGDFFSSFVYVPSEVLKTRLQLQGC----YNNPHFNSGYNYKSLRNAI 200

Query: 179 CRTYKEEGGIKGLYRGVWPTSLGVVPYVALNFAVYEQFKE--FMPEGTD---NTLANFYK 233
              Y+ EG +  L+ G   T    +P+ AL FA YE+F++  F+ EG D   + L+   +
Sbjct: 201 ATIYRTEG-VAALFFGYKATLARDLPFSALQFAFYEKFRQWAFLLEGKDIYKHDLSISNE 259

Query: 234 LSIGALSGGVAQTVTYPFDLLRRRFQV 260
           +  GA +GG+A  +T P D+++ R Q 
Sbjct: 260 IVTGACAGGLAGILTTPLDVVKTRVQT 286

>ADL264C [1477] [Homologous to ScYOR100C (CRC1) - SH]
           (241532..242521) [990 bp, 329 aa]
          Length = 329

 Score = 67.8 bits (164), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 47/172 (27%), Positives = 72/172 (41%), Gaps = 23/172 (13%)

Query: 39  VVSPFERVKILLQVQNSTTAYNQGIVGAVRQVYREEGTPGLFRGNGLNCIRIFPYSAVQF 98
           V++P ERVK++LQ Q+     N  +  A + +    G   LFRG+     R  P SA+ F
Sbjct: 166 VMAPTERVKVVLQTQS-----NHSLGSAAKHILATGGVRSLFRGSLATLARDGPGSALYF 220

Query: 99  VVYEACKKHFFHVDGSKGREQLQNWQRLFSGALCGGCSVLATYPLDLVRTRLSIQTANLT 158
             YEA K +    +   G  +L       +G + G    +  +P+D ++T L       T
Sbjct: 221 ASYEATKAYL---NARSGTNELSIKNVCLAGGMAGVSMWVGVFPIDTIKTELQSSNTRQT 277

Query: 159 KLSKSRAHNISKPPGVWDLLCRTYKEEGGIKGLYRGVWPTSLGVVPYVALNF 210
            +  +R               + Y   GGIKG + G+ P  L   P  A  F
Sbjct: 278 MMEATR---------------KIYNTRGGIKGFFPGIGPALLRSFPANAATF 314

 Score = 52.8 bits (125), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 52/218 (23%), Positives = 90/218 (41%), Gaps = 27/218 (12%)

Query: 103 ACKKHFFHVDGSKGREQLQNWQRLFSGALCGGCSVLATYPLDLVRTRLSIQTANLTKLSK 162
           A ++   HV   K     +N + L +GA+ G C+VL  +P DL++ R     A+ T    
Sbjct: 28  AIEEPSVHVGTPKSNALYENAKSLAAGAVGGVCAVLTGHPFDLLKVRCQSNQASGTV--- 84

Query: 163 SRAHNISKPPGVWDLLCRTYKEEG-----GIKGLYRGVWPTSLGVVPYVALNFAVYEQFK 217
                      V  +L     + G      ++G Y+GV P  LGV P  A++F  Y+  K
Sbjct: 85  ---------DAVRKILVEARAQSGLSAVNMMRGFYKGVIPPLLGVTPIFAVSFWGYDVGK 135

Query: 218 EFMPEGTDNTLANFYKLSIGALSGGVAQT-VTYPFDLLRRRFQVLAMGGNELGFRYKSVM 276
           + +    ++      +L+       +  T V  P + ++   Q      + LG   K ++
Sbjct: 136 KLVTWNDNSGKLTTAQLATAGFISAIPTTLVMAPTERVKVVLQT--QSNHSLGSAAKHIL 193

Query: 277 DALITIGKTEGFRGYYKGLTANLFKVIPSTAVSWLVYE 314
                   T G R  ++G  A L +  P +A+ +  YE
Sbjct: 194 -------ATGGVRSLFRGSLATLARDGPGSALYFASYE 224

 Score = 49.3 bits (116), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 69/295 (23%), Positives = 118/295 (40%), Gaps = 55/295 (18%)

Query: 42  PFERVKILLQVQNSTTAYNQGIVGAVRQVYREEGTP----------GLFRGNGLNCIRIF 91
           PF+ +K+  Q   ++     G V AVR++  E              G ++G     + + 
Sbjct: 67  PFDLLKVRCQSNQAS-----GTVDAVRKILVEARAQSGLSAVNMMRGFYKGVIPPLLGVT 121

Query: 92  PYSAVQFVVYEACKKHFFHVDGSKGREQLQNWQRLFSGALCGGCSVLATYPLDLVRTRLS 151
           P  AV F  Y+  KK     D S    +L   Q   +G +    + L   P +  R ++ 
Sbjct: 122 PIFAVSFWGYDVGKKLVTWNDNSG---KLTTAQLATAGFISAIPTTLVMAPTE--RVKVV 176

Query: 152 IQTANLTKLSKSRAHNISKPPGVWDLLCRTYKEEGGIKGLYRGVWPTSLGVVPYVALNFA 211
           +QT +   L  +  H ++                GG++ L+RG   T     P  AL FA
Sbjct: 177 LQTQSNHSLGSAAKHILAT---------------GGVRSLFRGSLATLARDGPGSALYFA 221

Query: 212 VYEQFKEFMPEGTDNTLANFYKLSIG--ALSGGVAQTV----TYPFDLLRRRFQVLAMGG 265
            YE  K ++     N  +   +LSI    L+GG+A        +P D ++   Q      
Sbjct: 222 SYEATKAYL-----NARSGTNELSIKNVCLAGGMAGVSMWVGVFPIDTIKTELQS----- 271

Query: 266 NELGFRYKSVMDALITIGKTE-GFRGYYKGLTANLFKVIPSTAVSWLVYEVVCDL 319
                  +++M+A   I  T  G +G++ G+   L +  P+ A ++L  E+   L
Sbjct: 272 ---SNTRQTMMEATRKIYNTRGGIKGFFPGIGPALLRSFPANAATFLGVELTHSL 323

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 31/88 (35%), Positives = 42/88 (47%), Gaps = 3/88 (3%)

Query: 230 NFYKLSIGALSGGVAQTVTYPFDLLRRRFQVLAMGGNELGFRYKSVMDALITIG--KTEG 287
           N   L+ GA+ G  A    +PFDLL+ R Q     G     R K +++A    G      
Sbjct: 47  NAKSLAAGAVGGVCAVLTGHPFDLLKVRCQSNQASGTVDAVR-KILVEARAQSGLSAVNM 105

Query: 288 FRGYYKGLTANLFKVIPSTAVSWLVYEV 315
            RG+YKG+   L  V P  AVS+  Y+V
Sbjct: 106 MRGFYKGVIPPLLGVTPIFAVSFWGYDV 133

>ACR109W [1156] [Homologous to ScYOR222W (ODC2) - SH; ScYPL134C
           (ODC1) - SH] complement(546745..547644) [900 bp, 299 aa]
          Length = 299

 Score = 66.6 bits (161), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 67/284 (23%), Positives = 120/284 (42%), Gaps = 23/284 (8%)

Query: 39  VVSPFERVK--ILLQVQNSTTAYNQGIVGAVRQVYREEGTPGLFRGNGLNCIRIFPYSAV 96
           V+ P + VK  + LQVQ     +  G+V  ++++   EG   L++G     +   P  A 
Sbjct: 28  VMYPLDVVKTRMQLQVQGGAGPHYTGVVDCLKKIVAGEGVGRLYKGISSPILMEAPKRAT 87

Query: 97  QFVVYEACKKHFFHV-DGSKGREQLQNWQRLFSGALCGGCSVLATYPLDLVRTRLSIQTA 155
           +F    AC   F  +   + G E+L     + +GA  G        P +LV+ RL  Q A
Sbjct: 88  KF----ACNDEFQKLYKQAFGVEKLSQPLSMLAGASAGCVEAFVVVPFELVKIRL--QDA 141

Query: 156 NLTKLSKSRAHNISKPPGVWDLLCRTYKEEGGIKGLYRGVWPTSLGVVPYVALNFAVYEQ 215
           +            S   G  D++ +    EG +  +Y G+  T      +    F +  Q
Sbjct: 142 S------------SSYKGPVDVVRKIVAREG-VLAMYNGLESTLWRHALWNGGYFGIIFQ 188

Query: 216 FKEFMPEGTDNTLANFYKLSIGALSGGVAQTVTYPFDLLRRRFQVLAMGGNELGFRYKSV 275
            +  +P   + T      L   ++   +   ++ PFD+++ R Q  A+    +  +Y   
Sbjct: 189 ARALLPAAHNKTQCITNDLISDSIGCSIGCMLSTPFDVVKSRIQNTAVIPGVVR-KYNWS 247

Query: 276 MDALITIGKTEGFRGYYKGLTANLFKVIPSTAVSWLVYEVVCDL 319
           + +L+TI + EGFR  YKG    + ++ P   +  +V+  V D 
Sbjct: 248 LPSLLTIYREEGFRALYKGFVPKVLRLGPGGGILLVVFTGVLDF 291

 Score = 60.8 bits (146), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 50/178 (28%), Positives = 80/178 (44%), Gaps = 18/178 (10%)

Query: 125 RLFSGALCGGCSVLATYPLDLVRTRLSIQTANLTKLSKSRAHNISKPPGVWDLLCRTYKE 184
           + F+GA+ G   +L  YPLD+V+TR+ +Q         +  H      GV D L +    
Sbjct: 14  QFFAGAVAGVSEILVMYPLDVVKTRMQLQVQG-----GAGPHYT----GVVDCLKKIVAG 64

Query: 185 EGGIKGLYRGVWPTSLGVVPYVALNFAVYEQFKEFMPEGTD-NTLANFYKLSIGALSGGV 243
           E G+  LY+G+    L   P  A  FA  ++F++   +      L+    +  GA +G V
Sbjct: 65  E-GVGRLYKGISSPILMEAPKRATKFACNDEFQKLYKQAFGVEKLSQPLSMLAGASAGCV 123

Query: 244 AQTVTYPFDLLRRRFQVLAMGGNELGFRYKSVMDALITIGKTEGFRGYYKGLTANLFK 301
              V  PF+L++ R Q       +    YK  +D +  I   EG    Y GL + L++
Sbjct: 124 EAFVVVPFELVKIRLQ-------DASSSYKGPVDVVRKIVAREGVLAMYNGLESTLWR 174

 Score = 43.1 bits (100), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 27/91 (29%), Positives = 41/91 (45%), Gaps = 2/91 (2%)

Query: 220 MPEGTDNTLANFYKLSIGALSGGVAQTVTYPFDLLRRRFQVLAMGGNELGFRYKSVMDAL 279
           M      +L   Y+   GA++G     V YP D+++ R Q+   GG   G  Y  V+D L
Sbjct: 1   MSSSDTKSLPFLYQFFAGAVAGVSEILVMYPLDVVKTRMQLQVQGGA--GPHYTGVVDCL 58

Query: 280 ITIGKTEGFRGYYKGLTANLFKVIPSTAVSW 310
             I   EG    YKG+++ +    P  A  +
Sbjct: 59  KKIVAGEGVGRLYKGISSPILMEAPKRATKF 89

 Score = 39.3 bits (90), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 50/188 (26%), Positives = 91/188 (48%), Gaps = 22/188 (11%)

Query: 35  VSRTVVSPFERVKILLQVQNSTTAYNQGIVGAVRQVYREEGTPGLFRGNGLNCIRIFPYS 94
           V   VV PFE VKI  ++Q+++++Y +G V  VR++   EG   ++ G      R   ++
Sbjct: 123 VEAFVVVPFELVKI--RLQDASSSY-KGPVDVVRKIVAREGVLAMYNGLESTLWRHALWN 179

Query: 95  AVQF-VVYEACKKHFFHVDGSKGREQLQNWQRLFSGALCGGCSV--LATYPLDLVRTRLS 151
              F ++++A  +       +K +    +   L S ++  GCS+  + + P D+V++R+ 
Sbjct: 180 GGYFGIIFQA--RALLPAAHNKTQCITND---LISDSI--GCSIGCMLSTPFDVVKSRIQ 232

Query: 152 IQTANLTKLSKSRAHNISKPPGVWDLLCRTYKEEGGIKGLYRGVWPTSLGVVPYVALNFA 211
             TA +  +   R +N S P      L   Y+EE G + LY+G  P  L + P   +   
Sbjct: 233 -NTAVIPGV--VRKYNWSLPS-----LLTIYREE-GFRALYKGFVPKVLRLGPGGGILLV 283

Query: 212 VYEQFKEF 219
           V+    +F
Sbjct: 284 VFTGVLDF 291

>CAGL0K10362g complement(1009155..1010060) similar to sp|Q12375
           Saccharomyces cerevisiae YOR130c ARG11, start by
           similarity
          Length = 301

 Score = 66.6 bits (161), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 70/297 (23%), Positives = 118/297 (39%), Gaps = 33/297 (11%)

Query: 35  VSRTVVSPFERVKILLQVQNSTTAYNQGIVGAVRQVYREEGT-PGLFRGNGLNCIRIFPY 93
           + + +  PF+ VK+ LQ Q      +      +   Y+ EG   G F+G           
Sbjct: 26  LGKVIEYPFDTVKVRLQTQGRHVFPDTW--SCITYTYKNEGIIKGFFQGIASPLAGAAIE 83

Query: 94  SAVQFVVYEACKKHFFHVDGSKGREQLQNWQRLFSGALCGGCSVLATYPLDLVRTRLSIQ 153
           +A  F+ Y  C K   H         +     L SGA  G C+     P++L++ +L + 
Sbjct: 84  NAALFLSYNQCSKFLQHYTNVSDLTNI-----LISGAFAGSCASFVLTPVELIKCKLQVS 138

Query: 154 TANLTKLSKSRAHNISKPPGVWDLLCRTYKEEGGIKGLYRGVWPT----SLGVVPYVALN 209
                 L  +  + +++         +   +  G  GL++G   T    S G V +    
Sbjct: 139 NLQSLPLGVAGGNTVTERHTRIIPTIQAVIKNRGFIGLWQGQSGTFIRESFGGVAW---- 194

Query: 210 FAVYEQFKEFMPEG---TDNTLANFYK----LSIGALSGGVAQTVTYPFDLLRRRFQVLA 262
           FA YE  K+++       D +L N  K    L+ GA +G       +P D ++   Q   
Sbjct: 195 FATYELMKKYLKSRHNIEDPSLPNDNKTWELLASGASAGLAFNASIFPADTVKSMMQTEH 254

Query: 263 MGGNELGFRYKSVMDALITIGKTEGFRGYYKGLTANLFKVIPSTAVSWLVYEVVCDL 319
           +G          +  A+  I   +G RG+Y+GL   L + IP+ A  + VYE +  L
Sbjct: 255 LG----------LKTAIKKIFVEKGLRGFYRGLGITLIRAIPANATVFYVYETLSKL 301

 Score = 63.9 bits (154), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 51/199 (25%), Positives = 85/199 (42%), Gaps = 28/199 (14%)

Query: 116 GREQLQ----NWQRLFSGALCGGCSVLATYPLDLVRTRLSIQTANLTKLSKSRAHNISKP 171
           G E+ Q     ++ +  G++ G    +  YP D V+ RL  Q  ++              
Sbjct: 3   GAEETQWLAAAFRDILYGSIAGALGKVIEYPFDTVKVRLQTQGRHVF------------- 49

Query: 172 PGVWDLLCRTYKEEGGIKGLYRGVWPTSLGVVPYVALNFAVYEQFKEFMPEGTD-NTLAN 230
           P  W  +  TYK EG IKG ++G+     G     A  F  Y Q  +F+   T+ + L N
Sbjct: 50  PDTWSCITYTYKNEGIIKGFFQGIASPLAGAAIENAALFLSYNQCSKFLQHYTNVSDLTN 109

Query: 231 FYKLSIGALSGGVAQTVTYPFDLLRRRFQVLAM--------GGNELGFRYKSVMDALITI 282
              L  GA +G  A  V  P +L++ + QV  +        GGN +  R+  ++  +  +
Sbjct: 110 I--LISGAFAGSCASFVLTPVELIKCKLQVSNLQSLPLGVAGGNTVTERHTRIIPTIQAV 167

Query: 283 GKTEGFRGYYKGLTANLFK 301
            K  GF G ++G +    +
Sbjct: 168 IKNRGFIGLWQGQSGTFIR 186

 Score = 29.6 bits (65), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 22/93 (23%), Positives = 41/93 (44%), Gaps = 7/93 (7%)

Query: 222 EGTDNTLANFYKLSIGALSGGVAQTVTYPFDLLRRRFQVLAMGGNELGFRYKSVMDALIT 281
           E T    A F  +  G+++G + + + YPFD ++ R Q     G  +   +      +  
Sbjct: 5   EETQWLAAAFRDILYGSIAGALGKVIEYPFDTVKVRLQT---QGRHV---FPDTWSCITY 58

Query: 282 IGKTEG-FRGYYKGLTANLFKVIPSTAVSWLVY 313
             K EG  +G+++G+ + L       A  +L Y
Sbjct: 59  TYKNEGIIKGFFQGIASPLAGAAIENAALFLSY 91

>CAGL0H03839g 359987..360835 highly similar to sp|P38921
           Saccharomyces cerevisiae YNL003c PET8, start by
           similarity
          Length = 282

 Score = 65.9 bits (159), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 63/261 (24%), Positives = 118/261 (45%), Gaps = 40/261 (15%)

Query: 71  YREEGTPGLFRGNGLNCIRIFPYSAVQFVVYEACK---KHFFH--VDGSKGREQLQNWQR 125
           +R  G  G++RG G   +   P +++ F+ Y+ CK   + FF   +  S   + + +   
Sbjct: 40  FRNGGYRGVYRGLGSAVVASAPGASLFFITYDTCKAETRGFFRGLLPSSNVADVVTH--- 96

Query: 126 LFSGALCGGCSVLATYPLDLVRTRLSIQTANLTKLSKSRAHNISKPPGVWDLLCRTYKEE 185
           +FS ++    + +   P ++V+ R           S++ A + S     W+ L    K E
Sbjct: 97  MFSSSMGEIAACMVRVPAEVVKQR-----------SQTHASHSS-----WETLREILKNE 140

Query: 186 GGI---KGLYRGVWPTSLGVVPYVALNFAVYEQFKEFMPEGTDNTLANFYKLSI-GALSG 241
            G    + LYRG   T +  +P+  + F +YE  K+   E  ++     +K ++ G+++G
Sbjct: 141 NGEGVRRNLYRGWSTTIMREIPFTCIQFPLYEYMKKVWAELDESDRVEPWKGAVCGSIAG 200

Query: 242 GVAQTVTYPFDLLRRRFQVLAMGGNELGFRYKSV-MDALI-TIGKTEGFRGYYKGLTANL 299
           G+A   T P D L+ R  +            KS+ +  L+ TI K EGF+ ++ G+    
Sbjct: 201 GIAAATTTPLDFLKTRLMLCK----------KSIPLGTLVSTIYKEEGFKVFFSGVGPRT 250

Query: 300 FKVIPSTAVSWLVYEVVCDLM 320
             +    A+   +YE V  L+
Sbjct: 251 MWISAGGAIFLGIYETVHSLL 271

 Score = 62.8 bits (151), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 48/183 (26%), Positives = 84/183 (45%), Gaps = 28/183 (15%)

Query: 42  PFERVKILLQVQNSTTAYNQGIVGAVRQVYREEGTPG----LFRGNGLNCIRIFPYSAVQ 97
           P E VK   Q   S +++       +R++ + E   G    L+RG     +R  P++ +Q
Sbjct: 113 PAEVVKQRSQTHASHSSWE-----TLREILKNENGEGVRRNLYRGWSTTIMREIPFTCIQ 167

Query: 98  FVVYEACKKHFFHVDGSKGREQLQNWQRLFSGALCGGCSVLATYPLDLVRTRLSIQTANL 157
           F +YE  KK +  +D S   ++++ W+    G++ GG +   T PLD ++TRL +   ++
Sbjct: 168 FPLYEYMKKVWAELDES---DRVEPWKGAVCGSIAGGIAAATTTPLDFLKTRLMLCKKSI 224

Query: 158 TKLSKSRAHNISKPPGVWDLLCRTYKEEGGIKGLYRGVWPTSLGVVPYVALNFAVYEQFK 217
                        P G   L+   YKEE G K  + GV P ++ +    A+   +YE   
Sbjct: 225 -------------PLGT--LVSTIYKEE-GFKVFFSGVGPRTMWISAGGAIFLGIYETVH 268

Query: 218 EFM 220
             +
Sbjct: 269 SLL 271

 Score = 41.6 bits (96), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 44/202 (21%), Positives = 79/202 (39%), Gaps = 51/202 (25%)

Query: 126 LFSGALCGGCSVLATYPLDLVRTRLSIQTANLTKLSKSRAHNISKPPGVWDLLCRTYKEE 185
           L SGA  G  + L  +P+D ++TRL  +                            +   
Sbjct: 9   LLSGAAAGTSTDLVFFPIDTLKTRLQAKGG--------------------------FFRN 42

Query: 186 GGIKGLYRGVWPTSLGVVPYVALNFAVYEQ--------FKEFMPEGT-DNTLANFYKLSI 236
           GG +G+YRG+    +   P  +L F  Y+         F+  +P     + + + +  S+
Sbjct: 43  GGYRGVYRGLGSAVVASAPGASLFFITYDTCKAETRGFFRGLLPSSNVADVVTHMFSSSM 102

Query: 237 GALSGGVAQTVTYPFDLLRRRFQVLAMGGNELGFRYKSVMDALITIGKTEGFRG----YY 292
           G ++   A  V  P +++++R Q  A           S  + L  I K E   G     Y
Sbjct: 103 GEIA---ACMVRVPAEVVKQRSQTHA---------SHSSWETLREILKNENGEGVRRNLY 150

Query: 293 KGLTANLFKVIPSTAVSWLVYE 314
           +G +  + + IP T + + +YE
Sbjct: 151 RGWSTTIMREIPFTCIQFPLYE 172

>Kwal_27.11419
          Length = 298

 Score = 65.9 bits (159), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 75/302 (24%), Positives = 119/302 (39%), Gaps = 54/302 (17%)

Query: 36  SRTVVSPFERVKILLQVQNSTTAYNQGIVGAVRQVYREEGTPG-LFRGNGLNCIRIFPYS 94
           S  ++ PF+ +K  LQ   S+   +         V R   TPG L++G   + +R    S
Sbjct: 21  SAVILQPFDLLKTRLQQNKSSNLLD---------VVRSIETPGQLWKGTLPSALRTSVGS 71

Query: 95  AV-----QFVVYEACKKHFFHVDGSKGRE----QLQNWQRLFSGALCGGCSVLATYPLDL 145
           A+       V      K    + G  G      QL  ++ L SGA+      +AT P+ +
Sbjct: 72  ALFLSTLNIVRSAIADKRVKGIAGKNGSSSFLPQLSMYENLISGAITRAAVGVATMPITV 131

Query: 146 VRTRLSIQTANLTKLSKSRAHNISKPPGVWDLLCRTYKEEGGIKGLYRGVWPTSLGVVPY 205
           ++ R      N   L ++  H               Y+ EG I+GL+ G   T +   PY
Sbjct: 132 LKVRFESTMYNYKSLGEAATH--------------IYRSEG-IRGLFSGCGATVMRDAPY 176

Query: 206 VALNFAVYEQFKEFMP------------EGTDNTLANFYKLSIGAL-SGGVAQTVTYPFD 252
             L    YEQ K  +P             G  +T  +    SI A  S  +A T+T PFD
Sbjct: 177 AGLYVLFYEQSKLQLPRILPVWMVEHNESGVFSTKTSTIINSIAAFSSASLATTITSPFD 236

Query: 253 LLRRRFQVLAMGGNELGFRYKSVMDALITIGKTEGFRGYYKGLTANLFKVIPSTAVSWLV 312
            ++ R Q+          +Y   +    +I + E  R  + GL+  L +   S  ++W +
Sbjct: 237 TIKTRMQLNPS-------QYYGFIQTFKSIIRYERPRNLFDGLSLRLSRKALSAGIAWGI 289

Query: 313 YE 314
           YE
Sbjct: 290 YE 291

 Score = 43.1 bits (100), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 51/204 (25%), Positives = 85/204 (41%), Gaps = 45/204 (22%)

Query: 127 FSGALCGG-CSVLATYPLDLVRTRLSI-QTANLTKLSKSRAHNISKPPGVWDLLCRTYKE 184
           F G   GG  S +   P DL++TRL   +++NL  + +S    I  P  +W         
Sbjct: 11  FIGGFVGGLTSAVILQPFDLLKTRLQQNKSSNLLDVVRS----IETPGQLW--------- 57

Query: 185 EGGIKGLYRGVWPTSLGVVPYVA-LNF---AVYEQ----------FKEFMPEGTDNTLAN 230
               KG       TS+G   +++ LN    A+ ++             F+P+     L+ 
Sbjct: 58  ----KGTLPSALRTSVGSALFLSTLNIVRSAIADKRVKGIAGKNGSSSFLPQ-----LSM 108

Query: 231 FYKLSIGALSGGVAQTVTYPFDLLRRRFQVLAMGGNELGFRYKSVMDALITIGKTEGFRG 290
           +  L  GA++       T P  +L+ RF+          + YKS+ +A   I ++EG RG
Sbjct: 109 YENLISGAITRAAVGVATMPITVLKVRFE-------STMYNYKSLGEAATHIYRSEGIRG 161

Query: 291 YYKGLTANLFKVIPSTAVSWLVYE 314
            + G  A + +  P   +  L YE
Sbjct: 162 LFSGCGATVMRDAPYAGLYVLFYE 185

>CAGL0H10538g 1027739..1028632 highly similar to tr|Q07534
           Saccharomyces cerevisiae YDL119c, hypothetical start
          Length = 297

 Score = 65.5 bits (158), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 68/283 (24%), Positives = 111/283 (39%), Gaps = 47/283 (16%)

Query: 57  TAYNQGIVGAVRQVYREEGTP-GLFRGNGLNCIRIFPYSAVQFVVYE------ACKKHFF 109
           T + Q   G + Q  +   TP  L+RG   + IR    SA+            A +K F 
Sbjct: 30  TRFQQTKGGTLWQTVKSLDTPWQLWRGTLPSAIRTSVGSALYLSSLNLMRTALAKRKQFD 89

Query: 110 HVDG-----SKGREQLQNWQRLFSGALCGGCSVLATYPLDLVRTRLSIQTANLTKLSKSR 164
             D      S    QL  ++ L +GA   G     T P+ +++ R      N   ++++ 
Sbjct: 90  TADSVVTGKSSNLPQLSMYENLVTGAFARGTVGYITMPITIIKVRYESTLYNYKSIAEA- 148

Query: 165 AHNISKPPGVWDLLCRTYKEEGGIKGLYRGVWPTSLGVVPYVALNFAVYEQFKEFMPEGT 224
                          ++   + GI+G +RG  PT L   PY  L   +YE+ K  +P   
Sbjct: 149 --------------AKSIAAQEGIRGFFRGFGPTCLRDAPYSGLYVLLYEKLKHTLPTIL 194

Query: 225 DNTL---------ANFYKLSIGA----LSGGVAQTVTYPFDLLRRRFQVLAMGGNELGFR 271
             +L           +   +I +    LS  +A TVT PFD ++ R Q+          +
Sbjct: 195 PKSLLQLDSEGRYTAYTSTAINSTSAILSASMATTVTAPFDTIKTRMQLEPT-------K 247

Query: 272 YKSVMDALITIGKTEGFRGYYKGLTANLFKVIPSTAVSWLVYE 314
           +K+    L TI   E     + GL+  L +   S  ++W +YE
Sbjct: 248 FKTFWSTLTTIVTQEHPIKIFSGLSMRLTRKALSAGIAWGIYE 290

 Score = 52.0 bits (123), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 33/116 (28%), Positives = 55/116 (47%), Gaps = 12/116 (10%)

Query: 49  LLQVQNSTTAYN-QGIVGAVRQVYREEGTPGLFRGNGLNCIRIFPYSAVQFVVYEACK-- 105
           +++V+  +T YN + I  A + +  +EG  G FRG G  C+R  PYS +  ++YE  K  
Sbjct: 130 IIKVRYESTLYNYKSIAEAAKSIAAQEGIRGFFRGFGPTCLRDAPYSGLYVLLYEKLKHT 189

Query: 106 ------KHFFHVDGSKGREQLQNWQRL--FSGALCGGCSVLATYPLDLVRTRLSIQ 153
                 K    +D S+GR        +   S  L    +   T P D ++TR+ ++
Sbjct: 190 LPTILPKSLLQLD-SEGRYTAYTSTAINSTSAILSASMATTVTAPFDTIKTRMQLE 244

 Score = 44.7 bits (104), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 52/202 (25%), Positives = 84/202 (41%), Gaps = 43/202 (21%)

Query: 129 GALCGG-CSVLATYPLDLVRTRLSIQTANLTKLSKSRAHNISKPPGVWDLLCRTYKEEGG 187
           G   GG  S +A  PLDL++TR   QT   T                   L +T K    
Sbjct: 10  GGFAGGLSSAVALQPLDLLKTRFQ-QTKGGT-------------------LWQTVKSLDT 49

Query: 188 IKGLYRGVWP----TSLGVVPYV-ALNFAVYEQFKEFMPEGTDNTL----ANFYKLSI-- 236
              L+RG  P    TS+G   Y+ +LN       K    +  D+ +    +N  +LS+  
Sbjct: 50  PWQLWRGTLPSAIRTSVGSALYLSSLNLMRTALAKRKQFDTADSVVTGKSSNLPQLSMYE 109

Query: 237 ----GALSGGVAQTVTYPFDLLRRRFQVLAMGGNELGFRYKSVMDALITIGKTEGFRGYY 292
               GA + G    +T P  +++ R++          + YKS+ +A  +I   EG RG++
Sbjct: 110 NLVTGAFARGTVGYITMPITIIKVRYESTL-------YNYKSIAEAAKSIAAQEGIRGFF 162

Query: 293 KGLTANLFKVIPSTAVSWLVYE 314
           +G      +  P + +  L+YE
Sbjct: 163 RGFGPTCLRDAPYSGLYVLLYE 184

>CAGL0G01166g complement(111298..112185) highly similar to tr|Q06143
           Saccharomyces cerevisiae YLR348c DIC1, hypothetical
           start
          Length = 295

 Score = 65.5 bits (158), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 68/259 (26%), Positives = 110/259 (42%), Gaps = 21/259 (8%)

Query: 42  PFERVKILLQVQNSTTAYNQGIVGAVRQVYREEGTPGLFRGNGLNCIRIFPYSAVQFVVY 101
           P +  K+ LQ   +       IV  +R + + EG  GL+ G   + +R   Y+  +F +Y
Sbjct: 26  PLDLTKVRLQ---AAPIPKPTIVQMLRSILKNEGIVGLYAGLSASLLRQCTYTTARFGMY 82

Query: 102 EACKKHFFHVDGSKGREQLQN-WQRLFSGALCGGCSVLATYPLDLVRTRLSIQTANLTKL 160
           +A K+H         R++L N W  L +  + G    LA    DL+  R+  Q  +   L
Sbjct: 83  DALKEHVI------PRDKLTNMWYLLGASMVSGALGGLAGNFADLINIRM--QNDSALPL 134

Query: 161 SKSRAHNISKPPGVWDLLCRTYKEEGGIKGLYRGVW-PTSLGVVPYVALNFAVYEQFKEF 219
            K R +         D + + YK EG  K L+   W P  +  V   A     Y+ FK F
Sbjct: 135 DKRRNYK-----NAIDGMVKIYKAEGA-KSLFLTGWKPNMVRGVLMTASQVVTYDMFKNF 188

Query: 220 MPEGTD-NTLANFYKLSIGALSGGVAQTVTYPFDLLRR-RFQVLAMGGNELGFRYKSVMD 277
           +    + +   N   L+   L+G VA TV  P D+++          G+     +K +M+
Sbjct: 189 LVTKYNMDPKKNSTHLTSSLLAGFVATTVCSPADVIKTIVMNAHKKPGHNHDSSFKILME 248

Query: 278 ALITIGKTEGFRGYYKGLT 296
           A+   G +  FRG+    T
Sbjct: 249 AINKEGPSFMFRGWVPSFT 267

 Score = 51.2 bits (121), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 51/194 (26%), Positives = 83/194 (42%), Gaps = 19/194 (9%)

Query: 129 GALCGGCSVLATYPLDLVRTRLSIQTANLTKLSKSRAHNISKPPGVWDLLCRTYKEEGGI 188
           G   G  +V+ T+PLDL + RL  Q A + K            P +  +L    K E GI
Sbjct: 13  GGAAGIFAVMNTHPLDLTKVRL--QAAPIPK------------PTIVQMLRSILKNE-GI 57

Query: 189 KGLYRGVWPTSLGVVPYVALNFAVYEQFKEF-MPEGTDNTLANFYKLSIGALSGGVAQTV 247
            GLY G+  + L    Y    F +Y+  KE  +P   D     +Y L    +SG +    
Sbjct: 58  VGLYAGLSASLLRQCTYTTARFGMYDALKEHVIPR--DKLTNMWYLLGASMVSGALGGLA 115

Query: 248 TYPFDLLRRRFQVLAMGGNELGFRYKSVMDALITIGKTEGFRG-YYKGLTANLFKVIPST 306
               DL+  R Q  +    +    YK+ +D ++ I K EG +  +  G   N+ + +  T
Sbjct: 116 GNFADLINIRMQNDSALPLDKRRNYKNAIDGMVKIYKAEGAKSLFLTGWKPNMVRGVLMT 175

Query: 307 AVSWLVYEVVCDLM 320
           A   + Y++  + +
Sbjct: 176 ASQVVTYDMFKNFL 189

 Score = 30.0 bits (66), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 18/74 (24%), Positives = 35/74 (47%), Gaps = 1/74 (1%)

Query: 35  VSRTVVSPFERVKILLQVQNSTTAYNQ-GIVGAVRQVYREEGTPGLFRGNGLNCIRIFPY 93
           V+ TV SP + +K ++   +    +N       + +   +EG   +FRG   +  R+ P+
Sbjct: 213 VATTVCSPADVIKTIVMNAHKKPGHNHDSSFKILMEAINKEGPSFMFRGWVPSFTRLAPF 272

Query: 94  SAVQFVVYEACKKH 107
           + + F   E  KK+
Sbjct: 273 TMLIFFAMEQLKKY 286

>YNL003C (PET8) [4582] chr14 complement(624974..625828) Protein of
           the mitochondrial carrier (MCF) family of membrane
           transporters, has similarity to Mrs4p and Mrs3p [855 bp,
           284 aa]
          Length = 284

 Score = 65.1 bits (157), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 60/254 (23%), Positives = 107/254 (42%), Gaps = 32/254 (12%)

Query: 75  GTPGLFRGNGLNCIRIFPYSAVQFVVYEACK---KHFFHVDGSKGREQL-QNWQRLFSGA 130
           G  G++RG G   +   P +++ F+ Y+  K   + +     S+G EQL      + S +
Sbjct: 43  GYKGIYRGLGSAVVASAPGASLFFISYDYMKVKSRPYISKLYSQGSEQLIDTTTHMLSSS 102

Query: 131 LCGGCSVLATYPLDLVRTRLSIQTANLTKLSKSRAHNISKPPGVWDLL---CRTYKEEGG 187
           +   C+ L   P ++V+ R  + + N +                W  L    R   +EG 
Sbjct: 103 IGEICACLVRVPAEVVKQRTQVHSTNSS----------------WQTLQSILRNDNKEGL 146

Query: 188 IKGLYRGVWPTSLGVVPYVALNFAVYEQFKEFMPEGTDNTLANFYKLSI-GALSGGVAQT 246
            K LYRG   T +  +P+  + F +YE  K+   +    +    +K +I G+++GG+A  
Sbjct: 147 RKNLYRGWSTTIMREIPFTCIQFPLYEYLKKTWAKANGQSQVEPWKGAICGSIAGGIAAA 206

Query: 247 VTYPFDLLRRRFQVLAMGGNELGFRYKSVMDALITIGKTEGFRGYYKGLTANLFKVIPST 306
            T P D L+ R          L     S+   +I I + EG   ++ G+      +    
Sbjct: 207 TTTPLDFLKTRLM--------LNKTTASLGSVIIRIYREEGPAVFFSGVGPRTMWISAGG 258

Query: 307 AVSWLVYEVVCDLM 320
           A+   +YE V  L+
Sbjct: 259 AIFLGMYETVHSLL 272

 Score = 64.7 bits (156), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 47/181 (25%), Positives = 86/181 (47%), Gaps = 20/181 (11%)

Query: 42  PFERVKILLQVQNSTTAYNQGIVGAVRQVYREEGTPGLFRGNGLNCIRIFPYSAVQFVVY 101
           P E VK   QV ++ +++ Q +   +R   +E     L+RG     +R  P++ +QF +Y
Sbjct: 114 PAEVVKQRTQVHSTNSSW-QTLQSILRNDNKEGLRKNLYRGWSTTIMREIPFTCIQFPLY 172

Query: 102 EACKKHFFHVDGSKGREQLQNWQRLFSGALCGGCSVLATYPLDLVRTRLSIQTANLTKLS 161
           E  KK +   +G   + Q++ W+    G++ GG +   T PLD ++TRL         L+
Sbjct: 173 EYLKKTWAKANG---QSQVEPWKGAICGSIAGGIAAATTTPLDFLKTRL--------MLN 221

Query: 162 KSRAHNISKPPGVWDLLCRTYKEEGGIKGLYRGVWPTSLGVVPYVALNFAVYEQFKEFMP 221
           K+ A        +  ++ R Y+EEG     + GV P ++ +    A+   +YE     + 
Sbjct: 222 KTTAS-------LGSVIIRIYREEGPAV-FFSGVGPRTMWISAGGAIFLGMYETVHSLLS 273

Query: 222 E 222
           +
Sbjct: 274 K 274

 Score = 43.9 bits (102), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 44/201 (21%), Positives = 81/201 (40%), Gaps = 47/201 (23%)

Query: 126 LFSGALCGGCSVLATYPLDLVRTRLSIQTANLTKLSKSRAHNISKPPGVWDLLCRTYKEE 185
           L SGA  G  + L  +P+D ++TRL  +                            +   
Sbjct: 8   LLSGAAAGTSTDLVFFPIDTIKTRLQAKGG--------------------------FFAN 41

Query: 186 GGIKGLYRGVWPTSLGVVPYVALNFAVYEQFK--------EFMPEGTD---NTLANFYKL 234
           GG KG+YRG+    +   P  +L F  Y+  K        +   +G++   +T  +    
Sbjct: 42  GGYKGIYRGLGSAVVASAPGASLFFISYDYMKVKSRPYISKLYSQGSEQLIDTTTHMLSS 101

Query: 235 SIGALSGGVAQTVTYPFDLLRRRFQVLAMGGNELGFRYKSVMDALITIGKTEGFR-GYYK 293
           SIG +    A  V  P +++++R QV +   +         + +++     EG R   Y+
Sbjct: 102 SIGEI---CACLVRVPAEVVKQRTQVHSTNSSW------QTLQSILRNDNKEGLRKNLYR 152

Query: 294 GLTANLFKVIPSTAVSWLVYE 314
           G +  + + IP T + + +YE
Sbjct: 153 GWSTTIMREIPFTCIQFPLYE 173

>CAGL0B04543g 441599..442552 highly similar to tr|Q12289
           Saccharomyces cerevisiae YOR100c CRC1, start by
           similarity
          Length = 317

 Score = 65.5 bits (158), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 42/172 (24%), Positives = 72/172 (41%), Gaps = 18/172 (10%)

Query: 39  VVSPFERVKILLQVQNSTTAYNQGIVGAVRQVYREEGTPGLFRGNGLNCIRIFPYSAVQF 98
           V +P ER+K++LQ  +    +    + A + +    G   LF G+     R  P SA+ F
Sbjct: 149 VTAPTERIKVVLQTNSE---FKGSFIKAAKHIVSTGGVKSLFNGSLATLARDGPGSALYF 205

Query: 99  VVYEACKKHFFHVDGSKGREQLQNWQRLFSGALCGGCSVLATYPLDLVRTRLSIQTANLT 158
             YE  K         K ++++       +G + G    L  +P+D ++TRL + T  ++
Sbjct: 206 ASYELSKAFLNKSVAKKDKDEVNLANVCLAGGIAGMSMWLVVFPIDTIKTRLQVATTPIS 265

Query: 159 KLSKSRAHNISKPPGVWDLLCRTYKEEGGIKGLYRGVWPTSLGVVPYVALNF 210
            +  ++                 Y + GGIKG + G+ P  L   P  A  F
Sbjct: 266 MVQATK---------------DIYIQRGGIKGFFPGLGPALLRSFPANAATF 302

 Score = 55.5 bits (132), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 50/201 (24%), Positives = 88/201 (43%), Gaps = 16/201 (7%)

Query: 121 QNWQRLFSGALCGGCSVLATYPLDLVRTRLSIQTANLTKLSKS----RAHNISKPPGVWD 176
           +N + L +G + G C+VL  +P DL++ R     A  T  + S     A ++S   G   
Sbjct: 20  ENMKALVAGGVGGVCAVLTGHPFDLIKVRCQSNQAKSTMDAVSIILKEARSLSTVNGS-- 77

Query: 177 LLCRTYKEEGGIKGLYRGVWPTSLGVVPYVALNFAVYEQFKEFM--PEGTDNTLANFYKL 234
            L  +   +  +KG Y+GV P  +GV P  A++F  Y+  K  +   + +D  L      
Sbjct: 78  -LTTSLFFKNSVKGFYKGVIPPLIGVTPIFAVSFWGYDIGKRLVTWKQASDAPLTTAQMA 136

Query: 235 SIGALSGGVAQTVTYPFDLLRRRFQVLAMGGNELGFRYKSVMDALITIGKTEGFRGYYKG 294
           + G +S      VT P      R +V+    +E    +      +++ G   G +  + G
Sbjct: 137 TAGFISAIPTTLVTAP----TERIKVVLQTNSEFKGSFIKAAKHIVSTG---GVKSLFNG 189

Query: 295 LTANLFKVIPSTAVSWLVYEV 315
             A L +  P +A+ +  YE+
Sbjct: 190 SLATLARDGPGSALYFASYEL 210

 Score = 53.1 bits (126), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 64/279 (22%), Positives = 109/279 (39%), Gaps = 31/279 (11%)

Query: 41  SPFERVKILLQVQNSTTAYNQGIVGAVRQVYREEGTPGLFRGNGLNCIRIFPYSAVQFVV 100
           S  + V I+L+   S +  N  +      ++ +    G ++G     I + P  AV F  
Sbjct: 56  STMDAVSIILKEARSLSTVNGSLT---TSLFFKNSVKGFYKGVIPPLIGVTPIFAVSFWG 112

Query: 101 YEACKKHFFHVDGSKGREQLQNWQRLFSGALCGGCSVLATYPLDLVRTRLSIQTANLTKL 160
           Y+  K+       S     L   Q   +G +    + L T P + ++  L   +      
Sbjct: 113 YDIGKRLVTWKQASDA--PLTTAQMATAGFISAIPTTLVTAPTERIKVVLQTNSEFKGSF 170

Query: 161 SKSRAHNISKPPGVWDLLCRTYKEEGGIKGLYRGVWPTSLGVVPYVALNFAVYEQFKEFM 220
            K+  H +S                GG+K L+ G   T     P  AL FA YE  K F+
Sbjct: 171 IKAAKHIVS---------------TGGVKSLFNGSLATLARDGPGSALYFASYELSKAFL 215

Query: 221 PEGTDNTLANFYKLSIGALSGGVAQT----VTYPFDLLRRRFQVLAMGGNELGFRYKSVM 276
            +       +   L+   L+GG+A      V +P D ++ R QV     + +    ++  
Sbjct: 216 NKSVAKKDKDEVNLANVCLAGGIAGMSMWLVVFPIDTIKTRLQVATTPISMV----QATK 271

Query: 277 DALITIGKTEGFRGYYKGLTANLFKVIPSTAVSWLVYEV 315
           D  I  G   G +G++ GL   L +  P+ A ++L  E+
Sbjct: 272 DIYIQRG---GIKGFFPGLGPALLRSFPANAATFLGVEL 307

 Score = 34.3 bits (77), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 31/110 (28%), Positives = 43/110 (39%), Gaps = 27/110 (24%)

Query: 224 TDNTLANFYKLSIGALSGGVAQTVTYPFDLLRRRFQVLAMGGNELGFRYKSVMDALITIG 283
           TD    N   L  G + G  A    +PFDL++ R Q           + KS MDA+  I 
Sbjct: 15  TDAFRENMKALVAGGVGGVCAVLTGHPFDLIKVRCQ---------SNQAKSTMDAVSIIL 65

Query: 284 K------------------TEGFRGYYKGLTANLFKVIPSTAVSWLVYEV 315
           K                      +G+YKG+   L  V P  AVS+  Y++
Sbjct: 66  KEARSLSTVNGSLTTSLFFKNSVKGFYKGVIPPLIGVTPIFAVSFWGYDI 115

 Score = 32.3 bits (72), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 33/71 (46%), Gaps = 5/71 (7%)

Query: 39  VVSPFERVKILLQVQNSTTAYNQGIVGAVRQVYREEG-TPGLFRGNGLNCIRIFPYSAVQ 97
           VV P + +K  LQV  +  +    +V A + +Y + G   G F G G   +R FP +A  
Sbjct: 246 VVFPIDTIKTRLQVATTPIS----MVQATKDIYIQRGGIKGFFPGLGPALLRSFPANAAT 301

Query: 98  FVVYEACKKHF 108
           F+  E     F
Sbjct: 302 FLGVELTHAFF 312

>AFL196W [2999] [Homologous to ScYMR166C - SH]
           complement(66955..68040) [1086 bp, 361 aa]
          Length = 361

 Score = 65.5 bits (158), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 75/296 (25%), Positives = 128/296 (43%), Gaps = 34/296 (11%)

Query: 38  TVVSPFERVKILLQVQNSTTAYNQGIVGAVRQVYREEGTP-GLFRGNGLNCIRIFPYSAV 96
           +V+   + VK   Q       Y   ++ A R +  EEG   GL+ G G   +  FP +AV
Sbjct: 69  SVMHSLDTVKTRQQGAPGEVKYRH-MISAYRTLALEEGVRRGLYGGYGAAMLGSFPSAAV 127

Query: 97  QFVVYEACKKHFFHVDGSKGREQLQNWQ------RLFSGALCGGCSVLATYPLDLVRTRL 150
            F  YE  K           R+ +  WQ       L +G L    S +   P ++++TRL
Sbjct: 128 FFGTYEWVK-----------RQMINEWQIHETYSHLAAGFLGDLFSSVVYVPSEVLKTRL 176

Query: 151 SIQTANLTKLSKSRAHNISKPPGVWDLLCRTYKEEGGIKGLYRGVWPTSLGVVPYVALNF 210
            +Q     +  +S  +N     G+ D + RT     G+  L+ G   T    +P+ AL F
Sbjct: 177 QLQGCYNNRHFQS-GYNYR---GLSDAV-RTIVRTEGVSALFFGYKATLSRDLPFSALQF 231

Query: 211 AVYEQFKE--FMPE--GTDNTLANFYKLSIGALSGGVAQTVTYPFDLLRRRFQVLAMG-- 264
           A YE+F++  F+ E    D  L+   ++  GA +GG+A  +T P D+++ R Q    G  
Sbjct: 232 AFYERFRKWAFLLERKPVDGHLSFTAEVVTGASAGGLAGIITTPLDVVKTRIQTQPRGSA 291

Query: 265 ----GNELGFRYKSVMDALITIGKTEGFRGYYKGLTANLFKVIPSTAVSWLVYEVV 316
                +       S+  +L+ + + EG  G + G+          +++  L+Y+  
Sbjct: 292 GTPDASAPARLNGSIFRSLLVVLRYEGLGGAFSGVGPRFIWTSIQSSIMLLLYQTA 347

 Score = 63.2 bits (152), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 43/125 (34%), Positives = 61/125 (48%), Gaps = 7/125 (5%)

Query: 36  SRTVVSPFERVKILLQVQNS------TTAYN-QGIVGAVRQVYREEGTPGLFRGNGLNCI 88
           S  V  P E +K  LQ+Q         + YN +G+  AVR + R EG   LF G      
Sbjct: 162 SSVVYVPSEVLKTRLQLQGCYNNRHFQSGYNYRGLSDAVRTIVRTEGVSALFFGYKATLS 221

Query: 89  RIFPYSAVQFVVYEACKKHFFHVDGSKGREQLQNWQRLFSGALCGGCSVLATYPLDLVRT 148
           R  P+SA+QF  YE  +K  F ++       L     + +GA  GG + + T PLD+V+T
Sbjct: 222 RDLPFSALQFAFYERFRKWAFLLERKPVDGHLSFTAEVVTGASAGGLAGIITTPLDVVKT 281

Query: 149 RLSIQ 153
           R+  Q
Sbjct: 282 RIQTQ 286

 Score = 28.9 bits (63), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 23/77 (29%), Positives = 34/77 (44%), Gaps = 6/77 (7%)

Query: 245 QTVTYPFDLLRRRFQVLAMGGNELGFRYKSVMDALITIGKTEGFR-GYYKGLTANLFKVI 303
            +V +  D ++ R Q     G     +Y+ ++ A  T+   EG R G Y G  A +    
Sbjct: 68  DSVMHSLDTVKTRQQ-----GAPGEVKYRHMISAYRTLALEEGVRRGLYGGYGAAMLGSF 122

Query: 304 PSTAVSWLVYEVVCDLM 320
           PS AV +  YE V   M
Sbjct: 123 PSAAVFFGTYEWVKRQM 139

>YPR058W (YMC1) [5488] chr16 (673746..674669) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters [924 bp, 307 aa]
          Length = 307

 Score = 65.1 bits (157), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 75/286 (26%), Positives = 114/286 (39%), Gaps = 25/286 (8%)

Query: 39  VVSPFERVKILLQVQNSTTAYNQGIVGAVRQVYREEGTPGLFRGNGLNCIRIFPYSAVQF 98
           V  PF+  K+ LQ  ++ T   +     VR++   EG  G ++G     I +    ++QF
Sbjct: 42  VGQPFDTTKVRLQTSSTPTTAME----VVRKLLANEGPRGFYKGTLTPLIGVGACVSLQF 97

Query: 99  VVYEACKKHFFHVDGSKGREQLQNWQRLFSGALCGGCSVLATYPLDLVRTRLSIQTANLT 158
            V EA K+ FFH   +     L   Q    G   G  +     P++ VR RL  QT + T
Sbjct: 98  GVNEAMKR-FFHHRNADMSSTLSLPQYYACGVTGGIVNSFLASPIEHVRIRLQTQTGSGT 156

Query: 159 KLSKSRAHNISKPPGVWDLLCRTYKEEGGIKGLYRGVWPTSLGVVPYVALNFAVYEQF-- 216
                      K P    L C   K+    K L RG+ PT L         F VYE    
Sbjct: 157 NAE-------FKGP----LEC--IKKLRHNKALLRGLTPTILREGHGCGTYFLVYEALIA 203

Query: 217 -KEFMPEGTDNTLANFYKLSI-GALSGGVAQTVTYPFDLLRRRFQVLAMGGNELGFRYKS 274
            +     G +      +KL I GALSG     + YP D+++   Q   +   + G    S
Sbjct: 204 NQMNKRRGLERKDIPAWKLCIFGALSGTALWLMVYPLDVIKSVMQTDNLQKPKFGNSISS 263

Query: 275 VMDALITIGKTEGFRGYYKGLTANLFKVIPSTAVSWLVYEVVCDLM 320
           V   L   G   G   ++KG    + +  P+   ++  +E+   L+
Sbjct: 264 VAKTLYANG---GIGAFFKGFGPTMLRAAPANGATFATFELAMRLL 306

 Score = 32.3 bits (72), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 27/108 (25%), Positives = 44/108 (40%), Gaps = 9/108 (8%)

Query: 215 QFKEFMPEGTDNTLANFYKLSIGALSGGVAQT-VTYPFDLLRRRFQVLAMGGNELGFRYK 273
           Q  + + E   +  A   K  +   +GG+AQ  V  PFD  + R Q  +           
Sbjct: 9   QLIDDLEEHPQHDNARVVKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSST--------PT 60

Query: 274 SVMDALITIGKTEGFRGYYKGLTANLFKVIPSTAVSWLVYEVVCDLMH 321
           + M+ +  +   EG RG+YKG    L  V    ++ + V E +    H
Sbjct: 61  TAMEVVRKLLANEGPRGFYKGTLTPLIGVGACVSLQFGVNEAMKRFFH 108

>YLR348C (DIC1) [3731] chr12 complement(826976..827872)
           Mitochondrial dicarboxylate transport protein, member of
           the mitochondrial carrier family (MCF) of membrane
           transporters [897 bp, 298 aa]
          Length = 298

 Score = 65.1 bits (157), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 69/264 (26%), Positives = 111/264 (42%), Gaps = 29/264 (10%)

Query: 39  VVSPFERVKILLQVQNSTTAYNQGIVGAVRQVYREEGTPGLFRGNGLNCIRIFPYSAVQF 98
           V  P +  K+ LQ   +       +   +  +   EG  GL+ G     +R   Y+ V+F
Sbjct: 30  VTHPLDLAKVRLQ---AAPMPKPTLFRMLESILANEGVVGLYSGLSAAVLRQCTYTTVRF 86

Query: 99  VVYEACKKHFFHVDGSKGREQLQNWQRL-----FSGALCGGCSVLATYPLDLVRTRLSIQ 153
             Y+  K++         REQL N   L     FSGA+ G    LA    D+V  R+   
Sbjct: 87  GAYDLLKENVIP------REQLTNMAYLLPCSMFSGAIGG----LAGNFADVVNIRMQ-- 134

Query: 154 TANLTKLSKSRAHNISKPPGVWDLLCRTYKEEGGIKGLYRGVWPTSLGVVPYVALNFAVY 213
             N + L  ++  N        D + + Y+ EGG+K L+ G  P  +  +   A     Y
Sbjct: 135 --NDSALEAAKRRNYKN---AIDGVYKIYRYEGGLKTLFTGWKPNMVRGILMTASQVVTY 189

Query: 214 EQFKEFMPEGTD-NTLANFYKLSIGALSGGVAQTVTYPFDLLRRRFQVLAMGGNELGFRY 272
           + FK ++    D +   N+  L+   L+G VA TV  P D+++ R   +  G  +     
Sbjct: 190 DVFKNYLVTKLDFDASKNYTHLTASLLAGLVATTVCSPADVMKTR---IMNGSGDHQPAL 246

Query: 273 KSVMDALITIGKTEGFRGYYKGLT 296
           K + DA+   G +  FRG+    T
Sbjct: 247 KILADAVRKEGPSFMFRGWLPSFT 270

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 48/189 (25%), Positives = 76/189 (40%), Gaps = 19/189 (10%)

Query: 129 GALCGGCSVLATYPLDLVRTRLSIQTANLTKLSKSRAHNISKPPGVWDLLCRTYKEEGGI 188
           G   G  + + T+PLDL + RL  Q A + K            P ++ +L      E G+
Sbjct: 20  GGAAGIFATMVTHPLDLAKVRL--QAAPMPK------------PTLFRMLESILANE-GV 64

Query: 189 KGLYRGVWPTSLGVVPYVALNFAVYEQFKE-FMPEGTDNTLANFYKLSIGALSGGVAQTV 247
            GLY G+    L    Y  + F  Y+  KE  +P      +A  Y L     SG +    
Sbjct: 65  VGLYSGLSAAVLRQCTYTTVRFGAYDLLKENVIPREQLTNMA--YLLPCSMFSGAIGGLA 122

Query: 248 TYPFDLLRRRFQVLAMGGNELGFRYKSVMDALITIGKTE-GFRGYYKGLTANLFKVIPST 306
               D++  R Q  +         YK+ +D +  I + E G +  + G   N+ + I  T
Sbjct: 123 GNFADVVNIRMQNDSALEAAKRRNYKNAIDGVYKIYRYEGGLKTLFTGWKPNMVRGILMT 182

Query: 307 AVSWLVYEV 315
           A   + Y+V
Sbjct: 183 ASQVVTYDV 191

 Score = 34.3 bits (77), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 26/80 (32%), Positives = 37/80 (46%), Gaps = 7/80 (8%)

Query: 237 GALSGGVAQTVTYPFDLLRRRFQVLAMGGNELGFRYKSVMDALITIGKTEGFRGYYKGLT 296
           G  +G  A  VT+P DL + R Q   M    L FR       L +I   EG  G Y GL+
Sbjct: 20  GGAAGIFATMVTHPLDLAKVRLQAAPMPKPTL-FRM------LESILANEGVVGLYSGLS 72

Query: 297 ANLFKVIPSTAVSWLVYEVV 316
           A + +    T V +  Y+++
Sbjct: 73  AAVLRQCTYTTVRFGAYDLL 92

 Score = 30.8 bits (68), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 21/73 (28%), Positives = 37/73 (50%), Gaps = 3/73 (4%)

Query: 35  VSRTVVSPFERVKILLQVQNSTTAYNQGIVGAVRQVYREEGTPGLFRGNGLNCIRIFPYS 94
           V+ TV SP + +K   ++ N +  + Q  +  +    R+EG   +FRG   +  R+ P++
Sbjct: 220 VATTVCSPADVMKT--RIMNGSGDH-QPALKILADAVRKEGPSFMFRGWLPSFTRLGPFT 276

Query: 95  AVQFVVYEACKKH 107
            + F   E  KKH
Sbjct: 277 MLIFFAIEQLKKH 289

>KLLA0D09889g complement(834904..835998) similar to sp|Q03829
           Saccharomyces cerevisiae YMR166c, start by similarity
          Length = 364

 Score = 65.1 bits (157), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 52/170 (30%), Positives = 79/170 (46%), Gaps = 8/170 (4%)

Query: 35  VSRTVVSPFERVKILLQVQNS------TTAYN-QGIVGAVRQVYREEGTPGLFRGNGLNC 87
           +S  V  P E +K  LQ+Q         + YN + +  AV  + R EG P LF G     
Sbjct: 163 ISSFVYVPSEVLKTRLQLQGRYNNPFFRSGYNYKNLTDAVTTIVRREGWPTLFFGYKATL 222

Query: 88  IRIFPYSAVQFVVYEACKKHFFHVDGSKGREQLQNWQRLFSGALCGGCSVLATYPLDLVR 147
            R  P+S +QF  YE  ++  F V+     E L     + +GA  GG + + T PLD+V+
Sbjct: 223 SRDLPFSGLQFAFYEKFRQLAFAVENKTFDEDLSLSNEIITGAAAGGLAGIITTPLDVVK 282

Query: 148 TRLSIQTANLTKLSKSRAHNISKPPGVWDLLCRTYKEEGGIKGLYRGVWP 197
           TR+  Q  ++ + S       +    +   +   YK E G+ GL+ GV P
Sbjct: 283 TRIQTQLPDIPENSSQNLKQQTLTNSITKGMMTVYKTE-GLAGLFSGVGP 331

 Score = 57.8 bits (138), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 45/136 (33%), Positives = 66/136 (48%), Gaps = 8/136 (5%)

Query: 184 EEGGIKGLYRGVWPTSLGVVPYVALNFAVYEQFKEFM--PEGTDNTLANFYKLSIGALSG 241
           EEG  KGLY G     LG  P  A+ FA YE  K  M    G + T   F  L+ G L  
Sbjct: 105 EEGLRKGLYGGYSGAMLGSFPSAAIFFATYEYTKRKMIGEWGINET---FSHLTAGFLGD 161

Query: 242 GVAQTVTYPFDLLRRRFQVLAMGGNEL---GFRYKSVMDALITIGKTEGFRGYYKGLTAN 298
            ++  V  P ++L+ R Q+     N     G+ YK++ DA+ TI + EG+   + G  A 
Sbjct: 162 FISSFVYVPSEVLKTRLQLQGRYNNPFFRSGYNYKNLTDAVTTIVRREGWPTLFFGYKAT 221

Query: 299 LFKVIPSTAVSWLVYE 314
           L + +P + + +  YE
Sbjct: 222 LSRDLPFSGLQFAFYE 237

 Score = 53.9 bits (128), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 69/295 (23%), Positives = 120/295 (40%), Gaps = 23/295 (7%)

Query: 38  TVVSPFERVKILLQVQNSTTAYNQGIVGAVRQVYREEG-TPGLFRGNGLNCIRIFPYSAV 96
           + +   + VK   Q   ST  Y + ++GA R +  EEG   GL+ G     +  FP +A+
Sbjct: 71  SAMHSLDTVKTRQQGAPSTVKY-KNMIGAYRTIILEEGLRKGLYGGYSGAMLGSFPSAAI 129

Query: 97  QFVVYEACKKHFFHVDGSKGREQLQNWQRLFSGALCGGCSVLATYPLDLVRTRLSIQTAN 156
            F  YE  K+      G       + +  L +G L    S     P ++++TRL +Q   
Sbjct: 130 FFATYEYTKRKMIGEWGIN-----ETFSHLTAGFLGDFISSFVYVPSEVLKTRLQLQGRY 184

Query: 157 LTKLSKSRAHNISKPPGVWDLLCRTYKEEGGIKGLYRGVWPTSLGVVPYVALNFAVYEQF 216
                +S  +N      + D +    + EG    L+ G   T    +P+  L FA YE+F
Sbjct: 185 NNPFFRS-GYNYKN---LTDAVTTIVRREG-WPTLFFGYKATLSRDLPFSGLQFAFYEKF 239

Query: 217 KEFMPEGTDNTLANFYKLSIGALSGGVAQ----TVTYPFDLLRRRFQVLAMGGNELGFR- 271
           ++      + T      LS   ++G  A      +T P D+++ R Q       E   + 
Sbjct: 240 RQLAFAVENKTFDEDLSLSNEIITGAAAGGLAGIITTPLDVVKTRIQTQLPDIPENSSQN 299

Query: 272 ------YKSVMDALITIGKTEGFRGYYKGLTANLFKVIPSTAVSWLVYEVVCDLM 320
                   S+   ++T+ KTEG  G + G+          +++  L+Y+V    +
Sbjct: 300 LKQQTLTNSITKGMMTVYKTEGLAGLFSGVGPRFIWTSIQSSIMLLLYQVALKTL 354

>Scas_697.47
          Length = 328

 Score = 65.1 bits (157), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 47/178 (26%), Positives = 79/178 (44%), Gaps = 27/178 (15%)

Query: 39  VVSPFERVKILLQVQ--NSTTAYNQGIVGAVRQVYREEGTPGLFRGNGLNCIRIFPYSAV 96
           V +P ER+K++LQ    NS T++    +GA + + ++ G   LF+G+     R  P SA+
Sbjct: 157 VTAPTERIKVVLQTAGANSKTSF----IGAAKNIVKDGGVKSLFKGSLATLARDGPGSAL 212

Query: 97  QFVVYEACKKHFFH----VDGSKGREQLQNWQRLFSGALCGGCSVLATYPLDLVRTRLSI 152
            F  YE  KK         +   G   + N     +G + G    L  +P+D ++T+L  
Sbjct: 213 YFASYEISKKFLNDRNATAESKTGEVNIANV--CLAGGIAGMSMWLVVFPIDTIKTKLQS 270

Query: 153 QTANLTKLSKSRAHNISKPPGVWDLLCRTYKEEGGIKGLYRGVWPTSLGVVPYVALNF 210
            + + + ++ +R                 Y + GGIKG + G+ P  L   P  A  F
Sbjct: 271 SSGSQSMVAATR---------------EIYVKRGGIKGFFPGLGPALLRSFPANAATF 313

 Score = 56.6 bits (135), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 73/291 (25%), Positives = 121/291 (41%), Gaps = 37/291 (12%)

Query: 42  PFERVKILLQV-QNSTTAYNQGIV-GAVRQVYREE----GTPGLFRGNGLNCIRIFPYSA 95
           PF+ +K+  Q  Q S+T +   I+    R +           G ++G     + + P  A
Sbjct: 56  PFDLIKVRCQSGQASSTIHAIKIILKDARAIPTSNMLVNSVKGFYKGVIPPLLGVTPIFA 115

Query: 96  VQFVVYEACKKHFFHVDGSKGREQLQNWQRLFSGALCGGCSVLATYPLDLVRTRLSIQTA 155
           V F  Y+  KK     D S    QL   Q   +G +    + L T P + ++  L    A
Sbjct: 116 VSFWGYDVGKKIVTRSDSSSA--QLTMGQMAAAGFISAIPTTLVTAPTERIKVVLQTAGA 173

Query: 156 NLTKLSKSRAHNISKPPGVWDLLCRTYKEEGGIKGLYRGVWPTSLGVVPYVALNFAVYEQ 215
           N        A NI K              +GG+K L++G   T     P  AL FA YE 
Sbjct: 174 NSKTSFIGAAKNIVK--------------DGGVKSLFKGSLATLARDGPGSALYFASYEI 219

Query: 216 FKEFMPEGTDNTLANFYKLSIG--ALSGGVAQT----VTYPFDLLRRRFQVLAMGGNELG 269
            K+F+ +      +   +++I    L+GG+A      V +P D ++ + Q  +  G++  
Sbjct: 220 SKKFLNDRNATAESKTGEVNIANVCLAGGIAGMSMWLVVFPIDTIKTKLQ--SSSGSQ-- 275

Query: 270 FRYKSVMDALITI-GKTEGFRGYYKGLTANLFKVIPSTAVSWLVYEVVCDL 319
               S++ A   I  K  G +G++ GL   L +  P+ A ++L  E+   L
Sbjct: 276 ----SMVAATREIYVKRGGIKGFFPGLGPALLRSFPANAATFLGVELTHSL 322

 Score = 53.9 bits (128), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 55/204 (26%), Positives = 90/204 (44%), Gaps = 28/204 (13%)

Query: 121 QNWQRLFSGALCGGCSVLATYPLDLVRTRLSIQTANLTK------LSKSRAHNISKPPGV 174
            N + L +G + G C+VL  +P DL++ R     A+ T       L  +RA   S     
Sbjct: 35  DNLKSLVAGGVGGVCAVLTGHPFDLIKVRCQSGQASSTIHAIKIILKDARAIPTS----- 89

Query: 175 WDLLCRTYKEEGGIKGLYRGVWPTSLGVVPYVALNFAVYEQFKEFMPEGTDNTLANF--- 231
            ++L  +      +KG Y+GV P  LGV P  A++F  Y+  K+ +   +D++ A     
Sbjct: 90  -NMLVNS------VKGFYKGVIPPLLGVTPIFAVSFWGYDVGKKIVTR-SDSSSAQLTMG 141

Query: 232 YKLSIGALSGGVAQTVTYPFDLLRRRFQVLAMGGNELGFRYKSVMDALITIGKTEGFRGY 291
              + G +S      VT P + ++   Q    G N       S + A   I K  G +  
Sbjct: 142 QMAAAGFISAIPTTLVTAPTERIKVVLQT--AGANS----KTSFIGAAKNIVKDGGVKSL 195

Query: 292 YKGLTANLFKVIPSTAVSWLVYEV 315
           +KG  A L +  P +A+ +  YE+
Sbjct: 196 FKGSLATLARDGPGSALYFASYEI 219

>CAGL0F08305g complement(827705..828829) similar to sp|P53320
           Saccharomyces cerevisiae YGR257c, start by similarity
          Length = 374

 Score = 64.7 bits (156), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 69/275 (25%), Positives = 117/275 (42%), Gaps = 35/275 (12%)

Query: 61  QGIVGAVRQVYREEGTPGLFRGNGLNCIRIFPYSAVQFVVYEACKKHFFHVDGSKGREQL 120
            G + A  ++ + EG   L+RG  +  +   P + V F  YE  +      D S      
Sbjct: 111 NGTLEAFEKIAKFEGVTTLWRGISITLLMAIPANVVYFTGYEYVR------DRSPLNGLY 164

Query: 121 QNWQRLFSGALCGGCSVLATYPLDLVRTRL-SIQTANLTKLSKSRAHNISKPPGVWDLLC 179
                L  GA     +  +  PL+L++T+L SI ++++   S     +          L 
Sbjct: 165 PTINPLICGAFARTLAATSVAPLELIKTKLQSIPSSSMKNGSVIMYRD----------LF 214

Query: 180 RTYKEEGGIKG----LYRGVWPTSLGVVPYVALNFAVYEQFKE----FMPEGTDNTLANF 231
              K E  ++G    +++G+  T    VP+ A+ +A YE +K       P   D   +N+
Sbjct: 215 NEIKSEIAMRGVAQTMFKGLEITLWRDVPFSAIYWASYEFYKTKVAYLSPSTFDKNSSNW 274

Query: 232 YKLSI----GALSGGVAQTVTYPFDLLRRRFQVLAMGGNELG---FRYKS---VMDALIT 281
           +  +     G +SG +A   T+PFD+ + R Q+  +   +L     +Y S   +   L  
Sbjct: 275 FHFTNSFLGGFISGSLAAICTHPFDVGKTRQQISLVTDKKLANSNLKYGSSNTMFGFLNY 334

Query: 282 IGKTEGFRGYYKGLTANLFKVIPSTAVSWLVYEVV 316
           I KTEG    Y GL   + K+ PS A+    YE+ 
Sbjct: 335 IRKTEGIGALYTGLAPRVAKIAPSCAIMISSYELT 369

 Score = 29.6 bits (65), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 14/48 (29%), Positives = 24/48 (50%)

Query: 271 RYKSVMDALITIGKTEGFRGYYKGLTANLFKVIPSTAVSWLVYEVVCD 318
           ++   ++A   I K EG    ++G++  L   IP+  V +  YE V D
Sbjct: 109 KFNGTLEAFEKIAKFEGVTTLWRGISITLLMAIPANVVYFTGYEYVRD 156

>YPL134C (ODC1) [5311] chr16 complement(298570..299502)
           2-Oxodicarboxylate transporter, has specificity for
           2-oxoadipate and 2-oxoglutarate, member of the
           mitochondrial carrier (MCF) family of membrane
           transporters [933 bp, 310 aa]
          Length = 310

 Score = 63.9 bits (154), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 60/293 (20%), Positives = 120/293 (40%), Gaps = 32/293 (10%)

Query: 39  VVSPFERVKILLQVQNSTTAYN------------QGIVGAVRQVYREEGTPGLFRGNGLN 86
           V+ P + VK  +Q+Q +T  +              G++  + ++ ++EG   L++G    
Sbjct: 28  VMYPLDVVKTRMQLQVTTKGHPAVVAAKAAVDHYTGVMDCLTKIVKKEGFSHLYKGITSP 87

Query: 87  CIRIFPYSAVQFVVYEACKKHFFHVDGSKGREQLQNWQRLFSGALCGGCSVLATYPLDLV 146
            +   P  A++F   +  +  +  +  +   E  Q    ++SGA  G        P +LV
Sbjct: 88  ILMEAPKRAIKFSGNDTFQTFYKKIFPTPNGEMTQKIA-IYSGASAGAVEAFVVAPFELV 146

Query: 147 RTRLSIQTANLTKLSKSRAHNISKPPGVWDLLCRTYKEEGGIKGLYRGVWPTSLGVVPYV 206
           + RL    +      +   +++ K               GG+  L+ G+  T    V + 
Sbjct: 147 KIRLQDVNSQFKTPIEVVKNSVVK---------------GGVLSLFNGLEATIWRHVLWN 191

Query: 207 ALNFAVYEQFKEFMPEGTDNTLANFYKLSIGALSGGVAQTVTYPFDLLRRRFQVLAMGGN 266
           A  F +  Q ++ +P    +T      L  GA+ G V   +  PFD+++ R Q       
Sbjct: 192 AGYFGIIFQIRKLLPAAKTSTEKTRNDLIAGAIGGTVGCLLNTPFDVVKSRIQ---RSSG 248

Query: 267 ELGFRYKSVMDALITIGKTEGFRGYYKGLTANLFKVIPSTAVSWLVYEVVCDL 319
            L  +Y   + +++ + + EGF+  YKG    + ++ P   +  +V+  V D 
Sbjct: 249 PLR-KYNWSLPSVLLVYREEGFKALYKGFAPKVMRLAPGGGLLLVVFTNVMDF 300

 Score = 54.7 bits (130), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 42/139 (30%), Positives = 63/139 (45%), Gaps = 11/139 (7%)

Query: 128 SGALCGGCSVLATYPLDLVRTRLSIQ-TANLTKLSKSRAHNISKPPGVWDLLCRTYKEEG 186
           +GA+ G   +L  YPLD+V+TR+ +Q T        +    +    GV D L +  K+E 
Sbjct: 17  AGAIAGVSELLVMYPLDVVKTRMQLQVTTKGHPAVVAAKAAVDHYTGVMDCLTKIVKKE- 75

Query: 187 GIKGLYRGVWPTSLGVVPYVALNFAVYEQFKEF------MPEGTDNTLANFYKLSIGALS 240
           G   LY+G+    L   P  A+ F+  + F+ F       P G        Y    GA +
Sbjct: 76  GFSHLYKGITSPILMEAPKRAIKFSGNDTFQTFYKKIFPTPNGEMTQKIAIYS---GASA 132

Query: 241 GGVAQTVTYPFDLLRRRFQ 259
           G V   V  PF+L++ R Q
Sbjct: 133 GAVEAFVVAPFELVKIRLQ 151

 Score = 46.6 bits (109), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 52/184 (28%), Positives = 78/184 (42%), Gaps = 19/184 (10%)

Query: 39  VVSPFERVKILLQVQNSTTAYNQGIVGAVRQVYREEGTPGLFRGNGLNCIRIFPYSAVQF 98
           VV+PFE VKI LQ  NS     +  +  V+    + G   LF G      R   ++A  F
Sbjct: 139 VVAPFELVKIRLQDVNSQF---KTPIEVVKNSVVKGGVLSLFNGLEATIWRHVLWNAGYF 195

Query: 99  VVYEACKKHFFHVDGSKGREQLQNWQRLFSGALCGGCSVLATYPLDLVRTRLSIQTANLT 158
            +    +K       S   E+ +N   L +GA+ G    L   P D+V++R+   +  L 
Sbjct: 196 GIIFQIRKLLPAAKTST--EKTRN--DLIAGAIGGTVGCLLNTPFDVVKSRIQRSSGPL- 250

Query: 159 KLSKSRAHNISKPPGVWDLLCRTYKEEGGIKGLYRGVWPTSLGVVPYVALNFAVYEQFKE 218
                R +N S P      +   Y+EE G K LY+G  P  + + P   L   V+    +
Sbjct: 251 -----RKYNWSLPS-----VLLVYREE-GFKALYKGFAPKVMRLAPGGGLLLVVFTNVMD 299

Query: 219 FMPE 222
           F  E
Sbjct: 300 FFRE 303

 Score = 44.7 bits (104), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 28/94 (29%), Positives = 44/94 (46%), Gaps = 8/94 (8%)

Query: 225 DNTLANFYKLSIGALSGGVAQTVTYPFDLLRRRFQV-LAMGGNELGF-------RYKSVM 276
           +  L   Y+ + GA++G     V YP D+++ R Q+ +   G+            Y  VM
Sbjct: 6   NRPLPFIYQFTAGAIAGVSELLVMYPLDVVKTRMQLQVTTKGHPAVVAAKAAVDHYTGVM 65

Query: 277 DALITIGKTEGFRGYYKGLTANLFKVIPSTAVSW 310
           D L  I K EGF   YKG+T+ +    P  A+ +
Sbjct: 66  DCLTKIVKKEGFSHLYKGITSPILMEAPKRAIKF 99

 Score = 31.2 bits (69), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 21/75 (28%), Positives = 33/75 (44%)

Query: 41  SPFERVKILLQVQNSTTAYNQGIVGAVRQVYREEGTPGLFRGNGLNCIRIFPYSAVQFVV 100
           +PF+ VK  +Q  +         + +V  VYREEG   L++G     +R+ P   +  VV
Sbjct: 234 TPFDVVKSRIQRSSGPLRKYNWSLPSVLLVYREEGFKALYKGFAPKVMRLAPGGGLLLVV 293

Query: 101 YEACKKHFFHVDGSK 115
           +      F  V   K
Sbjct: 294 FTNVMDFFREVKYGK 308

>YBR104W (YMC2) [293] chr2 (449624..450613) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters [990 bp, 329 aa]
          Length = 329

 Score = 63.9 bits (154), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 75/298 (25%), Positives = 125/298 (41%), Gaps = 38/298 (12%)

Query: 39  VVSPFERVKILLQVQNSTTAYNQGIVGAVRQVYREEGTPGLFRGNGLNCIRIFPYSAVQF 98
           V  PF+  K+ LQ   + T      +  +R + + EG    ++G     + +    +VQF
Sbjct: 51  VGQPFDTTKVRLQTATTRTTT----LEVLRNLVKNEGVFAFYKGALTPLLGVGICVSVQF 106

Query: 99  VVYEACKKHFFHVDGSKG-----------REQLQNWQRLFSGALCGGC--SVLATYPLDL 145
            V EA K+ F + + SK            R       + +   L GG   S LA+ P++ 
Sbjct: 107 GVNEAMKRFFQNYNASKNPNMSSQDVDLSRSNTLPLSQYYVCGLTGGVVNSFLAS-PIEQ 165

Query: 146 VRTRLSIQTANLTKLSKSRAHNISKPPGVWDLLCRTYKEEGGIKGLYRGVWPTSLGVVPY 205
           +R RL  QT+N       R        G WD + +  K +GG   L RG++PT +     
Sbjct: 166 IRIRLQTQTSN----GGDREFK-----GPWDCI-KKLKAQGG---LMRGLFPTMIRAGHG 212

Query: 206 VALNFAVYEQF--KEFMPEGTDNTLANFYKLSIGALSGGVAQTVTYPFDLLRRRFQVLAM 263
           +   F VYE    +E     T N +  +     GA SG +     YP D+++   Q    
Sbjct: 213 LGTYFLVYEALVAREIGTGLTRNEIPPWKLCLFGAFSGTMLWLTVYPLDVVKSIIQ---- 268

Query: 264 GGNELGFRYKSVMDALI-TIGKTEGFRGYYKGLTANLFKVIPSTAVSWLVYEVVCDLM 320
             +    +YK+ +  +  TI   EG R ++KG    + +  P    ++L +E+V   +
Sbjct: 269 NDDLRKPKYKNSISYVAKTIYAKEGIRAFFKGFGPTMVRSAPVNGATFLTFELVMRFL 326

 Score = 51.6 bits (122), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 49/188 (26%), Positives = 79/188 (42%), Gaps = 14/188 (7%)

Query: 35  VSRTVVSPFERVKILLQVQNSTTAYNQGIVGAVRQVYREEGTPGLFRGNGLNCIRIFPYS 94
           V+  + SP E+++I LQ Q S    ++   G    + + +   GL RG     IR     
Sbjct: 155 VNSFLASPIEQIRIRLQTQTSNGG-DREFKGPWDCIKKLKAQGGLMRGLFPTMIRAGHGL 213

Query: 95  AVQFVVYEACKKHFFHVDGSKGREQLQNWQRLFSGALCGGCSVLATYPLDLVRTRLSIQT 154
              F+VYEA       +     R ++  W+    GA  G    L  YPLD+V++   IQ 
Sbjct: 214 GTYFLVYEALVAR--EIGTGLTRNEIPPWKLCLFGAFSGTMLWLTVYPLDVVKS--IIQN 269

Query: 155 ANLTKLSKSRAHNISKPPGVWDLLCRTYKEEGGIKGLYRGVWPTSLGVVPYVALNFAVYE 214
            +L K      ++IS        + +T   + GI+  ++G  PT +   P     F  +E
Sbjct: 270 DDLRK--PKYKNSIS-------YVAKTIYAKEGIRAFFKGFGPTMVRSAPVNGATFLTFE 320

Query: 215 QFKEFMPE 222
               F+ E
Sbjct: 321 LVMRFLGE 328

 Score = 38.9 bits (89), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 53/209 (25%), Positives = 81/209 (38%), Gaps = 37/209 (17%)

Query: 124 QRLFSGALCGGCSVLATYPLDLVRTRLSIQTANLTKLSKSRAHNISKPPGVWDLLCRTYK 183
           + +F+G + G   VL   P D  + RL   T   T L   R  N+ K  GV+        
Sbjct: 36  KDIFAGTIGGIAQVLVGQPFDTTKVRLQTATTRTTTLEVLR--NLVKNEGVF-------- 85

Query: 184 EEGGIKGLYRGVWPTSLGVVPYVALNFAVYEQFKEFM------------PEGTDNTLANF 231
                   Y+G     LGV   V++ F V E  K F              +  D + +N 
Sbjct: 86  ------AFYKGALTPLLGVGICVSVQFGVNEAMKRFFQNYNASKNPNMSSQDVDLSRSNT 139

Query: 232 YKLS---IGALSGGVAQT-VTYPFDLLRRRFQVLAMGGNELGFRYKSVMDALITIGKTEG 287
             LS   +  L+GGV  + +  P + +R R Q     G +  F  K   D +  + K +G
Sbjct: 140 LPLSQYYVCGLTGGVVNSFLASPIEQIRIRLQTQTSNGGDREF--KGPWDCIKKL-KAQG 196

Query: 288 FRGYYKGLTANLFKVIPSTAVSWLVYEVV 316
             G  +GL   + +        +LVYE +
Sbjct: 197 --GLMRGLFPTMIRAGHGLGTYFLVYEAL 223

>Kwal_55.21335
          Length = 317

 Score = 63.9 bits (154), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 63/283 (22%), Positives = 120/283 (42%), Gaps = 35/283 (12%)

Query: 42  PFERVKILLQVQNS---TTAYNQGIVGAVRQVYREEG-TPGLFRGNGLNCIRIFPYSAVQ 97
           P + +K+ LQ Q +    T+++      ++  Y++EG   G ++G     +     +AV 
Sbjct: 65  PLDTIKVRLQTQPAHVFPTSWS-----CIKYTYQKEGFVKGFYQGVASPLVGAALENAVL 119

Query: 98  FVVYEACKKHFFHVDGSKGREQLQNWQRLFSGALCGGCSVLATYPLDLVRTRLSIQTANL 157
           FV +   +      +      Q      + SGA  G C+     P++L++  L  Q +NL
Sbjct: 120 FVTFNRAQNFLQQYESVSPLSQT-----VLSGAFAGACTSYVLTPVELIKCTL--QVSNL 172

Query: 158 TKLSKSRAHNISKPPGVWDLLCRTYKEEGGIKGLYRGVWPTSLGVVPYVALNFAVYEQFK 217
              +       ++   +W  +    + +G I GL++G   T +      A+ F  YE  K
Sbjct: 173 EGAT-------TRHSKIWPTVKHIVQHKG-IGGLWQGQSSTFIRECAGGAVWFTTYESLK 224

Query: 218 EFMPEGTDNTLANFYKLSIGALSGGVAQTVT-YPFDLLRRRFQVLAMGGNELGFRYKSVM 276
            ++    ++T  + ++L     S GVA   + +P D ++   Q   +G          ++
Sbjct: 225 SYLARRRNDTENHTWELLASGASAGVAFNASIFPADTIKSTAQTQHLG----------IV 274

Query: 277 DALITIGKTEGFRGYYKGLTANLFKVIPSTAVSWLVYEVVCDL 319
           DA   I    G  G Y+GL   L +  P+ A+ +  YE + +L
Sbjct: 275 DATKRILARSGPAGLYRGLGITLIRAAPANAIVFYTYETLSNL 317

 Score = 58.5 bits (140), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 45/186 (24%), Positives = 82/186 (44%), Gaps = 16/186 (8%)

Query: 129 GALCGGCSVLATYPLDLVRTRLSIQTANLTKLSKSRAHNISKPPGVWDLLCRTYKEEGGI 188
           G++ G    +  YPLD ++ RL  Q A++              P  W  +  TY++EG +
Sbjct: 52  GSIAGAAGKVIEYPLDTIKVRLQTQPAHVF-------------PTSWSCIKYTYQKEGFV 98

Query: 189 KGLYRGVWPTSLGVVPYVALNFAVYEQFKEFMPEGTDNTLANFYKLSIGALSGGVAQTVT 248
           KG Y+GV    +G     A+ F  + + + F+ +    +  +   LS GA +G     V 
Sbjct: 99  KGFYQGVASPLVGAALENAVLFVTFNRAQNFLQQYESVSPLSQTVLS-GAFAGACTSYVL 157

Query: 249 YPFDLLRRRFQVLAMGGNELGFRYKSVMDALITIGKTEGFRGYYKGLTANLFKVIPSTAV 308
            P +L++   QV  + G     R+  +   +  I + +G  G ++G ++   +     AV
Sbjct: 158 TPVELIKCTLQVSNLEGATT--RHSKIWPTVKHIVQHKGIGGLWQGQSSTFIRECAGGAV 215

Query: 309 SWLVYE 314
            +  YE
Sbjct: 216 WFTTYE 221

>Kwal_0.232
          Length = 274

 Score = 62.8 bits (151), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 49/183 (26%), Positives = 81/183 (44%), Gaps = 28/183 (15%)

Query: 42  PFERVKILLQVQNSTTAYNQGIVGAVRQVYREEGTPG----LFRGNGLNCIRIFPYSAVQ 97
           P E +K   Q   S ++        ++++ + E   G    L+RG     +R  P++ +Q
Sbjct: 115 PAEVIKQRTQTHKSDSSLQ-----TLKKLLQNENGEGIRRNLYRGWSTTVMREIPFTCIQ 169

Query: 98  FVVYEACKKHFFHVDGSKGREQLQNWQRLFSGALCGGCSVLATYPLDLVRTRLSIQTANL 157
           F +YE  KK +     S GREQ+  WQ  F G + GG +   T PLD+++TRL +   ++
Sbjct: 170 FPLYEFLKKQWAI---SGGREQVAPWQGAFCGCVAGGIAAATTTPLDVLKTRLMLSHTSV 226

Query: 158 TKLSKSRAHNISKPPGVWDLLCRTYKEEGGIKGLYRGVWPTSLGVVPYVALNFAVYEQFK 217
             L  +R               + Y  E G K  + GV P ++ +    A+   VYE   
Sbjct: 227 PVLHLAR---------------QIYATE-GWKVFFSGVGPRTVWISAGGAIFLGVYETVH 270

Query: 218 EFM 220
             +
Sbjct: 271 SIL 273

 Score = 54.3 bits (129), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 54/247 (21%), Positives = 101/247 (40%), Gaps = 25/247 (10%)

Query: 78  GLFRGNGLNCIRIFPYSAVQFVVYEACKKH---FFHVDGSKGREQLQNWQRLFSGALCGG 134
           G++RG G   +   P +++ FV Y+  K +    F+   +   +  +    +FS +    
Sbjct: 48  GVYRGLGSAVVASAPSASLFFVTYDGMKSYSRPIFNNLITSSDQVAETATHMFSSSAGEI 107

Query: 135 CSVLATYPLDLVRTRLSIQTANLTKLSKSRAHNISKPPGVWDLLCRTYKEEGGIKGLYRG 194
            + +   P ++++ R        T  S S    + K       L +    EG  + LYRG
Sbjct: 108 AACMVRVPAEVIKQRTQ------THKSDSSLQTLKK-------LLQNENGEGIRRNLYRG 154

Query: 195 VWPTSLGVVPYVALNFAVYEQF-KEFMPEGTDNTLANFYKLSIGALSGGVAQTVTYPFDL 253
              T +  +P+  + F +YE   K++   G    +A +     G ++GG+A   T P D+
Sbjct: 155 WSTTVMREIPFTCIQFPLYEFLKKQWAISGGREQVAPWQGAFCGCVAGGIAAATTTPLDV 214

Query: 254 LRRRFQVLAMGGNELGFRYKSVMDALITIGKTEGFRGYYKGLTANLFKVIPSTAVSWLVY 313
           L+ R          L      V+     I  TEG++ ++ G+      +    A+   VY
Sbjct: 215 LKTRLM--------LSHTSVPVLHLARQIYATEGWKVFFSGVGPRTVWISAGGAIFLGVY 266

Query: 314 EVVCDLM 320
           E V  ++
Sbjct: 267 ETVHSIL 273

 Score = 35.0 bits (79), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 43/200 (21%), Positives = 76/200 (38%), Gaps = 46/200 (23%)

Query: 126 LFSGALCGGCSVLATYPLDLVRTRLSIQTANLTKLSKSRAHNISKPPGVWDLLCRTYKEE 185
           L +GA  G  + L  +P+D ++TRL  Q A                          +   
Sbjct: 10  LLAGAAAGTSTDLFFFPIDTLKTRL--QAAG------------------------GFFAN 43

Query: 186 GGIKGLYRGVWPTSLGVVPYVALNFAVYEQFKEFMPEGTDN----------TLANFYKLS 235
           GG  G+YRG+    +   P  +L F  Y+  K +     +N          T  + +  S
Sbjct: 44  GGYLGVYRGLGSAVVASAPSASLFFVTYDGMKSYSRPIFNNLITSSDQVAETATHMFSSS 103

Query: 236 IGALSGGVAQTVTYPFDLLRRRFQVLAMGGNELGFRYKSVMDALITIGKTEGF-RGYYKG 294
            G ++   A  V  P +++++R Q      +         +  L+     EG  R  Y+G
Sbjct: 104 AGEIA---ACMVRVPAEVIKQRTQTHKSDSS------LQTLKKLLQNENGEGIRRNLYRG 154

Query: 295 LTANLFKVIPSTAVSWLVYE 314
            +  + + IP T + + +YE
Sbjct: 155 WSTTVMREIPFTCIQFPLYE 174

>KLLA0F17864g complement(1634241..1635164) similar to sp|P32331
           Saccharomyces cerevisiae YPR058w YMC1 mitochondrial
           carrier protein (MCF), start by similarity
          Length = 307

 Score = 62.8 bits (151), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 66/287 (22%), Positives = 118/287 (41%), Gaps = 26/287 (9%)

Query: 39  VVSPFERVKILLQVQ-NSTTAYNQGIVGAVRQVYREEGTPGLFRGNGLNCIRIFPYSAVQ 97
           V  PF+ +K+ LQ    + TA+      A+  + + EG  G ++G     + +    + Q
Sbjct: 41  VGQPFDIIKVRLQTMPGNATAWE-----AITDLVKYEGFMGFYKGTMAPLVGVGACVSCQ 95

Query: 98  FVVYEACKKHFFHVDGSKG--REQLQNWQRLFSGALCGGCSVLATYPLDLVRTRLSIQTA 155
           F + EA K++F  ++ S+G     L   Q    G + G  + L   P++ VR RL +Q  
Sbjct: 96  FGINEAMKRYFRDLNRSRGIYDNTLSLGQYYTCGFVSGSANALLATPIEHVRIRLQLQKE 155

Query: 156 NLTKLSKSRAHNISKPPGVWDLLCRTYKEEGGIKGLYRGVWPTSLGVVPYVALNFAVYEQ 215
            L           ++     D   +  K+   ++G    +  TS G   Y    F  YE 
Sbjct: 156 ALAN---------AEYKSTLDCTEKLLKQGSLMRGFTATLMRTSHGFGIY----FLTYET 202

Query: 216 F-KEFMPEGTDNTLANFYKLSI-GALSGGVAQTVTYPFDLLRRRFQVLAMGGNELGFRYK 273
                +  G      + +K  + GALSG     +TYPFD+++   Q   +     G    
Sbjct: 203 LIASQLAHGFRREDISAWKACMFGALSGAFFWAMTYPFDVVKSVMQADKLVNPAYG---T 259

Query: 274 SVMDALITIGKTEGFRGYYKGLTANLFKVIPSTAVSWLVYEVVCDLM 320
           +V+     I +  G R + KG    + + +P    ++  +EV   ++
Sbjct: 260 NVVQVAKNIYRERGLRAFTKGFMPTMLRSLPVNGATFAAFEVTMQML 306

 Score = 51.2 bits (121), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 50/204 (24%), Positives = 80/204 (39%), Gaps = 31/204 (15%)

Query: 121 QNWQRLFSGALCGGCSVLATYPLDLVRTRLSIQTANLTKLSKSRAHNISKPPGVWDLLCR 180
           +  + +FSG + G   VL   P D+++ RL     N T                W+ +  
Sbjct: 23  KTLKDVFSGTVGGVAQVLVGQPFDIIKVRLQTMPGNAT---------------AWEAITD 67

Query: 181 TYKEEGGIKGLYRGVWPTSLGVVPYVALNFAVYEQFKEFMPEGT------DNTLANFYKL 234
             K E G  G Y+G     +GV   V+  F + E  K +  +        DNTL+     
Sbjct: 68  LVKYE-GFMGFYKGTMAPLVGVGACVSCQFGINEAMKRYFRDLNRSRGIYDNTLSLGQYY 126

Query: 235 SIGALSGGVAQTVTYPFDLLRRRFQVL--AMGGNELGFRYKSVMDALITIGKTEGFRGYY 292
           + G +SG     +  P + +R R Q+   A+   E    YKS +D    + K        
Sbjct: 127 TCGFVSGSANALLATPIEHVRIRLQLQKEALANAE----YKSTLDCTEKLLKQGSL---M 179

Query: 293 KGLTANLFKVIPSTAVSWLVYEVV 316
           +G TA L +      + +L YE +
Sbjct: 180 RGFTATLMRTSHGFGIYFLTYETL 203

>Scas_328.1
          Length = 227

 Score = 61.6 bits (148), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 60/228 (26%), Positives = 99/228 (43%), Gaps = 23/228 (10%)

Query: 86  NCIRIFPYSAVQFVVYEACKKHFFHVDGSKGREQLQNWQRLFSGALCGGCSVL----ATY 141
           + IR FP  A+ F   +  K  F    G +   Q+          + G C +      ++
Sbjct: 1   HVIRYFPTQALNFAFKDKIKAMFGFQQGKRRLYQM----------VYGECGIRWMCRCSF 50

Query: 142 PLDLVRTRLSI-QTANLTKLSKSRAHNISKPPGVWDLLCRTYKEEGGIKGLYRGVWPTSL 200
           P+  +  RL   +  +  K  KS A    K  G+ D+  +T   +G + GLYRG  P+ +
Sbjct: 51  PIVCLFLRLCKNEIGSDAKSIKSGAPR--KFNGILDVYKKTLFTDG-VLGLYRGFLPSVV 107

Query: 201 GVVPYVALNFAVYEQFKEFMPEGTDNTLANFYKLSIGALSGGVAQTVTYPFDLLRRRFQV 260
           G++ Y  L F +Y+  K  +  G+    A      +G      A T +YP D +RRR  +
Sbjct: 108 GIMVYRGLYFGLYDSLKPVLLTGSFEN-AFLPSFLLGWAVTISASTTSYPLDTVRRR--M 164

Query: 261 LAMGGNELGFRYKSVMDALITIGKTEGFRGYYKGLTANLFKVIPSTAV 308
           +   G  +  +YK  +D    I   EG    +KG  AN+F+ + +  V
Sbjct: 165 MMTSGQAV--KYKGAIDCFQQIVSQEGVYSLFKGCGANIFRGVAAAGV 210

 Score = 28.5 bits (62), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 13/54 (24%), Positives = 25/54 (46%)

Query: 36  SRTVVSPFERVKILLQVQNSTTAYNQGIVGAVRQVYREEGTPGLFRGNGLNCIR 89
           + T   P + V+  + + +      +G +   +Q+  +EG   LF+G G N  R
Sbjct: 150 ASTTSYPLDTVRRRMMMTSGQAVKYKGAIDCFQQIVSQEGVYSLFKGCGANIFR 203

>YOR100C (CRC1) [4905] chr15 complement(513295..514278)
           Mitochondrial carnitine carrier, member of the
           mitochondrial carrier family (MCF) of membrane
           transporters [984 bp, 327 aa]
          Length = 327

 Score = 62.4 bits (150), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 47/175 (26%), Positives = 77/175 (44%), Gaps = 23/175 (13%)

Query: 39  VVSPFERVKILLQVQNSTTAYNQGIVGAVRQVYREEGTPGLFRGNGLNCIRIFPYSAVQF 98
           V +P ERVK++LQ     T+     + A + + +E G   LF+G+     R  P SA+ F
Sbjct: 158 VTAPTERVKVVLQ-----TSSKGSFIQAAKTIVKEGGIASLFKGSLATLARDGPGSALYF 212

Query: 99  VVYEACKKHFFHVDGSK--GREQLQNWQRL-FSGALCGGCSVLATYPLDLVRTRLSIQTA 155
             YE  K +       +  G+++  N   +  +G + G    LA +P+D ++T+L   + 
Sbjct: 213 ASYEISKNYLNSRQPRQDAGKDEPVNILNVCLAGGIAGMSMWLAVFPIDTIKTKLQASST 272

Query: 156 NLTKLSKSRAHNISKPPGVWDLLCRTYKEEGGIKGLYRGVWPTSLGVVPYVALNF 210
               LS ++                 Y + GGIKG + G+ P  L   P  A  F
Sbjct: 273 RQNMLSATK---------------EIYLQRGGIKGFFPGLGPALLRSFPANAATF 312

 Score = 58.5 bits (140), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 52/205 (25%), Positives = 86/205 (41%), Gaps = 19/205 (9%)

Query: 121 QNWQRLFSGALCGGCSVLATYPLDLVRTRLSIQTANLTKLSKSRAHNISKPPGVWDLLCR 180
           +N +   +G + G C+V   +P DL++ R     AN      S  H I+          +
Sbjct: 34  ENIKSFVAGGVGGVCAVFTGHPFDLIKVRCQNGQAN------STVHAITNIIKEAKTQVK 87

Query: 181 TYKEEGGIKGLYRGVWPTSLGVVPYVALNFAVYEQFKEFM----PEGTDNTLANFYKLSI 236
                  +KG Y+GV P  LGV P  A++F  Y+  K+ +     +G  N L      + 
Sbjct: 88  GTLFTNSVKGFYKGVIPPLLGVTPIFAVSFWGYDVGKKLVTFNNKQGGSNELTMGQMAAA 147

Query: 237 GALSGGVAQTVTYPFDLLRRRFQVLAMGGNELGFRYKSVMDALITIGKTEGFRGYYKGLT 296
           G +S      VT P + ++   Q  + G         S + A  TI K  G    +KG  
Sbjct: 148 GFISAIPTTLVTAPTERVKVVLQTSSKG---------SFIQAAKTIVKEGGIASLFKGSL 198

Query: 297 ANLFKVIPSTAVSWLVYEVVCDLMH 321
           A L +  P +A+ +  YE+  + ++
Sbjct: 199 ATLARDGPGSALYFASYEISKNYLN 223

 Score = 51.2 bits (121), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 63/300 (21%), Positives = 114/300 (38%), Gaps = 47/300 (15%)

Query: 42  PFERVKILLQVQNSTTAYNQGIVGAVRQVYREEGT-----------PGLFRGNGLNCIRI 90
           PF+ +K+  Q   + +      V A+  + +E  T            G ++G     + +
Sbjct: 55  PFDLIKVRCQNGQANST-----VHAITNIIKEAKTQVKGTLFTNSVKGFYKGVIPPLLGV 109

Query: 91  FPYSAVQFVVYEACKKHFFHVDGSKGREQLQNWQRLFSGALCGGCSVLATYPLDLVRTRL 150
            P  AV F  Y+  KK     +   G  +L   Q   +G +    + L T P +  R ++
Sbjct: 110 TPIFAVSFWGYDVGKKLVTFNNKQGGSNELTMGQMAAAGFISAIPTTLVTAPTE--RVKV 167

Query: 151 SIQTANLTKLSKSRAHNISKPPGVWDLLCRTYKEEGGIKGLYRGVWPTSLGVVPYVALNF 210
            +QT++                G +    +T  +EGGI  L++G   T     P  AL F
Sbjct: 168 VLQTSS---------------KGSFIQAAKTIVKEGGIASLFKGSLATLARDGPGSALYF 212

Query: 211 AVYEQFKEFM-------PEGTDNTLANFYKLSIGALSGGVAQTVTYPFDLLRRRFQVLAM 263
           A YE  K ++         G D  +        G ++G       +P D ++ + Q  + 
Sbjct: 213 ASYEISKNYLNSRQPRQDAGKDEPVNILNVCLAGGIAGMSMWLAVFPIDTIKTKLQASST 272

Query: 264 GGNELGFRYKSVMDALITIGKTEGFRGYYKGLTANLFKVIPSTAVSWLVYEVVCDLMHVW 323
             N L    +  +       +  G +G++ GL   L +  P+ A ++L  E+   L   +
Sbjct: 273 RQNMLSATKEIYL-------QRGGIKGFFPGLGPALLRSFPANAATFLGVEMTHSLFKKY 325

>Scas_673.17
          Length = 314

 Score = 62.0 bits (149), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 72/281 (25%), Positives = 112/281 (39%), Gaps = 35/281 (12%)

Query: 42  PFERVKILLQVQNSTTAYNQGIVGAVRQVYREEGTPGLFRGNGLNCIRIFPYSAVQFVVY 101
           P + VK  +Q++   T YN+G+VG+ +++  +EG   L  G G   +      A +F  Y
Sbjct: 40  PVDVVKTRIQLE--PTVYNKGMVGSFKKIIADEGAGALLTGFGPTLLGYSVQGAFKFGGY 97

Query: 102 EACKKHFFHVDGSKGREQLQNWQRLFSGALCGGCSVLATYPLDLVRTRLSIQTANLTKLS 161
           E  KK      G +     +N   + S A+    + +A  PL+  R RL           
Sbjct: 98  EVFKKLSIDTIGYENAVHYKNSVYMGSAAVAEFLADIALCPLEATRIRL----------- 146

Query: 162 KSRAHNISKPP---GVWDLLCRTYKEEGGIKGLYRGVWPTSLGVVPYVALNFAVYEQFKE 218
                 +S+P    G+     R  KEE G+   Y G  P     +PY    F V+E+  E
Sbjct: 147 ------VSQPTFANGLVGGFSRILKEE-GVGSFYSGFTPILFKQIPYNIAKFLVFERASE 199

Query: 219 --FMPEGTDNTLANFYKLSIGALSG---GVAQT-VTYPFDLLRRRFQVLAMGGNELGFRY 272
             +   G   TL++     I  LSG   G A   V+ P D L  +         +     
Sbjct: 200 VYYGIVGAKETLSDMTNTGINLLSGLTAGFAAAFVSQPADTLLSKVNKTKKAPGQ----- 254

Query: 273 KSVMDALITIGKTEGFRGYYKGLTANLFKVIPSTAVSWLVY 313
            S +  L  + K  G  G + GL   L  V   T++ + +Y
Sbjct: 255 -STIGLLAQLAKQLGVIGSFAGLPTRLIMVGTLTSLQFAIY 294

 Score = 43.9 bits (102), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 50/196 (25%), Positives = 77/196 (39%), Gaps = 25/196 (12%)

Query: 123 WQRLFSGALCGGCSVLATYPLDLVRTRLSIQTANLTKLSKSRAHNISKPPGVWDLLCRTY 182
           ++   +GA+  G +  +  P+D+V+TR+ ++     K             G+     +  
Sbjct: 21  FKFALAGAIGCGTTHSSLVPVDVVKTRIQLEPTVYNK-------------GMVGSFKKII 67

Query: 183 KEEGGIKGLYRGVWPTSLGVVPYVALNFAVYEQFKEFMPEGTDNTLANFYKLSIGALSGG 242
            +EG    L  G  PT LG     A  F  YE FK+   +      A  YK S+   S  
Sbjct: 68  ADEGA-GALLTGFGPTLLGYSVQGAFKFGGYEVFKKLSIDTIGYENAVHYKNSVYMGSAA 126

Query: 243 VAQTVT----YPFDLLRRRFQVLAMGGNELGFRYKSVMDALITIGKTEGFRGYYKGLTAN 298
           VA+ +      P +  R R        N L   +  ++       K EG   +Y G T  
Sbjct: 127 VAEFLADIALCPLEATRIRLVSQPTFANGLVGGFSRIL-------KEEGVGSFYSGFTPI 179

Query: 299 LFKVIPSTAVSWLVYE 314
           LFK IP     +LV+E
Sbjct: 180 LFKQIPYNIAKFLVFE 195

>Sklu_1119.1 YJR077C, Contig c1119 366-1289
          Length = 307

 Score = 62.0 bits (149), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 73/287 (25%), Positives = 114/287 (39%), Gaps = 35/287 (12%)

Query: 36  SRTVVSPFERVKILLQVQNSTTAYNQGIVGAVRQVYREEGTPGLFRGNGLNCIRIFPYSA 95
           + + + P + VK  +Q++   T YN+G++ + +Q+   EG   L  G G   +      +
Sbjct: 27  THSAMVPIDVVKTRIQLE--PTVYNKGMISSFKQIISSEGAGALLTGFGPTLLGYSLQGS 84

Query: 96  VQFVVYEACKKHFFHVDGSKGREQLQNWQRLFSGALCGGCSVLATYPLDLVRTRLSIQTA 155
            +F  YE  KK F  V G       +N   + S A+    + +A  PL+  R RL     
Sbjct: 85  FKFGGYEVFKKLFIDVLGYDQAVNYKNSIYIGSAAIAEFFADIALCPLEATRIRL----- 139

Query: 156 NLTKLSKSRAHNISKPP---GVWDLLCRTYKEEGGIKGLYRGVWPTSLGVVPYVALNFAV 212
                       +S+P    G+     R  KEEG     Y G  P     +PY    F V
Sbjct: 140 ------------VSQPTFANGLVGGFSRILKEEGA-GSFYNGFTPILFKQIPYNIAKFLV 186

Query: 213 YEQFKE--FMPEGTDNTLANFYKLSIGALSG---GVAQT-VTYPFDLLRRRFQVLAMGGN 266
           +E+  E  F   G   +L+      I  LSG   G+A   V+ P D L  +         
Sbjct: 187 FERAAEVYFGMAGPKESLSTASTTGINLLSGLTAGLAAAIVSQPADTLLSKVNKTKKAPG 246

Query: 267 ELGFRYKSVMDALITIGKTEGFRGYYKGLTANLFKVIPSTAVSWLVY 313
           +      S +  L  + K  GF G + GL   L  V   T++ + +Y
Sbjct: 247 Q------STIGLLAQLAKQLGFVGSFAGLPTRLVMVGTLTSLQFGIY 287

 Score = 43.9 bits (102), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 52/206 (25%), Positives = 78/206 (37%), Gaps = 26/206 (12%)

Query: 119 QLQNWQRL-FSGALCGGCSVLATYPLDLVRTRLSIQTANLTKLSKSRAHNISKPPGVWDL 177
            L ++ +   +GA+  G +  A  P+D+V+TR+ ++     K   S    I    G   L
Sbjct: 9   SLSDYAKFALAGAIGCGTTHSAMVPIDVVKTRIQLEPTVYNKGMISSFKQIISSEGAGAL 68

Query: 178 LCRTYKEEGGIKGLYRGVWPTSLGVVPYVALNFAVYEQFKEFMPEGTDNTLANFYKLSI- 236
           L               G  PT LG     +  F  YE FK+   +      A  YK SI 
Sbjct: 69  LT--------------GFGPTLLGYSLQGSFKFGGYEVFKKLFIDVLGYDQAVNYKNSIY 114

Query: 237 ---GALSGGVAQTVTYPFDLLRRRFQVLAMGGNELGFRYKSVMDALITIGKTEGFRGYYK 293
               A++   A     P +  R R        N L   +  ++       K EG   +Y 
Sbjct: 115 IGSAAIAEFFADIALCPLEATRIRLVSQPTFANGLVGGFSRIL-------KEEGAGSFYN 167

Query: 294 GLTANLFKVIPSTAVSWLVYEVVCDL 319
           G T  LFK IP     +LV+E   ++
Sbjct: 168 GFTPILFKQIPYNIAKFLVFERAAEV 193

>Kwal_27.12599
          Length = 304

 Score = 62.0 bits (149), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 65/279 (23%), Positives = 117/279 (41%), Gaps = 23/279 (8%)

Query: 39  VVSPFERVKILLQVQNSTTAYNQGIVGAVRQVYREEGTPGLFRGNGLNCIRIFPYSAVQF 98
           V  PF+  K+ LQ   + T      V  V+++ + EG  G ++G     + +    + QF
Sbjct: 41  VGQPFDTTKVRLQTSTTPTT----AVEVVKKLVKNEGLRGFYKGTLTPLVGVGACVSCQF 96

Query: 99  VVYEACKKHFFHVDGSKGREQLQNWQRLFSGALCGGCSVLATYPLDLVRTRLSIQTANLT 158
            V EA K+ FF    +   + L   Q    G + G  +     P++ VR RL  QTA+ T
Sbjct: 97  GVNEAMKR-FFRGSSADPHKTLTLPQYYICGFVGGVANSFLASPIEHVRIRLQTQTASGT 155

Query: 159 KLSKSRAHNISKPPGVWDLLCRTYKEEGGIKGLYRGVWPTSLGVVPYVALNFAVYEQF-K 217
                    +++  G  D + +  +  G    L RG+ PT L      A  F  YE    
Sbjct: 156 ---------VAEFKGPLDCINK-LRANG---ALMRGLSPTILREAQGCATYFLTYEALVA 202

Query: 218 EFMPEGTDNTLANFYKLSI-GALSGGVAQTVTYPFDLLRRRFQVLAMGGNELGFRYKSVM 276
             + +G   +    +KL + GA+SG       YP D+++   Q   +       R K+++
Sbjct: 203 NQIGKGIARSDVPAWKLCLFGAVSGVTLWLTVYPLDVIKSLMQTDNLKNP---VRGKNII 259

Query: 277 DALITIGKTEGFRGYYKGLTANLFKVIPSTAVSWLVYEV 315
                +    G++ ++KG    + +  P+   ++  +E+
Sbjct: 260 QVARLVNAKYGWKSFFKGFGPTMLRAAPANGATFATFEL 298

 Score = 53.9 bits (128), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 51/184 (27%), Positives = 79/184 (42%), Gaps = 18/184 (9%)

Query: 39  VVSPFERVKILLQVQNS--TTAYNQGIVGAVRQVYREEGTPGLFRGNGLNCIRIFPYSAV 96
           + SP E V+I LQ Q +  T A  +G +  + ++ R  G   L RG     +R     A 
Sbjct: 136 LASPIEHVRIRLQTQTASGTVAEFKGPLDCINKL-RANG--ALMRGLSPTILREAQGCAT 192

Query: 97  QFVVYEACKKHFFHVDGSKGREQLQNWQRLFSGALCGGCSVLATYPLDLVRTRLSIQTAN 156
            F+ YEA   +   +     R  +  W+    GA+ G    L  YPLD++++ +  QT N
Sbjct: 193 YFLTYEALVAN--QIGKGIARSDVPAWKLCLFGAVSGVTLWLTVYPLDVIKSLM--QTDN 248

Query: 157 LTKLSKSRAHNISKPPGVWDLLCRTYKEEGGIKGLYRGVWPTSLGVVPYVALNFAVYEQF 216
           L   +  R  NI +       + R    + G K  ++G  PT L   P     FA +E  
Sbjct: 249 LK--NPVRGKNIIQ-------VARLVNAKYGWKSFFKGFGPTMLRAAPANGATFATFELA 299

Query: 217 KEFM 220
             F+
Sbjct: 300 MRFL 303

 Score = 44.3 bits (103), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 48/199 (24%), Positives = 75/199 (37%), Gaps = 30/199 (15%)

Query: 124 QRLFSGALCGGCSVLATYPLDLVRTRLSIQTANLTKLSKSRAHNISKPPGVWDLLCRTYK 183
           + L +G   G   VL   P D  + RL   T   T +               +++ +  K
Sbjct: 26  KDLLAGTAGGMAQVLVGQPFDTTKVRLQTSTTPTTAV---------------EVVKKLVK 70

Query: 184 EEGGIKGLYRGVWPTSLGVVPYVALNFAVYEQFKEFMPEGTDN-----TLANFYKLSIGA 238
            EG ++G Y+G     +GV   V+  F V E  K F    + +     TL  +Y   I  
Sbjct: 71  NEG-LRGFYKGTLTPLVGVGACVSCQFGVNEAMKRFFRGSSADPHKTLTLPQYY---ICG 126

Query: 239 LSGGVAQT-VTYPFDLLRRRFQVLAMGGNELGFRYKSVMDALITIGKTEGFRGYYKGLTA 297
             GGVA + +  P + +R R Q     G    F+       L  I K        +GL+ 
Sbjct: 127 FVGGVANSFLASPIEHVRIRLQTQTASGTVAEFK-----GPLDCINKLRANGALMRGLSP 181

Query: 298 NLFKVIPSTAVSWLVYEVV 316
            + +     A  +L YE +
Sbjct: 182 TILREAQGCATYFLTYEAL 200

>AAL014C [173] [Homologous to ScYNL003C (PET8) - SH]
           (317388..318203) [816 bp, 271 aa]
          Length = 271

 Score = 61.6 bits (148), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 60/252 (23%), Positives = 111/252 (44%), Gaps = 24/252 (9%)

Query: 71  YREEGTPGLFRGNGLNCIRIFPYSAVQFVVYEACKKHFFHVDGS-KGREQLQN-WQRLFS 128
           +   G  G++RG G   +   P +++ FV Y++ K+    V G     EQL      + S
Sbjct: 40  FHNGGYRGIYRGLGSAVVASAPGASLFFVTYDSMKQQLRPVMGRWTASEQLAEVLTHMLS 99

Query: 129 GALCGGCSVLATYPLDLVRTRLSIQTANLTKLSKSRAHNISKPPGVWDLLCRTYKEEGGI 188
            +L    + L   P ++++ R             ++ H+ +       L+ R    EG +
Sbjct: 100 SSLGEMSACLVRVPAEVIKQR-------------TQTHHTNSSLQTLRLILRDPTGEGVV 146

Query: 189 KGLYRGVWPTSLGVVPYVALNFAVYEQFKEFMPEGTDNTLANFYKLSI-GALSGGVAQTV 247
           +GLYRG W T +  +P+  + F +YE  K+      +    + ++ ++ G+L+GG+A   
Sbjct: 147 RGLYRGWWTTIMREIPFTCIQFPLYEYLKKKWAAYAEIERVSAWQGAVCGSLAGGIAAAA 206

Query: 248 TYPFDLLRRRFQVLAMGGNELGFRYKSVMDALITIGKTEGFRGYYKGLTANLFKVIPSTA 307
           T P D+L+ R          L  R   ++    T+ + EG R +++G+      +    A
Sbjct: 207 TTPLDVLKTRMM--------LHERRVPMLHLARTLFREEGARVFFRGIGPRTMWISAGGA 258

Query: 308 VSWLVYEVVCDL 319
           +   VYE V  L
Sbjct: 259 IFLGVYEAVHSL 270

>Sklu_2398.4 , Contig c2398 9476-10405
          Length = 309

 Score = 62.0 bits (149), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 66/288 (22%), Positives = 115/288 (39%), Gaps = 29/288 (10%)

Query: 39  VVSPFERVKILLQVQNSTTAYNQGIVGAVRQVYREEGTPGLFRGNGLNCIRIFPYSAVQF 98
           V  PF+  K+ +Q    T+A +   V  V  + + EG  G ++G     + +    + QF
Sbjct: 40  VGQPFDITKVRMQ----TSAGSATAVDVVTSLIKNEGILGFYKGTLAPLVGVGACVSCQF 95

Query: 99  VVYEACKKHFFHVDGSKGREQLQNWQRLFSGALCGGCSVLATYPLDLVRTRLSIQTANLT 158
            V EA K+ F  ++G   +  L   Q    G   G  +     P++ VR RL +QT +L 
Sbjct: 96  GVNEAMKRRFRRMNGDPSKP-LSLKQYYVCGVASGCANAFLATPIEHVRIRLQLQTKSLA 154

Query: 159 KLSKSRAHNISKPPGVWDLLCRTYKEEGGIKGLYRGVWPTSLGVVPYVALNFAVYE---- 214
                     ++  G  D + +  K+      L RG   T +       + F+ YE    
Sbjct: 155 N---------AEYQGSLDCMRKLLKQ----GALMRGFTATLMRTCHGFGIYFSTYEALIA 201

Query: 215 -QFKEFMPEGTDNTLANFYKLSIGALSGGVAQTVTYPFDLLRRRFQVLAMGGNELGFRYK 273
            Q K+ +P      +A +     GA SG     + YP D+++   Q   +     G    
Sbjct: 202 NQHKKGIPR---KDIAPWKVCIFGAFSGACYWAMAYPIDVVKSIMQSDRLVSPVHGTNVW 258

Query: 274 SVMDALITIGKTEGFRGYYKGLTANLFKVIPSTAVSWLVYEVVCDLMH 321
            V  ++ T   T G R + KG    + + +P    ++  +E+   L+ 
Sbjct: 259 QVAKSIYT---TRGKRAFIKGFMPAMLRSLPVNGATFATFEMTMRLLE 303

>Sklu_2115.4 YDL119C, Contig c2115 2906-3805
          Length = 299

 Score = 61.6 bits (148), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 73/299 (24%), Positives = 117/299 (39%), Gaps = 49/299 (16%)

Query: 35  VSRTVVSPFERVKILLQVQNSTTAYNQGIVGAVRQVYREEGTPGLFRGNGLNCIRIFPYS 94
            S  V+ PF+ +K  LQ    TT +     G ++++   +    L+RG   + +R    S
Sbjct: 20  TSAIVLQPFDLLKTRLQQNKDTTLW-----GTLKEIRSPKQ---LWRGALPSSLRTSIGS 71

Query: 95  AVQ------FVVYEACKKHFFHVDGSKGREQLQNWQRLFSGALCGGCSVLATYPLDLVRT 148
           A+       F    A  K      GS    QL  ++ L SGA   G     T P+ +++ 
Sbjct: 72  ALYLSTLNVFRTAMAKGKTQTLNPGSSFLPQLTMYENLASGAFTRGVVGFITMPITIIKV 131

Query: 149 RLSIQTANLTKLSKSRAHNISKPPGVWDLLCRTYKEEGGIKGLYRGVWPTSLGVVPYVAL 208
           R      +   L ++  H               Y  EG I+G + G   T +   PY  L
Sbjct: 132 RYESTMYSYKSLGEATRH--------------IYSTEG-IRGFFNGCGATVMRDAPYAGL 176

Query: 209 NFAVYEQFKEFMP------------EGTDNTLANFYKLSIGA-LSGGVAQTVTYPFDLLR 255
              +YE+ K  +P             G   T  +    SI A +S  +A T+T PFD ++
Sbjct: 177 YVLLYEKAKLLVPMMLPSSTISYDEAGMFTTYTSTVVNSISAFMSASLATTITSPFDTIK 236

Query: 256 RRFQVLAMGGNELGFRYKSVMDALITIGKTEGFRGYYKGLTANLFKVIPSTAVSWLVYE 314
            R Q+          ++      L+ I   E F+  + GLT  L +   S  ++W +YE
Sbjct: 237 TRMQLDPT-------KFSGFYKTLVLIVSKEKFKNLFDGLTLRLTRKAFSAGIAWGIYE 288

 Score = 58.2 bits (139), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 54/207 (26%), Positives = 85/207 (41%), Gaps = 37/207 (17%)

Query: 118 EQLQNWQRLFSGALCGGCSVLATYPLDLVRTRLSIQTANLTKLSKSRAHNISKPPGVWDL 177
           E+ +    L  G + G  S +   P DL++TRL                  +K   +W  
Sbjct: 3   ERPKTSSHLIGGFVGGLTSAIVLQPFDLLKTRL----------------QQNKDTTLWG- 45

Query: 178 LCRTYKEEGGIKGLYRGVWPTSLGVVPYVALNFAVYEQFKEFMPEGTDNTL--------- 228
              T KE    K L+RG  P+SL      AL  +    F+  M +G   TL         
Sbjct: 46  ---TLKEIRSPKQLWRGALPSSLRTSIGSALYLSTLNVFRTAMAKGKTQTLNPGSSFLPQ 102

Query: 229 -ANFYKLSIGALSGGVAQTVTYPFDLLRRRFQVLAMGGNELGFRYKSVMDALITIGKTEG 287
              +  L+ GA + GV   +T P  +++ R++          + YKS+ +A   I  TEG
Sbjct: 103 LTMYENLASGAFTRGVVGFITMPITIIKVRYE-------STMYSYKSLGEATRHIYSTEG 155

Query: 288 FRGYYKGLTANLFKVIPSTAVSWLVYE 314
            RG++ G  A + +  P   +  L+YE
Sbjct: 156 IRGFFNGCGATVMRDAPYAGLYVLLYE 182

>Scas_558.2
          Length = 289

 Score = 61.2 bits (147), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 54/256 (21%), Positives = 113/256 (44%), Gaps = 32/256 (12%)

Query: 71  YREEGTPGLFRGNGLNCIRIFPYSAVQFVVYEACK-------KHFFHVDGSKGREQLQNW 123
           ++  G  G++RG G   +   P +++ FV Y++ K       +   +  G++    +   
Sbjct: 41  FQNGGYHGIYRGLGSAVVASAPSASLFFVTYDSMKVRVRPHVERVINSSGTRSPHSVDTI 100

Query: 124 QRLFSGALCGGCSVLATYPLDLVRTRLSIQTANLTKLSKSRAHNISKPPGVWDLLCRTYK 183
             + + ++    + L   P ++++ R             ++ H+ +     +  + +   
Sbjct: 101 VHMIASSMGELAACLVRVPAEVIKQR-------------TQVHSTNSSWQTFRTILKNEN 147

Query: 184 EEGGIKGLYRGVWPTSLGVVPYVALNFAVYEQFKEFMPEGTDNTLANF--YKLSI-GALS 240
           +EG I+ LYRG   T +  +P+  + F +YE  K+      DN + +   +K +I G+++
Sbjct: 148 QEGIIRNLYRGWSTTIMREIPFTCIQFPLYEFMKKEWAL-YDNEVGHLKPWKGAICGSIA 206

Query: 241 GGVAQTVTYPFDLLRRRFQVLAMGGNELGFRYKSVMDALITIGKTEGFRGYYKGLTANLF 300
           GG+A   T P D L+ R  +     N+     KS++     I K EGF+ ++ G+     
Sbjct: 207 GGIAAATTTPLDFLKTRLML-----NKDSIPIKSLIR---NIYKEEGFKIFFSGIYPRTM 258

Query: 301 KVIPSTAVSWLVYEVV 316
            +    A+   VYE +
Sbjct: 259 WISAGGAIFLGVYETM 274

>Sklu_2432.5 YLR348C, Contig c2432 10310-11176 reverse complement
          Length = 288

 Score = 60.8 bits (146), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 54/188 (28%), Positives = 81/188 (43%), Gaps = 18/188 (9%)

Query: 129 GALCGGCSVLATYPLDLVRTRLSIQTANLTKLSKSRAHNISKPPGVWDLLCRTYKEEGGI 188
           G   G  + +AT+PLDL + RL  QTA   K            P +  +  +  + EG +
Sbjct: 15  GGFGGIVACVATHPLDLAKVRL--QTAPAPK------------PTLVRMASQILRNEG-V 59

Query: 189 KGLYRGVWPTSLGVVPYVALNFAVYEQFKE-FMPEGTDNTLANFYKLSIGALSGGVAQTV 247
            GLY G+    L    Y    F VY+  KE ++P+   N++   Y L     SG V   +
Sbjct: 60  PGLYSGLTAAILRQCTYTTARFGVYDFVKERYIPKEYLNSM--LYLLPCSMFSGAVGGLI 117

Query: 248 TYPFDLLRRRFQVLAMGGNELGFRYKSVMDALITIGKTEGFRGYYKGLTANLFKVIPSTA 307
             P D++  R Q  +    EL   YK+  D L  I   EG    + G   NL + I  T+
Sbjct: 118 GNPADVVNIRMQNDSSLPAELRRNYKNAADGLYKICSGEGVAKLFTGWQPNLVRGILMTS 177

Query: 308 VSWLVYEV 315
              + Y++
Sbjct: 178 SQVVTYDI 185

 Score = 55.1 bits (131), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 78/292 (26%), Positives = 121/292 (41%), Gaps = 45/292 (15%)

Query: 35  VSRTVVSPFERVKILLQVQNSTTAYNQGIVGAVRQVYREEGTPGLFRGNGLNCIRIFPYS 94
           V+     P +  K+ LQ   +  A    +V    Q+ R EG PGL+ G     +R   Y+
Sbjct: 21  VACVATHPLDLAKVRLQ---TAPAPKPTLVRMASQILRNEGVPGLYSGLTAAILRQCTYT 77

Query: 95  AVQFVVYEACKKHFFHVDGSKGREQLQNWQRL-----FSGALCGGCSVLATYPLDLVRTR 149
             +F VY+  K+ +        +E L +   L     FSGA+ G    L   P D+V  R
Sbjct: 78  TARFGVYDFVKERYIP------KEYLNSMLYLLPCSMFSGAVGG----LIGNPADVVNIR 127

Query: 150 L---SIQTANLTKLSKSRA---HNISKPPGVWDLLCRTYKEEGGIKGLYRGVWPTSLGVV 203
           +   S   A L +  K+ A   + I    GV  L        G    L RG+  TS  VV
Sbjct: 128 MQNDSSLPAELRRNYKNAADGLYKICSGEGVAKLF------TGWQPNLVRGILMTSSQVV 181

Query: 204 PY-VALNFAVYEQFKEFMPEGTDNTLANFYKLSIGALSGGVAQTVTYPFDLLRRRFQVLA 262
            Y +A N+ V     + +    DN   +F   +   L+G VA TV  P D+++ R     
Sbjct: 182 TYDIAKNYLV-----QNVGLDKDNKSTHF---ASSLLAGLVATTVCSPADVIKTRVM--- 230

Query: 263 MGGNELGFRYKSVMDALITIGKTEGFRGYYKGLTANLFKVIPSTAVSWLVYE 314
              N     + S +  L+   K EG    ++G   +  ++ P+T + +L  E
Sbjct: 231 ---NAHKHSHDSAVRILLDAVKQEGPSFMFRGWLPSFVRLGPNTILIFLTVE 279

 Score = 35.0 bits (79), Expect = 0.065,   Method: Compositional matrix adjust.
 Identities = 22/89 (24%), Positives = 42/89 (47%), Gaps = 2/89 (2%)

Query: 19  KNDSNVAFXXXXXXXXVSRTVVSPFERVKILLQVQNSTTAYNQGIVGAVRQVYREEGTPG 78
           K++ +  F        V+ TV SP + +K   +V N+    +   V  +    ++EG   
Sbjct: 198 KDNKSTHFASSLLAGLVATTVCSPADVIKT--RVMNAHKHSHDSAVRILLDAVKQEGPSF 255

Query: 79  LFRGNGLNCIRIFPYSAVQFVVYEACKKH 107
           +FRG   + +R+ P + + F+  E  +KH
Sbjct: 256 MFRGWLPSFVRLGPNTILIFLTVEQLRKH 284

 Score = 33.1 bits (74), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 26/80 (32%), Positives = 33/80 (41%), Gaps = 7/80 (8%)

Query: 237 GALSGGVAQTVTYPFDLLRRRFQVLAMGGNELGFRYKSVMDALITIGKTEGFRGYYKGLT 296
           G   G VA   T+P DL + R Q        L  R  S       I + EG  G Y GLT
Sbjct: 15  GGFGGIVACVATHPLDLAKVRLQTAPAPKPTL-VRMAS------QILRNEGVPGLYSGLT 67

Query: 297 ANLFKVIPSTAVSWLVYEVV 316
           A + +    T   + VY+ V
Sbjct: 68  AAILRQCTYTTARFGVYDFV 87

>CAGL0J04114g complement(384321..385232) similar to sp|Q99297
           Saccharomyces cerevisiae YOR222w ODC2 or sp|Q03028
           Saccharomyces cerevisiae YPL134c ODC1, start by
           similarity
          Length = 303

 Score = 60.8 bits (146), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 68/284 (23%), Positives = 117/284 (41%), Gaps = 28/284 (9%)

Query: 39  VVSPFERVKILLQVQ-----NSTTAYNQGIVGAVRQVYREEGTPGLFRGNGLNCIRIFPY 93
           V+ P + VK  +Q+Q      S  AYN G++  + Q+ + EG   L++G     +   P 
Sbjct: 25  VMYPLDVVKTRMQLQVGSGTGSGVAYN-GVIDCLGQIVKREGFSRLYKGISSPMLMEAPK 83

Query: 94  SAVQFVVYEACKKHFFHVDGSKGREQLQNWQRLFSGALCGGCSVLATYPLDLVRTRLSIQ 153
            A +F   ++ +K F  +    G ++L     + SG+L G        P +LV+ RL  Q
Sbjct: 84  RATKFACNDSYQKMFKDL---YGVDKLTQQISILSGSLAGVTEACVIVPFELVKIRL--Q 138

Query: 154 TANLTKLSKSRAHNISKPPGVWDLLCRTYKEEGGIKGLYRGVWPTSLGVVPYVALNFAVY 213
             N            SK  G  +++ +T +E G I  LY G+  T      +    F V 
Sbjct: 139 DVN------------SKFNGPMEVVFKTIRETG-ILSLYNGLESTMWRNAFWNGGYFGVI 185

Query: 214 EQFKEFMPEGTDNTLANFYKLSIGALSGGVAQTVTYP-FDLLRRRFQVLA---MGGNELG 269
            Q +  +P+   NT      L  G + G    +  +    +++ R Q  A   +    + 
Sbjct: 186 FQIRALLPKAKTNTEKTTNDLIAGTIGGYCRYSTEHTILSVVKSRIQSGATTTLADGTVV 245

Query: 270 FRYKSVMDALITIGKTEGFRGYYKGLTANLFKVIPSTAVSWLVY 313
            +Y     +L  I   EGF   YKG    + ++ P   +  +V+
Sbjct: 246 PKYNWTWPSLFKIYSEEGFTALYKGFIPKILRLGPGGGIMLVVF 289

 Score = 59.7 bits (143), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 49/179 (27%), Positives = 81/179 (45%), Gaps = 18/179 (10%)

Query: 125 RLFSGALCGGCSVLATYPLDLVRTRLSIQTANLTKLSKSRAHNISKPPGVWDLLCRTYKE 184
           +  SGA  G   +L  YPLD+V+TR+ +Q  + T      A+N     GV D L +  K 
Sbjct: 11  QFVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGT--GSGVAYN-----GVIDCLGQIVKR 63

Query: 185 EGGIKGLYRGVWPTSLGVVPYVALNFAVYEQFKEFMPE--GTDNTLANFYKLSIGALSGG 242
           E G   LY+G+    L   P  A  FA  + +++   +  G D        LS G+L+G 
Sbjct: 64  E-GFSRLYKGISSPMLMEAPKRATKFACNDSYQKMFKDLYGVDKLTQQISILS-GSLAGV 121

Query: 243 VAQTVTYPFDLLRRRFQVLAMGGNELGFRYKSVMDALITIGKTEGFRGYYKGLTANLFK 301
               V  PF+L++ R Q       ++  ++   M+ +    +  G    Y GL + +++
Sbjct: 122 TEACVIVPFELVKIRLQ-------DVNSKFNGPMEVVFKTIRETGILSLYNGLESTMWR 173

 Score = 46.6 bits (109), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 27/87 (31%), Positives = 41/87 (47%)

Query: 224 TDNTLANFYKLSIGALSGGVAQTVTYPFDLLRRRFQVLAMGGNELGFRYKSVMDALITIG 283
           ++  L   Y+   GA +G     V YP D+++ R Q+    G   G  Y  V+D L  I 
Sbjct: 2   SEKPLPFIYQFVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIV 61

Query: 284 KTEGFRGYYKGLTANLFKVIPSTAVSW 310
           K EGF   YKG+++ +    P  A  +
Sbjct: 62  KREGFSRLYKGISSPMLMEAPKRATKF 88

>Kwal_56.23011
          Length = 303

 Score = 59.7 bits (143), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 70/290 (24%), Positives = 117/290 (40%), Gaps = 33/290 (11%)

Query: 39  VVSPFERVKILLQVQNSTTAYNQGIVGAVRQVYREEGTPGLFRGNGLNCIRIFPYSAVQF 98
           V  PF+  K+ LQ     T   Q     ++ + + EG    ++G       +    + QF
Sbjct: 40  VGQPFDITKVRLQTSPVPTTAAQ----VIKSLVKNEGLLAFYKGTLAPLAGVGACVSCQF 95

Query: 99  VVYEACKKHFFHVDGSKGREQLQNWQRLFSGALCGGCSVLATYPLDLVRTRLSIQTANLT 158
            V EA KK F   DG+   + L   Q    G + G  +     P++ VR RL +QTA+  
Sbjct: 96  GVNEALKKWFRKKDGNFD-QPLALRQYYACGFVSGTANAFLATPIEHVRIRLQLQTASS- 153

Query: 159 KLSKSRAHNISKPPGVWDLLCRTYKEEGGIKGLYRGVWPTSLGVVPY------VALNFAV 212
             S +  H      G  D   +  K+   ++G       TS G   Y      +  N A 
Sbjct: 154 --SAAEYH------GSLDCARKLLKQGALMRGFTATTLRTSHGFGIYFLTYETLIANQAH 205

Query: 213 YEQFKEFMPEGTDNTLANFYKLSI-GALSGGVAQTVTYPFDLLRRRFQVLAMGGNELGFR 271
           +   +E +P          +K+ + GA SG     +TYPFD+++   Q   +     G  
Sbjct: 206 HGVLRENIPA---------WKVCVYGAFSGAFFWAMTYPFDVVKSVMQADKLKNPVYGRN 256

Query: 272 YKSVMDALITIGKTEGFRGYYKGLTANLFKVIPSTAVSWLVYEVVCDLMH 321
             +V  A   I +  G R + KG T  + + +P    ++  +E+   L++
Sbjct: 257 PLAVAKA---IYRERGPRAFTKGFTPTMLRSLPVNGATFAAFEITMRLIN 303

 Score = 33.9 bits (76), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 41/199 (20%), Positives = 70/199 (35%), Gaps = 24/199 (12%)

Query: 121 QNWQRLFSGALCGGCSVLATYPLDLVRTRLSIQTANLTKLSKSRAHNISKPPGVWDLLCR 180
           Q  + +F G + G   VL   P D+ + RL                  S  P     + +
Sbjct: 22  QALKDVFCGTVGGVAQVLVGQPFDITKVRL----------------QTSPVPTTAAQVIK 65

Query: 181 TYKEEGGIKGLYRGVWPTSLGVVPYVALNFAVYEQFKEFMPEGT---DNTLANFYKLSIG 237
           +  +  G+   Y+G      GV   V+  F V E  K++  +     D  LA     + G
Sbjct: 66  SLVKNEGLLAFYKGTLAPLAGVGACVSCQFGVNEALKKWFRKKDGNFDQPLALRQYYACG 125

Query: 238 ALSGGVAQTVTYPFDLLRRRFQVLAMGGNELGFRYKSVMDALITIGKTEGFRGYYKGLTA 297
            +SG     +  P + +R R Q+     +     Y   +D    + K        +G TA
Sbjct: 126 FVSGTANAFLATPIEHVRIRLQLQTASSSAA--EYHGSLDCARKLLKQGAL---MRGFTA 180

Query: 298 NLFKVIPSTAVSWLVYEVV 316
              +      + +L YE +
Sbjct: 181 TTLRTSHGFGIYFLTYETL 199

>Kwal_47.19228
          Length = 281

 Score = 59.3 bits (142), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 40/134 (29%), Positives = 62/134 (46%), Gaps = 7/134 (5%)

Query: 187 GIKGLYRGVWPTSLGVVPYVALNFAVYEQFKEFMPEGTDNTLANFYKLSIGALSGGVAQT 246
           GI+G  +G  PT +      A+ F  Y   K+ +    +  L  +Y  ++G +S      
Sbjct: 143 GIRGFLQGTMPTIIRQTSNSAVRFTTYTSLKQMI--SPNKPLNEYYAFALGFISSCAVVA 200

Query: 247 VTYPFDLLRRRFQVLAMGGNELGFRYKSVMDALITIGKTEGFRGYYKGLTANLFKVIPST 306
           VT P D+++ R Q      N     YK+ ++    I   EGF  ++KG    L KV  S 
Sbjct: 201 VTQPIDVIKTRMQSKYTWSN-----YKNSLNCAYRIFVEEGFTKFWKGWAPRLMKVGLSG 255

Query: 307 AVSWLVYEVVCDLM 320
            VS+ VY+ V +LM
Sbjct: 256 GVSFGVYQYVDNLM 269

 Score = 39.3 bits (90), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 41/157 (26%), Positives = 66/157 (42%), Gaps = 25/157 (15%)

Query: 67  VRQVYREEGTPGLFRGNGLNCIRIFPYSAVQFVVYEACKKHFFHVDGSKGREQLQNWQRL 126
           V+++YR  G  G  +G     IR    SAV+F  Y + K+            +  N    
Sbjct: 135 VQEIYRSRGIRGFLQGTMPTIIRQTSNSAVRFTTYTSLKQMI-------SPNKPLNEYYA 187

Query: 127 FSGALCGGCSVLA-TYPLDLVRTRLSIQTANLTKLSKSRAHNISKPPGVWDLLC--RTYK 183
           F+      C+V+A T P+D+++TR+       +K + S   N         L C  R + 
Sbjct: 188 FALGFISSCAVVAVTQPIDVIKTRMQ------SKYTWSNYKN--------SLNCAYRIFV 233

Query: 184 EEGGIKGLYRGVWPTSLGVVPYVALNFAVYEQFKEFM 220
           EEG  K  ++G  P  + V     ++F VY+     M
Sbjct: 234 EEGFTK-FWKGWAPRLMKVGLSGGVSFGVYQYVDNLM 269

>Kwal_23.3529
          Length = 395

 Score = 59.3 bits (142), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 45/162 (27%), Positives = 77/162 (47%), Gaps = 13/162 (8%)

Query: 162 KSRAHNISKPPGVWDLLC---RTYKEEGGIKGLYRGVWPTSLGVVPYVALNFAVYEQFKE 218
           K+R       P   +++    + + EEG  +GLY G     LG  P  A+ F  YE  K 
Sbjct: 110 KTRQQGAPNAPKYRNMISAYQKIFMEEGIRRGLYGGYTAAMLGSFPSAAIFFGTYELTKR 169

Query: 219 FMPE--GTDNTLANFYKLSIGALSGGVAQTVTY-PFDLLRRRFQVLAMGGN---ELGFRY 272
            + +  G + TL++        LSG +  +V Y P ++L+ R Q+     N     G+ Y
Sbjct: 170 KLIDDWGVNETLSHL----TAGLSGDLVSSVVYVPSEVLKTRLQLQGCYNNPHFHSGYNY 225

Query: 273 KSVMDALITIGKTEGFRGYYKGLTANLFKVIPSTAVSWLVYE 314
           +++ DA+  I + EG++  + G  A L + +P +A  +  YE
Sbjct: 226 RNLRDAITAIVRLEGWQTLFFGYKATLCRDLPFSAFQFAFYE 267

 Score = 53.9 bits (128), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 50/170 (29%), Positives = 78/170 (45%), Gaps = 10/170 (5%)

Query: 35  VSRTVVSPFERVKILLQVQ------NSTTAYN-QGIVGAVRQVYREEGTPGLFRGNGLNC 87
           VS  V  P E +K  LQ+Q      +  + YN + +  A+  + R EG   LF G     
Sbjct: 193 VSSVVYVPSEVLKTRLQLQGCYNNPHFHSGYNYRNLRDAITAIVRLEGWQTLFFGYKATL 252

Query: 88  IRIFPYSAVQFVVYEACKKHFFHVDGSKGREQLQNWQRLFSGALCGGCSVLATYPLDLVR 147
            R  P+SA QF  YE  ++  F ++G    + L     L +GA  GG + + T P+D+++
Sbjct: 253 CRDLPFSAFQFAFYEKFRQWAFTLEGKTPSQDLSLLNELLTGAAAGGLAGIITTPMDVIK 312

Query: 148 TRLSIQTANLTKLSKSRAHNISKPPGVWDLLCRTYKEEGGIKGLYRGVWP 197
           TR+  Q  +      +R   I     +   L   Y+ EG + G + GV P
Sbjct: 313 TRIQTQMPSTVASDSTRLVRIEN--SLIKGLTAVYRSEGTL-GFFSGVGP 359

 Score = 53.9 bits (128), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 71/289 (24%), Positives = 129/289 (44%), Gaps = 21/289 (7%)

Query: 38  TVVSPFERVKILLQVQNSTTAYNQGIVGAVRQVYREEGTP-GLFRGNGLNCIRIFPYSAV 96
           +V+   + VK   Q   +   Y + ++ A ++++ EEG   GL+ G     +  FP +A+
Sbjct: 101 SVMHSLDTVKTRQQGAPNAPKY-RNMISAYQKIFMEEGIRRGLYGGYTAAMLGSFPSAAI 159

Query: 97  QFVVYEACKKHFFHVDGSKGREQLQNWQRLFSGALCGGCSVLATYPLDLVRTRLSIQTAN 156
            F  YE  K+    +D     E L +     SG L    S +   P ++++TRL +Q   
Sbjct: 160 FFGTYELTKRKL--IDDWGVNETLSHLTAGLSGDL---VSSVVYVPSEVLKTRLQLQGC- 213

Query: 157 LTKLSKSRAHNISKPPGVWDLLCRTYKEEGGIKGLYRGVWPTSLGVVPYVALNFAVYEQF 216
               +    H+      + D +    + E G + L+ G   T    +P+ A  FA YE+F
Sbjct: 214 ---YNNPHFHSGYNYRNLRDAITAIVRLE-GWQTLFFGYKATLCRDLPFSAFQFAFYEKF 269

Query: 217 KE--FMPEGT--DNTLANFYKLSIGALSGGVAQTVTYPFDLLRRRFQ-----VLAMGGNE 267
           ++  F  EG      L+   +L  GA +GG+A  +T P D+++ R Q      +A     
Sbjct: 270 RQWAFTLEGKTPSQDLSLLNELLTGAAAGGLAGIITTPMDVIKTRIQTQMPSTVASDSTR 329

Query: 268 LGFRYKSVMDALITIGKTEGFRGYYKGLTANLFKVIPSTAVSWLVYEVV 316
           L     S++  L  + ++EG  G++ G+          +++  L+Y+V 
Sbjct: 330 LVRIENSLIKGLTAVYRSEGTLGFFSGVGPRFIWTSIQSSIMLLLYQVT 378

 Score = 31.6 bits (70), Expect = 0.93,   Method: Compositional matrix adjust.
 Identities = 19/77 (24%), Positives = 34/77 (44%), Gaps = 9/77 (11%)

Query: 39  VVSPFERVKILLQVQNSTTAYNQG---------IVGAVRQVYREEGTPGLFRGNGLNCIR 89
           + +P + +K  +Q Q  +T  +           ++  +  VYR EGT G F G G   I 
Sbjct: 304 ITTPMDVIKTRIQTQMPSTVASDSTRLVRIENSLIKGLTAVYRSEGTLGFFSGVGPRFIW 363

Query: 90  IFPYSAVQFVVYEACKK 106
               S++  ++Y+   K
Sbjct: 364 TSIQSSIMLLLYQVTLK 380

>Sklu_2435.2 YPR128C, Contig c2435 2489-3523 reverse complement
          Length = 344

 Score = 58.5 bits (140), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 57/261 (21%), Positives = 108/261 (41%), Gaps = 33/261 (12%)

Query: 53  QNSTTAYNQGIVGAVRQVYREEGTPGLFRGNGLNCIRIFPYSAVQFVVYEACKKHFFHVD 112
           +N+   YN     A+ ++Y++EG  GL++G   + +  F  +   F  Y   +K +F V 
Sbjct: 69  ENNYLQYN-STFDAIYKIYKQEGIRGLYQGLTTSVMAGFFQTFSYFFWYSFVRKCYFRVK 127

Query: 113 G-SKGREQLQNWQRLFSGALCGGCSVLATYPLDLVRTRLSIQTANLTKLSKSRAHNISKP 171
             ++   +    + L  G +    S + T P+ L+  R            +     I   
Sbjct: 128 LINRKNTKFTTIEELLLGIVAAATSQIFTNPISLISAR------------QQTRQGIDGD 175

Query: 172 PGVWDLLCRTYKEEGGIKGLYRGVWPTSLGVVPYVALNFAVYEQFKEFM---------PE 222
                +    YKE+  IKG ++G+   SL +    ++ +  YE+ K+ +          E
Sbjct: 176 NDFLTVAKEIYKEQRSIKGFWKGL-KVSLMLTINPSITYTSYEKLKDALFTTDTMNLKKE 234

Query: 223 GTDNT--LANFYKLSIGALSGGVAQTVTYPFDLLRRRFQVLAMGGNELGFRYKSVMDALI 280
             D++  L+ +   ++G LS  ++  +T P  + +   Q         G  + S    L 
Sbjct: 235 LVDSSSQLSPYQNFTLGVLSKMISAIITMPLIISKAWLQ-------RNGSNFSSFQQVLY 287

Query: 281 TIGKTEGFRGYYKGLTANLFK 301
            + K EG R ++KGL+  L K
Sbjct: 288 YLYKNEGLRSWWKGLSPQLAK 308

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 47/231 (20%), Positives = 92/231 (39%), Gaps = 38/231 (16%)

Query: 120 LQNWQRLFSGALCGGCSVLATYPLDLVRTRLSIQTANLTKLSKSRAHNISK--------- 170
           + +++   SGA+    +    YPLDLV+T +  Q     +L +      S+         
Sbjct: 1   MASFESALSGAVASAMANTVVYPLDLVKTLVQTQLKQDEQLKQLETEPQSQDKDEPVKDI 60

Query: 171 PP--------------GVWDLLCRTYKEEGGIKGLYRGVWPTSLG-----VVPYVALNFA 211
           PP                +D + + YK+E GI+GLY+G+  + +         +   +F 
Sbjct: 61  PPVPIKLNENNYLQYNSTFDAIYKIYKQE-GIRGLYQGLTTSVMAGFFQTFSYFFWYSFV 119

Query: 212 VYEQFKEFMPEGTDNTLANFYKLSIGALSGGVAQTVTYPFDLLRRRFQVLA--MGGNELG 269
               F+  +    +       +L +G ++   +Q  T P  L+  R Q      G N+  
Sbjct: 120 RKCYFRVKLINRKNTKFTTIEELLLGIVAAATSQIFTNPISLISARQQTRQGIDGDNDFL 179

Query: 270 FRYKSVMDALITIGKTEGFRGYYKGLTANLFKVIPSTAVSWLVYEVVCDLM 320
              K +        +    +G++KGL  +L   I + ++++  YE + D +
Sbjct: 180 TVAKEIYK------EQRSIKGFWKGLKVSLMLTI-NPSITYTSYEKLKDAL 223

>KLLA0E09680g complement(860245..861168) similar to ca|CA5146|CaYMC2
           Candida albicans Carnitine/acylcarnitine translocase (by
           homology), start by similarity
          Length = 307

 Score = 58.5 bits (140), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 72/328 (21%), Positives = 139/328 (42%), Gaps = 41/328 (12%)

Query: 1   MSELAQVLPQPSYVKSILKNDSN---VAFXXXXXXXXVSRTVVSPFERVKILLQVQNSTT 57
           MS+ +  + +P  V S++ N++    + F            V  PF+ +K+ LQ   + T
Sbjct: 1   MSKSSNAITEP--VNSLISNETYSRIMGFVAGVFSGVAKNAVGHPFDTIKVRLQTSQNET 58

Query: 58  AYNQGIVGAVRQVYREEGTPGLFRGNGLNCIRIFPYSAVQFVVYEA----CKKHF---FH 110
            + +G +  V + +R +G  G + G        F    V +++ ++    C  ++    H
Sbjct: 59  RF-KGPLDCVYKTFRNQGIRGFYLG--------FTPPLVGWILMDSVMLGCLHNYRMLMH 109

Query: 111 VDGSKGREQLQNWQRLFSGALCGGCSVLATYPLDLVRTRLSIQTANLTKLSKSRAHNISK 170
                  E+L     + SG L G        P++L + +L +Q    T   K        
Sbjct: 110 KYVYPNDEKLPLSGCIISGVLAGWSVSFIAPPIELAKAKLQVQYDKTTTRYK-------- 161

Query: 171 PPGVWDLLCRTYKEEGGIKGLYRGVWPTSLGVVPYVALNFAVYEQFKEFMPEGTDNTLA- 229
             G  D++ + Y  +G I+GLY+G+  T +    +V   +  YE    +  E T  + A 
Sbjct: 162 --GPLDVIKKIYSAQG-IRGLYKGLISTLIFRTHFVYW-WGSYELLTRWFRENTKMSEAA 217

Query: 230 -NFYKLSIGALSGGVAQTVTYPFDLLRRRFQVLAMGGNELGFRYKSVMDALITIGKTEGF 288
            NF+     A  G    T  YP D++++    + +  ++    +KS   A+  I +++G 
Sbjct: 218 INFWAGGFSASFG--FWTTAYPSDVVKQ----VVLCNDKYDGSFKSWRTAVKDIYQSKGI 271

Query: 289 RGYYKGLTANLFKVIPSTAVSWLVYEVV 316
            G++KG   +  +  P+ A +   +E V
Sbjct: 272 NGFFKGFVPSFLRSFPANAAALAAFEFV 299

>Kwal_33.15446
          Length = 305

 Score = 58.2 bits (139), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 70/320 (21%), Positives = 130/320 (40%), Gaps = 35/320 (10%)

Query: 2   SELAQVLPQPSYVKSILKNDSNVAFXXXXXXXXVSRTVVSPFERVKILLQVQNSTTAYNQ 61
           S+   V+P  +Y + +        F            V  PF+ +K+ LQ    T  + +
Sbjct: 5   SDSNAVVPNEAYSRMM-------GFVSGMFSGIAKNAVGHPFDTIKVRLQTSQDTGRF-K 56

Query: 62  GIVGAVRQVYREEGTPGLFRGNGLNCIRIFPYSAVQFVV---YEACKKHFFHVDGSKGRE 118
           G +  V Q  R++G  G + G     +      +V       Y    K + +    +  E
Sbjct: 57  GPLDCVYQTMRQQGIRGFYLGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVY----QHEE 112

Query: 119 QLQNWQRLFSGALCGGCSVLATYPLDLVRTRLSIQTANLTKLSKSRAHNISKPPGVWDLL 178
           +L     + SG L G        P++L + +L +Q    T          ++  G  D++
Sbjct: 113 KLPLSGCILSGVLAGWSVSFIAAPVELAKAKLQVQYDAQT----------TRYRGPLDVI 162

Query: 179 CRTYKEEGGIKGLYRGVWPTSLGVVPYVALNFAVYEQFKEFMPEGTD--NTLANFYKLSI 236
            + Y  +G I+G+Y+G+  T +    +V   +  YE    +    T+  +T  NF+    
Sbjct: 163 KKVYAADG-IRGMYKGLVSTLIFRTHFVYW-WGSYELLTRWFKANTNLSDTAINFWAGGF 220

Query: 237 GALSGGVAQTVTYPFDLLRRRFQVLAMGGNELGFRYKSVMDALITIGKTEGFRGYYKGLT 296
            A  G    T  YP D+++   QV+ +  ++     +S  +A   I +T G RG++KG  
Sbjct: 221 SASFG--FWTTAYPSDVIK---QVI-LCNDKYDGSLRSWRNAASDIWRTRGIRGFFKGFV 274

Query: 297 ANLFKVIPSTAVSWLVYEVV 316
            +  +  P+ A +   +E V
Sbjct: 275 PSFLRSFPANAAALASFEFV 294

>KLLA0B12826g 1121106..1122065 similar to sp|P32332 Saccharomyces
           cerevisiae YKL120w PMT, start by similarity
          Length = 319

 Score = 57.8 bits (138), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 73/301 (24%), Positives = 121/301 (40%), Gaps = 35/301 (11%)

Query: 35  VSRTVVSPFERVKILLQVQ-----NSTTAYNQGIVGAVRQVYREEGTPGLFRGNGLNCIR 89
           ++ TV +PF+ VK  +Q+Q     N+   Y   I  A   +++ EG  GL +G     + 
Sbjct: 33  IAVTVTNPFDCVKTRMQLQGELHANAAKVYTNPIQ-AFGVIFKNEGIAGLQKGLASAYLY 91

Query: 90  IFPYSAVQFVVYEACK---KHFFHVDGSKGREQLQNWQRLFSGALCGGCSVLATYPLDLV 146
               +  +   YE  +    + F+ +    + Q      + +GA  G        PL LV
Sbjct: 92  QIALNGSRLGFYEPIRGILNNVFYPNVESHKVQ-HIGINVAAGATSGVVGAFIGSPLFLV 150

Query: 147 RTRLSIQTANLTKLSKSRAHNISKPP---GVWDLLCRTYKEEGGIKGLYRGVWPTSLGVV 203
           +TR+          S S A +I +       ++ L   ++ EG IKGL+RGV    L   
Sbjct: 151 KTRMQ---------SYSNAIHIGQQTHYTSAFNGLATIFRSEG-IKGLFRGVDAAMLRTG 200

Query: 204 PYVALNFAVYEQFKEFMPEG---TDNTLANFYKLSIGALSGGVAQTVTYPFDLLRRRFQV 260
              A+   +Y   K F+ +     D T  +    +I     GVA     P+D++  R   
Sbjct: 201 IGSAVQLPIYNICKNFLLKHDLMNDGTGLHLLSSTIAGFGVGVAMN---PWDVVLTRVY- 256

Query: 261 LAMGGNELGFRYKSVMDALITIGKTEGFRGYYKGLTANLFKVIPSTAVSWLVYEVVCDLM 320
                N+ G  Y   +D  I   + EG    YKG  A + ++ P T +     E    L+
Sbjct: 257 -----NQKGNLYSGPIDCFIKTVRNEGLSALYKGFGAQILRIGPHTVLCLTFMEQTLKLV 311

Query: 321 H 321
           +
Sbjct: 312 Y 312

 Score = 52.4 bits (124), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 48/213 (22%), Positives = 91/213 (42%), Gaps = 21/213 (9%)

Query: 118 EQLQNWQRLFSGALCGGCSVLATYPLDLVRTRLSIQTANLTKLSKSRAHNISKPPGVWDL 177
            ++  +    +G L    +V  T P D V+TR+ +Q     +L  + A   + P   + +
Sbjct: 16  HKVSKFGSFVAGGLAACIAVTVTNPFDCVKTRMQLQG----ELHANAAKVYTNPIQAFGV 71

Query: 178 LCRTYKEEGGIKGLYRGVWPTSLGVVPYVALNFAVYEQFKE-----FMPEGTDNTLANF- 231
           +   +K EG I GL +G+    L  +         YE  +      F P    + + +  
Sbjct: 72  I---FKNEG-IAGLQKGLASAYLYQIALNGSRLGFYEPIRGILNNVFYPNVESHKVQHIG 127

Query: 232 YKLSIGALSGGVAQTVTYPFDLLRRRFQ----VLAMGGNELGFRYKSVMDALITIGKTEG 287
             ++ GA SG V   +  P  L++ R Q     + +G       Y S  + L TI ++EG
Sbjct: 128 INVAAGATSGVVGAFIGSPLFLVKTRMQSYSNAIHIGQQT---HYTSAFNGLATIFRSEG 184

Query: 288 FRGYYKGLTANLFKVIPSTAVSWLVYEVVCDLM 320
            +G ++G+ A + +    +AV   +Y +  + +
Sbjct: 185 IKGLFRGVDAAMLRTGIGSAVQLPIYNICKNFL 217

>KLLA0B08503g complement(753498..754409) similar to sp|P32331
           Saccharomyces cerevisiae YPR058w YMC1 mitochondrial
           carrier protein (MCF), start by similarity
          Length = 303

 Score = 57.8 bits (138), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 70/288 (24%), Positives = 117/288 (40%), Gaps = 31/288 (10%)

Query: 39  VVSPFERVKILLQVQNSTTAYNQGIVGAVRQVYREEGTPGLFRGNGLNCIRIFPYSAVQF 98
           V  PF+  K+ LQ   ++T      V  ++ + + EG  G ++G     + +    ++QF
Sbjct: 40  VGQPFDTTKVRLQTSETST----NAVKVIKDLIKNEGPMGFYKGTLTPLVGVGACVSLQF 95

Query: 99  VVYEACKKHFFHVDGSKGREQLQNWQRLFSGALCGGCSVLATYPLDLVRTRLSIQTANLT 158
            V EA K+ FFH       + L   Q    G   G  +     P++ +R RL  QT    
Sbjct: 96  GVNEAMKR-FFHTFDEAASQHLSLLQYYICGVAGGFTNSFLASPIEHIRIRLQTQTG--- 151

Query: 159 KLSKSRAHNISKPPGVWDLLCRTYKEEGGIKGLYRGVWPTSLGVVPYVALNFAVYEQF-K 217
               S A    K P    + C       G   L RG+ PT L       + F  YE    
Sbjct: 152 ----SGATAEFKGP----IDCIKKLRVNG--QLMRGLTPTMLRESHGCGVYFLTYEALIG 201

Query: 218 EFMPEGTDNTLANFYKLSI-GALSGGVAQTVTYPFDLLRRRFQVLAMGGNELGFRYKSVM 276
             +  G        +KL + GA SG +  T+ YP D+++   Q   +   + G       
Sbjct: 202 HQVKSGIQRKDIPAWKLCLFGAASGTLLWTMVYPLDVIKSVMQTDNLKTPKNG------- 254

Query: 277 DALITIGKT----EGFRGYYKGLTANLFKVIPSTAVSWLVYEVVCDLM 320
           + ++T+G+T    +G  G +KG    + +  P+ A ++  +E    L+
Sbjct: 255 NNILTVGRTIIARQGVSGLFKGFAPTMLRAAPANAATFATFETAMRLL 302

 Score = 32.0 bits (71), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 30/100 (30%), Positives = 42/100 (42%), Gaps = 11/100 (11%)

Query: 225 DNTLANFYKLSIGALSGGVAQT-VTYPFDLLRRRFQVLAMGGNELGFRYKSVMDALITIG 283
           DNT     K  +   +GG+AQ  V  PFD  + R Q      N +      V+  LI   
Sbjct: 19  DNT--RVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSETSTNAV-----KVIKDLI--- 68

Query: 284 KTEGFRGYYKGLTANLFKVIPSTAVSWLVYEVVCDLMHVW 323
           K EG  G+YKG    L  V    ++ + V E +    H +
Sbjct: 69  KNEGPMGFYKGTLTPLVGVGACVSLQFGVNEAMKRFFHTF 108

>Kwal_33.12988
          Length = 303

 Score = 56.6 bits (135), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 67/285 (23%), Positives = 116/285 (40%), Gaps = 23/285 (8%)

Query: 39  VVSPFERVKILLQVQNSTTAYNQGIVGAVRQVYREEGTPGLFRGNGLNCIRIFPYSAVQF 98
           V  PF+  K+ LQ  ++ T      +  V+ + + EG  G ++G  L  I +    + QF
Sbjct: 40  VGQPFDITKVRLQTSSTPTT----ALRVVQDLVKNEGLRGFYKGTTLPLIGVGLCVSSQF 95

Query: 99  VVYEACKKHFFHVDGSKGREQLQNWQRLFSGALCGGCSVLATYPLDLVRTRLSIQTANLT 158
              EA K+ +FH   +     L+  +    G + G  +     P++ VR  L +QT    
Sbjct: 96  GTNEAMKR-YFHKRNNFQSTSLRLPEYYACGFVSGCANAFLATPIEHVRILLQVQT---- 150

Query: 159 KLSKSRAHNISKPPGVWDLLCRTYKEEGGIKGLYRGVWPTSLGVVPYVALNFAVYE-QFK 217
              KSRA   ++  G  D + +  KE      L RG  PT L       + F  YE    
Sbjct: 151 ---KSRAD--AEYQGAMDCIKKLLKE----GKLMRGFTPTILRTSHGFGVYFTSYEAMIC 201

Query: 218 EFMPEGTDNTLANFYKLSI-GALSGGVAQTVTYPFDLLRRRFQVLAMGGNELGFRYKSVM 276
               +G        +KL + GA SG +   + YPFD+++   Q   +     G    +V 
Sbjct: 202 SEQRKGIARKDIPAWKLCLYGAFSGSLLWAMVYPFDVIKSVMQSDKLRTPVYG---TNVF 258

Query: 277 DALITIGKTEGFRGYYKGLTANLFKVIPSTAVSWLVYEVVCDLMH 321
                I    G + + KG    + + +P    ++  +E+   +++
Sbjct: 259 QVAKNIYNERGPKAFVKGFGPTMLRSLPVNGATFTAFEMAMRILN 303

>Kwal_33.15597
          Length = 305

 Score = 56.6 bits (135), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 68/287 (23%), Positives = 109/287 (37%), Gaps = 35/287 (12%)

Query: 36  SRTVVSPFERVKILLQVQNSTTAYNQGIVGAVRQVYREEGTPGLFRGNGLNCIRIFPYSA 95
           + + + P + VK  +Q++   T YN+G++ + +Q+   EG   L  G G   +      +
Sbjct: 27  THSAMVPIDVVKTRIQLE--PTVYNKGMISSFKQIISSEGAGALLTGFGPTLLGYSLQGS 84

Query: 96  VQFVVYEACKKHFFHVDGSKGREQLQNWQRLFSGALCGGCSVLATYPLDLVRTRLSIQTA 155
            +F  YE  KK F    G       +N   + S A+    + +A  PL+  R RL     
Sbjct: 85  FKFGGYEVFKKLFIDTLGYDQAVNYKNSIYIGSAAIAEFFADIALCPLEATRIRL----- 139

Query: 156 NLTKLSKSRAHNISKPP---GVWDLLCRTYKEEGGIKGLYRGVWPTSLGVVPYVALNFAV 212
                       +S+P    G+     R  KEE G+   Y G  P     +PY    F V
Sbjct: 140 ------------VSQPTFANGLVGGFSRILKEE-GLSSFYNGFTPILFKQIPYNIAKFLV 186

Query: 213 YEQFKEFM------PEGTDNTLANFYKLSIGALSGGVAQTVTYPFDLLRRRFQVLAMGGN 266
           +E+  E         E    +      L  G  +G  A  V+ P D L  +         
Sbjct: 187 FERAAEVYFGMAGPKETLSTSTTTGLNLLSGLTAGLAAAIVSQPADTLLSKVNKAKKAPG 246

Query: 267 ELGFRYKSVMDALITIGKTEGFRGYYKGLTANLFKVIPSTAVSWLVY 313
           +      S +  L  + K  GF G + GL   L  V   T++ + +Y
Sbjct: 247 Q------STIGLLGQLAKELGFVGSFAGLPTRLVMVGTLTSLQFGIY 287

 Score = 46.2 bits (108), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 51/197 (25%), Positives = 74/197 (37%), Gaps = 25/197 (12%)

Query: 127 FSGALCGGCSVLATYPLDLVRTRLSIQTANLTKLSKSRAHNISKPPGVWDLLCRTYKEEG 186
            +GA+  G +  A  P+D+V+TR+ ++     K   S    I    G   LL        
Sbjct: 18  LAGAIGCGTTHSAMVPIDVVKTRIQLEPTVYNKGMISSFKQIISSEGAGALLT------- 70

Query: 187 GIKGLYRGVWPTSLGVVPYVALNFAVYEQFKEFMPEGTDNTLANFYKLSI----GALSGG 242
                  G  PT LG     +  F  YE FK+   +      A  YK SI     A++  
Sbjct: 71  -------GFGPTLLGYSLQGSFKFGGYEVFKKLFIDTLGYDQAVNYKNSIYIGSAAIAEF 123

Query: 243 VAQTVTYPFDLLRRRFQVLAMGGNELGFRYKSVMDALITIGKTEGFRGYYKGLTANLFKV 302
            A     P +  R R        N L   +  ++       K EG   +Y G T  LFK 
Sbjct: 124 FADIALCPLEATRIRLVSQPTFANGLVGGFSRIL-------KEEGLSSFYNGFTPILFKQ 176

Query: 303 IPSTAVSWLVYEVVCDL 319
           IP     +LV+E   ++
Sbjct: 177 IPYNIAKFLVFERAAEV 193

>Sklu_2075.3 , Contig c2075 6414-7451 reverse complement
          Length = 345

 Score = 56.2 bits (134), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 67/320 (20%), Positives = 131/320 (40%), Gaps = 35/320 (10%)

Query: 2   SELAQVLPQPSYVKSILKNDSNVAFXXXXXXXXVSRTVVSPFERVKILLQVQNSTTAYNQ 61
           S++ Q  P  +Y + +        F            V  PF+ +K+ LQ    +T + +
Sbjct: 47  SDIQQPPPSEAYSRIM-------GFVSGMFSGIAKNAVGHPFDTIKVRLQTSQDSTRF-K 98

Query: 62  GIVGAVRQVYREEGTPGLFRGNGLNCIRIFPYSAVQFVV---YEACKKHFFHVDGSKGRE 118
           G +  V + + ++G  G + G     +      +V       Y    K + + +     E
Sbjct: 99  GPLDCVYKTFTQQGIRGFYLGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYYN----EE 154

Query: 119 QLQNWQRLFSGALCGGCSVLATYPLDLVRTRLSIQTANLTKLSKSRAHNISKPPGVWDLL 178
           +L     + SG + G        P++L + +L +Q    T          +K  G  D++
Sbjct: 155 KLPLSGCIISGVMAGWSVSFIAAPVELAKAKLQVQYDAKT----------TKYTGPVDVI 204

Query: 179 CRTYKEEGGIKGLYRGVWPTSLGVVPYVALNFAVYEQFKEFMPEGTD--NTLANFYKLSI 236
            + Y    G++GLY+G+  T +    +V   +  YE    +  E T+  +T  NF+    
Sbjct: 205 KKVY-SSNGVRGLYKGLTSTLIFRTNFV-FWWGSYELLTRWFKEHTNMSDTAINFWSGGF 262

Query: 237 GALSGGVAQTVTYPFDLLRRRFQVLAMGGNELGFRYKSVMDALITIGKTEGFRGYYKGLT 296
            A  G    T  YP D++++    + +  ++    ++S   A   I +T G+RG++KG  
Sbjct: 263 SASFG--FWTTAYPSDVIKQ----VVLCNDKYDGTFRSWKLAAKDIWRTRGYRGFFKGFV 316

Query: 297 ANLFKVIPSTAVSWLVYEVV 316
            +  +  P+ A +   +E V
Sbjct: 317 PSFLRSFPANAAALAAFEFV 336

>AFR253W [3445] [Homologous to ScYFR045W - SH]
           complement(892939..892986,893047..894033) [1035 bp, 344
           aa]
          Length = 344

 Score = 56.2 bits (134), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 39/137 (28%), Positives = 61/137 (44%), Gaps = 7/137 (5%)

Query: 187 GIKGLYRGVWPTSLGVVPYVALNFAVYEQFKEFMPEGTDNTLANFYKLSIGALSGGVAQT 246
           G++G  +G  PT    +    + F  Y    + +       L  +   + GALS      
Sbjct: 207 GVRGFLQGAMPTIFRQLGNSVVRFTTYAWIVQSL--SPHKALDEYQAFAAGALSSAAVVA 264

Query: 247 VTYPFDLLRRRFQVLAMGGNELGFRYKSVMDALITIGKTEGFRGYYKGLTANLFKVIPST 306
           +T P D+++ R Q          F YKS ++    I   EGFR  +KG    LFKV  S 
Sbjct: 265 LTQPIDVIKTRMQ-----SKTAWFTYKSSLNCAYRIFVEEGFRYMWKGWVPRLFKVSLSG 319

Query: 307 AVSWLVYEVVCDLMHVW 323
            +S+ VY+ V +L+ +W
Sbjct: 320 GISFGVYQYVENLVLLW 336

 Score = 45.1 bits (105), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 46/182 (25%), Positives = 73/182 (40%), Gaps = 28/182 (15%)

Query: 35  VSRTVVSPFERVKILLQVQNSTTAYNQGIVGAVRQVYREEGTPGLFRGNGLNCIRIFPYS 94
            +R V +  ER  +  + Q S+        G V ++YR  G  G  +G      R    S
Sbjct: 172 AARPVQTAHERWLLHYERQPSSH-----FAGTVLEIYRTRGVRGFLQGAMPTIFRQLGNS 226

Query: 95  AVQFVVYEACKKHFFHVDGSKGREQLQNWQRLFSGALCGGCSVLATYPLDLVRTRLSIQT 154
            V+F  Y       + V      + L  +Q   +GAL     V  T P+D+++TR+  +T
Sbjct: 227 VVRFTTYA------WIVQSLSPHKALDEYQAFAAGALSSAAVVALTQPIDVIKTRMQSKT 280

Query: 155 ANLTKLSKSRAHNISKPPGVWDLLC--RTYKEEGGIKGLYRGVWPTSLGVVPYVALNFAV 212
           A  T  S               L C  R + EE G + +++G  P    V     ++F V
Sbjct: 281 AWFTYKS--------------SLNCAYRIFVEE-GFRYMWKGWVPRLFKVSLSGGISFGV 325

Query: 213 YE 214
           Y+
Sbjct: 326 YQ 327

>Kwal_23.2913
          Length = 320

 Score = 55.8 bits (133), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 66/297 (22%), Positives = 115/297 (38%), Gaps = 49/297 (16%)

Query: 42  PFERVKILLQVQNSTTAYNQGIVGAVRQVYREEGTP----------GLFRGNGLNCIRIF 91
           PF+ +K+  Q   ++     G + A+ +V  E  +           G +RG     + + 
Sbjct: 48  PFDLLKVRCQSNQAS-----GTLDAISRVLHEAKSKSGPLPLNQIKGFYRGVIPPLLGVT 102

Query: 92  PYSAVQFVVYEACKK-------HFFHVDGSKGR-EQLQNWQRLFSGALCGGCSVLATYPL 143
           P  AV F  Y+  K+           + GS  +   L   Q   +G      + L T P 
Sbjct: 103 PIFAVSFWGYDVGKRLVTWGSNPVTDIAGSSSKLTPLTTSQLALAGFFSAIPTTLITAPT 162

Query: 144 DLVRTRLSIQTANLTKLSKSRAHNISKPPGVWDLLCRTYKEEGGIKGLYRGVWPTSLGVV 203
           +  R ++ +QT+                 G +    RT   EGG++ L++G   T     
Sbjct: 163 E--RVKVVLQTSE---------------SGSFLGAARTLIREGGVRSLFQGTLATLARDG 205

Query: 204 PYVALNFAVYEQFKEFMPEGTDNTLANFYKLSIGALSGGVAQTV-TYPFDLLRRRFQVLA 262
           P  AL FA YE  K F+    D    +   + +     G++  +  +P D ++ + Q  +
Sbjct: 206 PGSALYFASYEVSKRFLSRNQDTDALSVVSICVAGGVAGMSMWIGVFPIDTIKTKLQSSS 265

Query: 263 MGGNELGFRYKSVMDALITIGKTEGFRGYYKGLTANLFKVIPSTAVSWLVYEVVCDL 319
                   R +S++ A   I    G RG++ GL   L +  P+ A ++L  E    L
Sbjct: 266 --------RSQSMVQAAREIYTRAGLRGFFPGLGPALMRSFPANAATFLGVEFTHQL 314

 Score = 53.5 bits (127), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 54/208 (25%), Positives = 88/208 (42%), Gaps = 30/208 (14%)

Query: 121 QNWQRLFSGALCGGCSVLATYPLDLVRTRLSIQTANLTKLSKSRA-HNISKPPGVWDLLC 179
            +++ L +G + G C+VL  +P DL++ R     A+ T  + SR  H      G   L  
Sbjct: 27  DSFESLAAGGVGGVCAVLTGHPFDLLKVRCQSNQASGTLDAISRVLHEAKSKSGPLPL-- 84

Query: 180 RTYKEEGGIKGLYRGVWPTSLGVVPYVALNFAVYEQFKEFMPEGTDN-----------TL 228
                   IKG YRGV P  LGV P  A++F  Y+  K  +  G++            T 
Sbjct: 85  ------NQIKGFYRGVIPPLLGVTPIFAVSFWGYDVGKRLVTWGSNPVTDIAGSSSKLTP 138

Query: 229 ANFYKLSIGALSGGVAQT-VTYPFDLLRRRFQVLAMGGNELGFRYKSVMDALITIGKTEG 287
               +L++      +  T +T P + ++   Q    G         S + A  T+ +  G
Sbjct: 139 LTTSQLALAGFFSAIPTTLITAPTERVKVVLQTSESG---------SFLGAARTLIREGG 189

Query: 288 FRGYYKGLTANLFKVIPSTAVSWLVYEV 315
            R  ++G  A L +  P +A+ +  YEV
Sbjct: 190 VRSLFQGTLATLARDGPGSALYFASYEV 217

>Kwal_55.21106
          Length = 328

 Score = 55.8 bits (133), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 66/301 (21%), Positives = 115/301 (38%), Gaps = 53/301 (17%)

Query: 35  VSRTVVSPFERVKILLQVQNS--TTAYNQGI-----------------VGAVRQVYREEG 75
           ++  VV P + VK L+Q QN         G+                 + A+ ++++ +G
Sbjct: 16  LANVVVYPLDLVKTLIQTQNKEPNIGSEAGVKPQAKKSRVQEIRYKHSLDALIKIFKTKG 75

Query: 76  TPGLFRGNGLNCIRIFPYSAVQFVVYEACKKHFFHVDGSKGR-EQLQNWQRLFSGALCGG 134
             GL++G   + I  F  S   F  Y   +K FF     +GR  +    + L  G +   
Sbjct: 76  VLGLYQGLWTSIIAGFLQSFSYFFWYSIVRKSFFRYKLLRGRLGKFSTPEELLLGIVAAA 135

Query: 135 CSVLATYPLDLVRTRLSIQTANLTKLSKSRAHNISKPPGVWDLLCRTYKEEGGIKGLYRG 194
            S + T P+ ++ TR    T+                 G  ++L + Y E+  I G +RG
Sbjct: 136 VSQIFTSPIGVISTRQQTSTSG-------------SKGGFREVLHQIYSEQNNITGFWRG 182

Query: 195 VWPTSLGVVPYVALNFAVYEQFKEFMPEG------------TDNTLANFYKLSIGALSGG 242
            +  SL +    ++ FA YE+ ++                 T   L+      +G  S  
Sbjct: 183 -FKVSLILTVNPSITFASYEKLQDIFITSKRAVDENGQLLETSGQLSPRQNFLLGVFSKV 241

Query: 243 VAQTVTYPFDLLRRRFQVLAMGGNELGFRYKSVMDALITIGKTEGFRGYYKGLTANLFKV 302
           ++  +T P  + +   Q         G  ++S    L+ + K EG    +KGL   L K 
Sbjct: 242 ISTLITQPLIVSKAYLQ-------RTGSNFQSFQQVLLYLYKQEGLISLWKGLAPQLSKG 294

Query: 303 I 303
           I
Sbjct: 295 I 295

 Score = 43.9 bits (102), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 50/208 (24%), Positives = 97/208 (46%), Gaps = 26/208 (12%)

Query: 128 SGALCGGCSVLATYPLDLVRTRLSIQTANLT-----------KLSKSRAHNISKPPGVWD 176
           +GA+    + +  YPLDLV+T   IQT N             +  KSR   I     + D
Sbjct: 9   TGAVASSLANVVVYPLDLVKTL--IQTQNKEPNIGSEAGVKPQAKKSRVQEIRYKHSL-D 65

Query: 177 LLCRTYKEEGGIKGLYRGVWPTSL-GVVPYVALNF---AVYEQFKEF-MPEGTDNTLANF 231
            L + +K + G+ GLY+G+W + + G +   +  F    V + F  + +  G     +  
Sbjct: 66  ALIKIFKTK-GVLGLYQGLWTSIIAGFLQSFSYFFWYSIVRKSFFRYKLLRGRLGKFSTP 124

Query: 232 YKLSIGALSGGVAQTVTYPFDLLRRRFQVLAMGGNELGFRYKSVMDALITIGKTEGFRGY 291
            +L +G ++  V+Q  T P  ++  R Q  +  G++ GFR   V+  + +  +     G+
Sbjct: 125 EELLLGIVAAAVSQIFTSPIGVISTRQQT-STSGSKGGFR--EVLHQIYS--EQNNITGF 179

Query: 292 YKGLTANLFKVIPSTAVSWLVYEVVCDL 319
           ++G   +L   + + ++++  YE + D+
Sbjct: 180 WRGFKVSLILTV-NPSITFASYEKLQDI 206

>KLLA0E02750g 260854..261768 similar to ca|CA6127|IPF149 Candida
           albicans peroxisomal membrane protein (by homology),
           start by similarity
          Length = 304

 Score = 55.8 bits (133), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 53/242 (21%), Positives = 103/242 (42%), Gaps = 25/242 (10%)

Query: 67  VRQVYREEGTPGLFRGNGLNCIRIFPYSAVQFVVYEACKKHFFHVDGSKGREQLQNWQRL 126
           ++++Y + G  G F G       +   + V +  YE C K    +     ++ L  W+ +
Sbjct: 53  IKEIYNKNGIIGYFLGLESAVYGMATTNFVYYYFYEWCAKTARTLTT---KQYLSTWESI 109

Query: 127 FSGALCGGCSVLATYPLDLVRTRLSIQTANLTKLSKSRAHNISKPPGVWDLLCRTYKEEG 186
            +  + G  + +A+ P+ +  TR+++  +N + L             V D++    K +G
Sbjct: 110 LASTIAGSMTAVASNPIWVANTRMTVAKSNHSTLRT-----------VIDIV----KTDG 154

Query: 187 GIKGLYRGVWPTSLGVVPYVALNFAVYEQFKEFMPE-GTDNTLANFYKLSIGALSGGVAQ 245
            +  L  G+ P +L +V    + + VYEQ K  +        L+  +   +GA+    A 
Sbjct: 155 PLT-LLNGLKP-ALVLVSNPIIQYTVYEQLKNLVLRLQRKKVLSPSWAFLLGAIGKLAAT 212

Query: 246 TVTYPFDLLRRRFQVLAMGGNELGFRYKSVMDALITIGKTEGFRGYYKGLTANLFKVIPS 305
             TYP+  L+ R  ++           KS+   ++ I K +G  G Y G+   L + I +
Sbjct: 213 GTTYPYITLKTRMHLMQNDPK----HQKSMWSLIVEIVKKDGVSGLYNGVAVKLVQSIMT 268

Query: 306 TA 307
            A
Sbjct: 269 AA 270

>ABL023W [569] [Homologous to ScYKL120W (OAC1) - SH]
           complement(355977..356906) [930 bp, 309 aa]
          Length = 309

 Score = 55.1 bits (131), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 77/290 (26%), Positives = 114/290 (39%), Gaps = 38/290 (13%)

Query: 38  TVVSPFERVKILLQVQNSTTA----YNQGIVGAVRQVYREEGTPGLFRGNGLNCIRIFPY 93
           T  +P E VK  LQ+Q    A       G   AV  +YR EG  GL    GL C      
Sbjct: 27  TFTNPIETVKTRLQLQGELVAGVSRLYSGPAQAVSLIYRTEGLRGL--QQGLACA----- 79

Query: 94  SAVQFVVYEACKKHFFHVDGSKGREQLQNWQRLFSGALCGGCSVLATY---------PLD 144
            A Q ++  +    +  +  + G   L + +   + AL    +  A           PL 
Sbjct: 80  YAYQILLNGSRLGLYDPLRAALGGCVLSDRRTYGTAALAVNATAGAAAGMIGAALGSPLQ 139

Query: 145 LVRTRLSIQTANLTKLSKSRAHNISKPPGVWDLLCRTYKEEGGIKGLYRGVWPTSLGVVP 204
           LV+TR+         L+  R   +  P  +   L   +K+ G ++GLY+GV    L    
Sbjct: 140 LVKTRMQ-------ALAPRRVPPL--PGRMGRRLVALFKDRG-VRGLYQGVDAALLRTGV 189

Query: 205 YVALNFAVYEQFKEFMPEGTDNTLANFYKLSIGALSGGVAQTVTYPFDLLRRRFQVLAMG 264
             A+  AVY   KE +     + +A  Y L+  ALS         PFD+   R       
Sbjct: 190 GSAVQLAVYSHAKEALSRHVPDGMA-LYTLA-SALSSVAVCIAMNPFDVAMTRMY----- 242

Query: 265 GNELGFRYKSVMDALITIGKTEGFRGYYKGLTANLFKVIPSTAVSWLVYE 314
            +  G  Y+  +D L    + EGF   YKG  A L ++ P T +   + E
Sbjct: 243 -HHRGGLYRGPLDCLCKTVRQEGFSALYKGHLAQLLRIAPHTILCLTLME 291

 Score = 43.9 bits (102), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 40/147 (27%), Positives = 61/147 (41%), Gaps = 22/147 (14%)

Query: 70  VYREEGTPGLFRGNGLNCIRIFPYSAVQFVVYEACKKHFF-HVDGSKGREQLQNWQRLFS 128
           ++++ G  GL++G     +R    SAVQ  VY   K+    HV        L +   L S
Sbjct: 167 LFKDRGVRGLYQGVDAALLRTGVGSAVQLAVYSHAKEALSRHVPDGMALYTLASA--LSS 224

Query: 129 GALCGGCSVLATYPLDLVRTRLSIQTANLTKLSKSRAHNISKPPGVWDLLCRTYKEEGGI 188
            A+C     +A  P D+  TR+      L +             G  D LC+T ++E G 
Sbjct: 225 VAVC-----IAMNPFDVAMTRMYHHRGGLYR-------------GPLDCLCKTVRQE-GF 265

Query: 189 KGLYRGVWPTSLGVVPYVALNFAVYEQ 215
             LY+G     L + P+  L   + EQ
Sbjct: 266 SALYKGHLAQLLRIAPHTILCLTLMEQ 292

>KLLA0D04950g 424550..425374 similar to sp|P38921 Saccharomyces
           cerevisiae YNL003c PET8 member of the mitochondrial
           carrier (MCF) family, start by similarity
          Length = 274

 Score = 54.7 bits (130), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 49/201 (24%), Positives = 83/201 (41%), Gaps = 47/201 (23%)

Query: 126 LFSGALCGGCSVLATYPLDLVRTRLSIQTANLTKLSKSRAHNISKPPGVWDLLCRTYKEE 185
           L SGA  G  + LA +P+D ++TRL  +                            +   
Sbjct: 10  LVSGAAAGTSTDLAFFPIDTLKTRLQAKGG--------------------------FFAN 43

Query: 186 GGIKGLYRGVWPTSLGVVPYVALNFAVYEQFK--------EFMPEGTD---NTLANFYKL 234
           GG KG+YRG+    +   P  +L F  Y+  K        + +P+G D   +TL++    
Sbjct: 44  GGYKGVYRGLGSAVVASAPSASLFFVAYDSMKCWSRPVIGQLLPKGEDQTADTLSHMVSS 103

Query: 235 SIGALSGGVAQTVTYPFDLLRRRFQVLAMGGNELGFRYKSVMDALITIGKTEGF-RGYYK 293
           S G +S   A  V  P +++++R Q      +         + AL+     EG  R  Y+
Sbjct: 104 SFGEIS---ACMVRVPAEVIKQRTQTHRTNSS------LQTLQALLRNENGEGLRRNLYR 154

Query: 294 GLTANLFKVIPSTAVSWLVYE 314
           G +  + + IP T + + +YE
Sbjct: 155 GWSTTIMREIPFTCIQFPLYE 175

 Score = 53.9 bits (128), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 46/174 (26%), Positives = 80/174 (45%), Gaps = 23/174 (13%)

Query: 45  RVKILLQVQNSTTAYNQGIVGAVRQVYREEGTPGL----FRGNGLNCIRIFPYSAVQFVV 100
           RV   +  Q + T      +  ++ + R E   GL    +RG     +R  P++ +QF +
Sbjct: 114 RVPAEVIKQRTQTHRTNSSLQTLQALLRNENGEGLRRNLYRGWSTTIMREIPFTCIQFPL 173

Query: 101 YEACKKHFFHVDGSKGREQLQNWQRLFSGALCGGCSVLATYPLDLVRTRLSIQTANLTKL 160
           YE  KK +  V   +G+E+   WQ    G + GG +  AT PLD+++TR+ +   +++ L
Sbjct: 174 YEYMKKRWAEV---QGKERAAPWQGSVCGCIAGGIAAAATTPLDVLKTRIMLHHKSVSAL 230

Query: 161 SKSRAHNISKPPGVWDLLCRTYKEEGGIKGLYRGVWPTSLGVVPYVALNFAVYE 214
                            L +T  +E G+K  + GV P ++ +    A+   VYE
Sbjct: 231 H----------------LAKTMLQEEGVKVFFSGVGPRTMWISAGGAIFLGVYE 268

 Score = 44.7 bits (104), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 57/250 (22%), Positives = 103/250 (41%), Gaps = 26/250 (10%)

Query: 75  GTPGLFRGNGLNCIRIFPYSAVQFVVYEACKKHFFHVDGS---KGREQLQN-WQRLFSGA 130
           G  G++RG G   +   P +++ FV Y++ K     V G    KG +Q  +    + S +
Sbjct: 45  GYKGVYRGLGSAVVASAPSASLFFVAYDSMKCWSRPVIGQLLPKGEDQTADTLSHMVSSS 104

Query: 131 LCGGCSVLATYPLDLVRTRLSIQTANLTKLSKSRAHNISKPPGVWDLLCRTYKEEGGIKG 190
                + +   P ++++ R             ++ H  +        L R    EG  + 
Sbjct: 105 FGEISACMVRVPAEVIKQR-------------TQTHRTNSSLQTLQALLRNENGEGLRRN 151

Query: 191 LYRGVWPTSLGVVPYVALNFAVYEQFKEFMPEGTDNTLANFYKLSI-GALSGGVAQTVTY 249
           LYRG   T +  +P+  + F +YE  K+   E      A  ++ S+ G ++GG+A   T 
Sbjct: 152 LYRGWSTTIMREIPFTCIQFPLYEYMKKRWAEVQGKERAAPWQGSVCGCIAGGIAAAATT 211

Query: 250 PFDLLRRRFQVLAMGGNELGFRYKSVMDALITIGKTEGFRGYYKGLTANLFKVIPSTAVS 309
           P D+L+ R          L  +  S +    T+ + EG + ++ G+      +    A+ 
Sbjct: 212 PLDVLKTRIM--------LHHKSVSALHLAKTMLQEEGVKVFFSGVGPRTMWISAGGAIF 263

Query: 310 WLVYEVVCDL 319
             VYE V  L
Sbjct: 264 LGVYETVHSL 273

>Sklu_2127.5 YOR130C, Contig c2127 7354-8190 reverse complement
          Length = 278

 Score = 54.7 bits (130), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 66/292 (22%), Positives = 120/292 (41%), Gaps = 39/292 (13%)

Query: 35  VSRTVVSPFERVKILLQVQNS---TTAYNQGIVGAVRQVYREEGT-PGLFRGNGLNCIRI 90
           V + +  PF+ VK+ LQ Q +    T ++      ++  Y  EG   G ++G G      
Sbjct: 19  VGKVIEYPFDTVKVRLQTQPAHMFPTTWS-----CIKFTYDNEGLWRGFYQGIGSPLAGA 73

Query: 91  FPYSAVQFVVYEACKKHFFHVDGSKGREQLQNWQRLFSGALCGGCSVLATYPLDLVRTRL 150
              +AV FV +   K+    +D       L   + +++GA  G C+     P++L++ +L
Sbjct: 74  ALENAVLFVSFNQAKRL---LDVESLLSPLS--KTVWAGAFAGACASFVLTPVELIKCKL 128

Query: 151 SIQTANLTKLSKSRAHNISKPPGVWDLLCRTYKEEGGIKGLYRGVWPTSLGVVPYVALNF 210
            +   + TK S ++       P +  +L      E G  GL++G   T +      A  F
Sbjct: 129 QVSNLSTTKTSHTKIL-----PTIKSVL-----SERGFLGLWQGQSGTFIRESGGGAAWF 178

Query: 211 AVYEQFKEFMP---EGTDNTLANFYKLSIGALSGGVAQTVTYPFDLLRRRFQVLAMGGNE 267
             YE  K ++    +   NT   +  L+ GA +G       +P D ++   Q        
Sbjct: 179 TTYEVVKNYLASRRQAEQNT--TWELLASGASAGLAFNASIFPADTIKSTMQT------- 229

Query: 268 LGFRYKSVMDALITIGKTEGFRGYYKGLTANLFKVIPSTAVSWLVYEVVCDL 319
               +  +  A   I   +G  G+Y+GL   L + +P+ A  +  YE +  +
Sbjct: 230 ---DHIDLSSATRKIYARQGIAGFYRGLGITLIRAVPANAAIFYTYETLSSV 278

 Score = 30.4 bits (67), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 20/87 (22%), Positives = 40/87 (45%), Gaps = 7/87 (8%)

Query: 237 GALSGGVAQTVTYPFDLLRRRFQVLAMGGNELGFRYKSVMDALITIGKTEG-FRGYYKGL 295
           G+++G V + + YPFD ++ R Q       +    + +    +      EG +RG+Y+G+
Sbjct: 13  GSIAGAVGKVIEYPFDTVKVRLQ------TQPAHMFPTTWSCIKFTYDNEGLWRGFYQGI 66

Query: 296 TANLFKVIPSTAVSWLVYEVVCDLMHV 322
            + L       AV ++ +     L+ V
Sbjct: 67  GSPLAGAALENAVLFVSFNQAKRLLDV 93

>ADR036C [1777] [Homologous to ScYPR128C (ANT1) - SH]
           (771097..772119) [1023 bp, 340 aa]
          Length = 340

 Score = 54.3 bits (129), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 58/253 (22%), Positives = 106/253 (41%), Gaps = 35/253 (13%)

Query: 61  QGIVGAVRQVYREEGTPGLFRGNGLNCIRIFPYSAVQFVVYEACKKHFFHVDGSKGRE-Q 119
           +G + A++++Y  EG  GL+RG G + +  F  S   F  Y   +KH+F +  ++G + +
Sbjct: 73  KGALDALQRIYGAEGVAGLYRGLGSSTVAGFIQSFSYFFWYTLVRKHYFRLKQARGGDAR 132

Query: 120 LQNWQRLFSGALCGGCSVLATYPLDLVRTRLSIQTANLTKLSKSRAHNISKPPGVWDL-- 177
               + L  G +    S L   P+++V TR   +                +  G  D+  
Sbjct: 133 FSTPEELVLGIVAAATSQLFVNPINVVATRQQTR---------------GQAAGAADMRT 177

Query: 178 LCRTYKEEGGIKGLYRGVWPTSLGVVPYVALNFAVYEQFKEFM---PEGTDNTLANFYKL 234
           + R    E G +G + G+   SL +    ++ +A YE+ +E +   P    + + +   L
Sbjct: 178 VAREVHAENGWRGFWAGL-KVSLVLTVNPSITYATYERLREALFPTPAAASHLVDSAALL 236

Query: 235 S------IGALSGGVAQTVTYPFDLLRRRFQVLAMGGNELGFRYKSVMDALITIGKTEGF 288
           S      +G LS  V+  +T P  + +   Q         G  ++     L  +  TEG 
Sbjct: 237 SPGQNFVMGVLSKIVSTVLTQPLIIAKASLQ-------RSGSCFQDFHQVLHHLYSTEGP 289

Query: 289 RGYYKGLTANLFK 301
              +KGL   + K
Sbjct: 290 LSLWKGLGPQITK 302

 Score = 41.6 bits (96), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 50/213 (23%), Positives = 83/213 (38%), Gaps = 35/213 (16%)

Query: 129 GALCGGCSVLATYPLDLVRTRLSIQTAN---------LTKLSKSRAHNISKP-------- 171
           GA     + +A YPLDL +T +  Q  +           + + SR  N  KP        
Sbjct: 9   GATASSLANIAVYPLDLAKTLVQTQLKDEFVEAGEEAGEERAGSRRQNRIKPIALRSPQA 68

Query: 172 ----PGVWDLLCRTYKEEGGIKGLYRGVWPTSL-GVVPYVALNF----AVYEQFKEFMPE 222
                G  D L R Y  E G+ GLYRG+  +++ G +   +  F         F+     
Sbjct: 69  AEQYKGALDALQRIYGAE-GVAGLYRGLGSSTVAGFIQSFSYFFWYTLVRKHYFRLKQAR 127

Query: 223 GTDNTLANFYKLSIGALSGGVAQTVTYPFDLLRRRFQVLAMGGNELGFRYKSVMDALITI 282
           G D   +   +L +G ++   +Q    P +++  R Q           R  +       +
Sbjct: 128 GGDARFSTPEELVLGIVAAATSQLFVNPINVVATRQQTRGQAAGAADMRTVAR-----EV 182

Query: 283 GKTEGFRGYYKGLTANL-FKVIPSTAVSWLVYE 314
               G+RG++ GL  +L   V PS  +++  YE
Sbjct: 183 HAENGWRGFWAGLKVSLVLTVNPS--ITYATYE 213

>AER450C [2950] [Homologous to ScYJR077C (MIR1) - SH]
           (1500683..1501609) [927 bp, 308 aa]
          Length = 308

 Score = 53.9 bits (128), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 70/288 (24%), Positives = 110/288 (38%), Gaps = 35/288 (12%)

Query: 35  VSRTVVSPFERVKILLQVQNSTTAYNQGIVGAVRQVYREEGTPGLFRGNGLNCIRIFPYS 94
            + + + P + VK  +Q++     Y+ G+VG+ R++  EEG   L  G G   +      
Sbjct: 28  ATHSAMVPIDVVKTRIQLE--PLKYSSGMVGSFRKIVGEEGAAALLTGFGPTLLGYSMQG 85

Query: 95  AVQFVVYEACKKHFFHVDGSKGREQLQNWQRLFSGALCGGCSVLATYPLDLVRTRLSIQT 154
           A +F  YE  KK F    G +   Q +    + S A+    + +A  PL+  R RL    
Sbjct: 86  AFKFGGYEVFKKAFVDALGYETACQYRTPIYIGSAAIAEFFADIALCPLEATRIRL---- 141

Query: 155 ANLTKLSKSRAHNISKPP---GVWDLLCRTYKEEGGIKGLYRGVWPTSLGVVPYVALNFA 211
                        +S+P    G+     R  KEE GI   Y G  P     +PY    F 
Sbjct: 142 -------------VSQPTFANGLVGGFARILKEE-GIGSFYNGFTPILFKQIPYNIAKFV 187

Query: 212 VYEQFKE--FMPEGTDNTLANFYKLSIG----ALSGGVAQTVTYPFDLLRRRFQVLAMGG 265
           V+E      F   G+   L+      I       +G  A  ++ P D L  +        
Sbjct: 188 VFEHAANAYFGLAGSKENLSTTAATGINLLAGLTAGLAAAVISQPADTLLSKVNKTKKAP 247

Query: 266 NELGFRYKSVMDALITIGKTEGFRGYYKGLTANLFKVIPSTAVSWLVY 313
            +      S    L+ + K  GF G + GL   L  V   T++ + +Y
Sbjct: 248 GQ------STFGLLMQLAKQLGFVGSFAGLPTRLVMVGTLTSLQFGIY 289

 Score = 44.7 bits (104), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 52/200 (26%), Positives = 76/200 (38%), Gaps = 26/200 (13%)

Query: 120 LQNWQRL-FSGALCGGCSVLATYPLDLVRTRLSIQTANLTKLSKSRAHNISKPPGVWDLL 178
           L ++ +   +GA+  G +  A  P+D+V+TR+ ++     K S     +  K  G     
Sbjct: 12  LSDYAKFALAGAIGCGATHSAMVPIDVVKTRIQLEP---LKYSSGMVGSFRKIVG----- 63

Query: 179 CRTYKEEGGIKGLYRGVWPTSLGVVPYVALNFAVYEQFKEFMPEGTDNTLANFYKLSI-- 236
                 E G   L  G  PT LG     A  F  YE FK+   +      A  Y+  I  
Sbjct: 64  ------EEGAAALLTGFGPTLLGYSMQGAFKFGGYEVFKKAFVDALGYETACQYRTPIYI 117

Query: 237 --GALSGGVAQTVTYPFDLLRRRFQVLAMGGNELGFRYKSVMDALITIGKTEGFRGYYKG 294
              A++   A     P +  R R        N L       +     I K EG   +Y G
Sbjct: 118 GSAAIAEFFADIALCPLEATRIRLVSQPTFANGL-------VGGFARILKEEGIGSFYNG 170

Query: 295 LTANLFKVIPSTAVSWLVYE 314
            T  LFK IP     ++V+E
Sbjct: 171 FTPILFKQIPYNIAKFVVFE 190

>Scas_714.18
          Length = 305

 Score = 53.1 bits (126), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 34/137 (24%), Positives = 59/137 (43%), Gaps = 14/137 (10%)

Query: 124 QRLFSGALCGGCSVLATYPLDLVRTRLSIQTANLTKLSKSRAHNISKPPGVWDLLCRTYK 183
           + + +G++ G       YP D V+ RL  Q A +              P  W  +  TY+
Sbjct: 14  REILAGSIAGAIGKFIEYPFDTVKVRLQTQEAYMF-------------PSTWSCIKYTYE 60

Query: 184 EEGGIKGLYRGVWPTSLGVVPYVALNFAVYEQFKEFMPEGTDNTLANFYKLSIGALSGGV 243
            EG ++G Y+G+    +G     A+ F  Y Q   F+   T+ +      +S G  +G  
Sbjct: 61  NEGILEGFYQGIESPLIGAALENAILFLAYNQCSSFLNAFTEFSAFLIILISAG-FAGSC 119

Query: 244 AQTVTYPFDLLRRRFQV 260
           A  V  P +L++ + Q+
Sbjct: 120 ASFVLTPVELIKCKLQI 136

 Score = 52.0 bits (123), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 65/303 (21%), Positives = 120/303 (39%), Gaps = 39/303 (12%)

Query: 35  VSRTVVSPFERVKILLQVQNSTTAYN-QGIVGAVRQVYREEGT-PGLFRGNGLNCIRIFP 92
           + + +  PF+ VK+ LQ Q    AY        ++  Y  EG   G ++G     I    
Sbjct: 25  IGKFIEYPFDTVKVRLQTQE---AYMFPSTWSCIKYTYENEGILEGFYQGIESPLIGAAL 81

Query: 93  YSAVQFVVYEACKKHFFHVDGSKGREQLQNWQRLFSGALCGGCSVLATYPLDLVRTRLSI 152
            +A+ F+ Y  C         +   E       L S    G C+     P++L++ +L I
Sbjct: 82  ENAILFLAYNQCSSFL-----NAFTEFSAFLIILISAGFAGSCASFVLTPVELIKCKLQI 136

Query: 153 QTANLT--------KLSKSRAHNISKPPGVWDLLCRTYK---EEGGIKGLYRGVWPT--- 198
              + +        +  +     +    G    +  T K   +E G+ GL++G   T   
Sbjct: 137 SNLHYSLHDNDGEQQDEEDEDQGMVIGEGRHTRIIPTIKSIIKEKGLFGLWQGQSSTFIR 196

Query: 199 -SLGVVPYVALNFAVYEQFKEFMPEGTDNTLANFYKLSIGALSGGVAQTVTYPFDLLRRR 257
            S+G V +    FA YE  K+ + +        +  L  GA +G       +P D ++  
Sbjct: 197 ESIGSVVW----FATYELMKQTLRDPKSEVNTTWQLLISGATAGLAFNGSVFPADTVKSI 252

Query: 258 FQVLAMGGNELGFRYKSVMDALITIGKTEGFRGYYKGLTANLFKVIPSTAVSWLVYEVVC 317
            Q            + ++M+ + +I + +G  G+Y+GL   L + +PS A  +  YE + 
Sbjct: 253 MQT----------EHLALMETVRSILERDGVAGFYRGLGITLLRAVPSNAAVFYTYEKLS 302

Query: 318 DLM 320
            ++
Sbjct: 303 KIL 305

>KLLA0B14454g complement(1268709..1269626) highly similar to
           sp|P23641 Saccharomyces cerevisiae YJR077c MIR1
           phosphate transport protein, mitochondrial (MCF), start
           by similarity
          Length = 305

 Score = 52.8 bits (125), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 71/292 (24%), Positives = 112/292 (38%), Gaps = 43/292 (14%)

Query: 35  VSRTVVSPFERVKILLQVQNSTTAYNQGIVGAVRQVYREEGTPGLFRGNGLNCIRIFPYS 94
           ++ + + P + VK  +Q++   T YN+G+V + +Q+   EG   L  G G   +      
Sbjct: 26  ITHSSMVPIDVVKTRIQLE--PTVYNKGMVSSFKQIISSEGAGALLTGFGPTLLGYSLQG 83

Query: 95  AVQFVVYEACKKHFFHVDGSKGREQLQNWQRLFSGALCGGCSVLATYPLDLVRTRLSIQT 154
           + +F  YE  KK      G       +N   + S A+    + +A  PL+  R RL    
Sbjct: 84  SFKFGGYELFKKLAIDNMGYDNAVNYKNTIYIGSAAIAEFFADIALCPLEATRIRL---- 139

Query: 155 ANLTKLSKSRAHNISKPP---GVWDLLCRTYKEEGGIKGLYRGVWPTSLGVVPYVALNFA 211
                        +S+P    G++    R  KEE G+   Y G  P     +PY    F 
Sbjct: 140 -------------VSQPTFANGLFGGFSRILKEE-GVGSFYNGFTPILFKQIPYNIAKFF 185

Query: 212 VYEQF----------KEFMPEGTDNTLANFYKLSIGALSGGVAQTVTYPFDLLRRRFQVL 261
           V+E            KE M E T +T  N        L+  V   V+ P D L  +    
Sbjct: 186 VFEHAANAYFGLAGPKETMSE-TTHTAINLAAGLTAGLAAAV---VSQPADTLLSKVNKT 241

Query: 262 AMGGNELGFRYKSVMDALITIGKTEGFRGYYKGLTANLFKVIPSTAVSWLVY 313
                +      S +  L  + K  GF G + GL   L  V   T++ + +Y
Sbjct: 242 KKAPGQ------STIGLLAQLAKQLGFVGSFTGLPTRLVMVGTLTSLQFGIY 287

 Score = 43.1 bits (100), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 49/191 (25%), Positives = 73/191 (38%), Gaps = 25/191 (13%)

Query: 128 SGALCGGCSVLATYPLDLVRTRLSIQTANLTKLSKSRAHNISKPPGVWDLLCRTYKEEGG 187
           +GA+  G +  +  P+D+V+TR+ ++     K   S    I    G   LL         
Sbjct: 19  AGAIGCGITHSSMVPIDVVKTRIQLEPTVYNKGMVSSFKQIISSEGAGALLT-------- 70

Query: 188 IKGLYRGVWPTSLGVVPYVALNFAVYEQFKEFMPE--GTDNTLANFYKLSIG--ALSGGV 243
                 G  PT LG     +  F  YE FK+   +  G DN +     + IG  A++   
Sbjct: 71  ------GFGPTLLGYSLQGSFKFGGYELFKKLAIDNMGYDNAVNYKNTIYIGSAAIAEFF 124

Query: 244 AQTVTYPFDLLRRRFQVLAMGGNELGFRYKSVMDALITIGKTEGFRGYYKGLTANLFKVI 303
           A     P +  R R        N L   +  ++       K EG   +Y G T  LFK I
Sbjct: 125 ADIALCPLEATRIRLVSQPTFANGLFGGFSRIL-------KEEGVGSFYNGFTPILFKQI 177

Query: 304 PSTAVSWLVYE 314
           P     + V+E
Sbjct: 178 PYNIAKFFVFE 188

>YPR128C (ANT1) [5547] chr16 complement(791212..792198)
           Peroxisome-localized protein involved in adenine
           nucleotide transport, medium-chain fatty acid
           metabolism, and peroxisome proliferation, has similarity
           to ADP/ATP carrier proteins [987 bp, 328 aa]
          Length = 328

 Score = 52.4 bits (124), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 63/294 (21%), Positives = 123/294 (41%), Gaps = 50/294 (17%)

Query: 35  VSRTVVSPFERVKILLQVQ---NSTTAYNQG----------IVGAVRQVYREEGTPGLFR 81
           ++   V P +  K ++Q Q   +S+   N+G          +V  +  +++E+G  GL++
Sbjct: 16  MANIAVYPLDLSKTIIQSQVSPSSSEDSNEGKVLPNRRYKNVVDCMINIFKEKGILGLYQ 75

Query: 82  GNGLNCIRIFPYSAVQFVVYEACKKHFFHVDGSKGREQLQN---------WQRLFSGALC 132
           G  +  +  F  + V F  Y   +K +       G + L+N          + L  G   
Sbjct: 76  GMTVTTVATFVQNFVYFFWYTFIRKSYMK-HKLLGLQSLKNRDGPITPSTIEELVLGVAA 134

Query: 133 GGCSVLATYPLDLVRTR-LSIQTANLTKLSKSRAHNISKPPGVWDLLCRTYKEEGG-IKG 190
              S L T P+ +V TR  ++ +A   K +              +++   Y+E  G I  
Sbjct: 135 ASISQLFTSPMAVVATRQQTVHSAESAKFT--------------NVIKDIYRENNGDITA 180

Query: 191 LYRGVWPTSLGVVPYVALNFAVYEQFKE--FMPEGTD-NTLANFYKLSIGALSGGVAQTV 247
            ++G+  T L +    ++ +A +++ KE  F     D  +L+      +G LS  ++  V
Sbjct: 181 FWKGL-RTGLALTINPSITYASFQRLKEVFFHDHSNDAGSLSAVQNFILGVLSKMISTLV 239

Query: 248 TYPFDLLRRRFQVLAMGGNELGFRYKSVMDALITIGKTEGFRGYYKGLTANLFK 301
           T P  + +   Q         G ++ +  +AL+ + K EG +  +KG+   L K
Sbjct: 240 TQPLIVAKAMLQ-------SAGSKFTTFQEALLYLYKNEGLKSLWKGVLPQLTK 286

 Score = 36.2 bits (82), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 23/69 (33%), Positives = 34/69 (49%), Gaps = 9/69 (13%)

Query: 237 GALSGGVAQTVTYPFDLLRRRFQVL-----AMGGNELGF----RYKSVMDALITIGKTEG 287
           GA++  +A    YP DL +   Q       +   NE       RYK+V+D +I I K +G
Sbjct: 10  GAVASAMANIAVYPLDLSKTIIQSQVSPSSSEDSNEGKVLPNRRYKNVVDCMINIFKEKG 69

Query: 288 FRGYYKGLT 296
             G Y+G+T
Sbjct: 70  ILGLYQGMT 78

 Score = 33.9 bits (76), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 25/81 (30%), Positives = 39/81 (48%), Gaps = 11/81 (13%)

Query: 127 FSGALCGGCSVLATYPLDLVRTRLSIQTANLTKLSKSRAHNISKP------PGVWDLLCR 180
            +GA+    + +A YPLDL +T +  Q +     S S   N  K         V D +  
Sbjct: 8   LTGAVASAMANIAVYPLDLSKTIIQSQVSP----SSSEDSNEGKVLPNRRYKNVVDCMIN 63

Query: 181 TYKEEGGIKGLYRGVWPTSLG 201
            +KE+ GI GLY+G+  T++ 
Sbjct: 64  IFKEK-GILGLYQGMTVTTVA 83

>Scas_702.10
          Length = 302

 Score = 51.6 bits (122), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 60/227 (26%), Positives = 93/227 (40%), Gaps = 23/227 (10%)

Query: 70  VYREEGTPGLFRGNGLNCIRIFPYSAVQFVVYEACKKHFFHVDGSKGREQLQNWQRLFSG 129
           + R E   GL+ G     +R   Y+ V+F  Y+  K++            L     +FSG
Sbjct: 54  ILRNENVMGLYSGLSAAVLRQCTYTTVRFGAYDLMKENLIPQGHINDMVYLLPCS-MFSG 112

Query: 130 ALCGGCSVLATYPLDLVRTRLSIQTANLTKLSKSRAHNISKPPGVWDLLCRTYKEEGGIK 189
           A+ G     A    D+V  R+   +A   +L ++  + I    GV+    + Y  EGGIK
Sbjct: 113 AIGGLVGNFA----DVVNIRMQNDSALKPELRRNYRNAID---GVY----KIYMHEGGIK 161

Query: 190 GLYRGVWPTSLGVVPYVALNFAVYEQFKEFMPEGTD-NTLANFYKLSIGALSGGVAQTVT 248
            L  G  P  +  V   A     Y+ FK ++      +   N   LS   L+G VA T+ 
Sbjct: 162 TLLTGWKPNMVRGVLMTASQVVTYDVFKNYLVTKLSFDPKKNSTHLSASLLAGLVATTIC 221

Query: 249 YPFDLLRRRFQVLAMGGNELGFRYKSVMDALITIGKTEG----FRGY 291
            P D+++ R        N      +S +  L +  K EG    FRG+
Sbjct: 222 SPADVIKTRIM------NAHKTESESAIKILTSAIKKEGPSFMFRGW 262

 Score = 48.5 bits (114), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 50/189 (26%), Positives = 78/189 (41%), Gaps = 19/189 (10%)

Query: 129 GALCGGCSVLATYPLDLVRTRLSIQTANLTKLSKSRAHNISKPPGVWDLLCRTYKEEGGI 188
           G   G  + + T+PLDL + RL  Q A L K            P +  +L    + E  +
Sbjct: 16  GGAAGIFACVMTHPLDLAKVRL--QAAPLPK------------PTLGRMLTTILRNE-NV 60

Query: 189 KGLYRGVWPTSLGVVPYVALNFAVYEQFKE-FMPEGTDNTLANFYKLSIGALSGGVAQTV 247
            GLY G+    L    Y  + F  Y+  KE  +P+G  N +   Y L     SG +   V
Sbjct: 61  MGLYSGLSAAVLRQCTYTTVRFGAYDLMKENLIPQGHINDMV--YLLPCSMFSGAIGGLV 118

Query: 248 TYPFDLLRRRFQVLAMGGNELGFRYKSVMDALITIGKTE-GFRGYYKGLTANLFKVIPST 306
               D++  R Q  +    EL   Y++ +D +  I   E G +    G   N+ + +  T
Sbjct: 119 GNFADVVNIRMQNDSALKPELRRNYRNAIDGVYKIYMHEGGIKTLLTGWKPNMVRGVLMT 178

Query: 307 AVSWLVYEV 315
           A   + Y+V
Sbjct: 179 ASQVVTYDV 187

 Score = 34.3 bits (77), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 23/80 (28%), Positives = 36/80 (45%), Gaps = 7/80 (8%)

Query: 237 GALSGGVAQTVTYPFDLLRRRFQVLAMGGNELGFRYKSVMDALITIGKTEGFRGYYKGLT 296
           G  +G  A  +T+P DL + R Q   +    LG         L TI + E   G Y GL+
Sbjct: 16  GGAAGIFACVMTHPLDLAKVRLQAAPLPKPTLG-------RMLTTILRNENVMGLYSGLS 68

Query: 297 ANLFKVIPSTAVSWLVYEVV 316
           A + +    T V +  Y+++
Sbjct: 69  AAVLRQCTYTTVRFGAYDLM 88

>Sklu_2433.8 YFR045W, Contig c2433 11995-13257 reverse complement
          Length = 420

 Score = 50.8 bits (120), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 43/177 (24%), Positives = 72/177 (40%), Gaps = 7/177 (3%)

Query: 146 VRTRLSIQTANLTKLSKSRAHNISKPPGVWDLLCRTYKEEGGIKGLYRGVWPTSLGVVPY 205
           VR     QT  ++   +   H    P   +    +      G++G  +G  PT    +  
Sbjct: 241 VRATFHKQTPGISPRERLFLHYEEHPTSRFFSTVKEIYLTRGLRGFVQGTAPTIFRQMGN 300

Query: 206 VALNFAVYEQFKEFMPEGTDNTLANFYKLSIGALSGGVAQTVTYPFDLLRRRFQVLAMGG 265
            A+ F  Y   K+ +    +  L  +Y   +G +S      VT P D+++ R Q      
Sbjct: 301 SAVRFTTYTSLKQLI--SPNKPLNEYYAFVLGFISSCAVVAVTQPIDVIKTRMQSKYAWA 358

Query: 266 NELGFRYKSVMDALITIGKTEGFRGYYKGLTANLFKVIPSTAVSWLVYEVVCDLMHV 322
           N     YK+ ++    I   EG   ++KG    L KV  S  VS+ VY+ V +L+ +
Sbjct: 359 N-----YKNSLNCAYRIFVEEGIPKFWKGWAPRLMKVGLSGGVSFGVYQYVENLIKL 410

 Score = 33.5 bits (75), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 27/116 (23%), Positives = 47/116 (40%), Gaps = 11/116 (9%)

Query: 40  VSPFERVKILLQVQNSTTAYNQGIVGAVRQVYREEGTPGLFRGNGLNCIRIFPYSAVQFV 99
           +SP ER  + L  +   T+        V+++Y   G  G  +G      R    SAV+F 
Sbjct: 252 ISPRER--LFLHYEEHPTS---RFFSTVKEIYLTRGLRGFVQGTAPTIFRQMGNSAVRFT 306

Query: 100 VYEACKKHFFHVDGSKGREQLQNWQRLFSGALCGGCSVLATYPLDLVRTRLSIQTA 155
            Y + K+           + L  +     G +     V  T P+D+++TR+  + A
Sbjct: 307 TYTSLKQLI------SPNKPLNEYYAFVLGFISSCAVVAVTQPIDVIKTRMQSKYA 356

>Kwal_23.5757
          Length = 307

 Score = 50.1 bits (118), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 62/286 (21%), Positives = 110/286 (38%), Gaps = 30/286 (10%)

Query: 36  SRTVVSPFERVKILLQVQNSTTAYNQGIVGAVRQVYREEGTPGLFRGNGLNCIRIFPYSA 95
           + + V+P + VK   QV  S    N   +   RQ+ R EG   +F G G   I      A
Sbjct: 33  THSAVTPLDLVKCRRQVDASLYKSN---LDGWRQIVRSEGATKVFTGVGATAIGYSLQGA 89

Query: 96  VQFVVYEACKKHFFHVDGSKGREQLQNWQRLFSGALCGGCSVLATYPLDLVRTRLSIQTA 155
            ++  YE  K  +  +   +     +    L + A     + +   P + ++ R   QTA
Sbjct: 90  FKYGGYEFFKHQYSQLVSPETAHSYRTGIFLAASASAEFIADIFLCPWEAIKVRQ--QTA 147

Query: 156 NLTKLSKSRAHNISKPPGVWDLLCRTYKEEGGIKGLYRGVWPTSLGVVPYVALNFAVYEQ 215
                +++          V+D   +    EG    LY+G+ P     +PY    F  +E+
Sbjct: 148 VPPPFARN----------VFDAYSKMVGAEG-FASLYKGITPLWFRQIPYTMCKFTSFER 196

Query: 216 FKEFM------PEGTDNTLANF-YKLSIGALSGGVAQTVTYPFDLLRRRFQVLAMGGNEL 268
             E +      P+   + L       + G L+G +   V++P D++  +       G   
Sbjct: 197 IVEMIYARLPTPKREMSQLGQISVSFAGGYLAGILCAVVSHPADVMVSKVNNERKSG--- 253

Query: 269 GFRYKSVMDALITIGKTEGFRGYYKGLTANLFKVIPSTAVSWLVYE 314
               +S + A   I    GF G + GL   +  +   T+  WL+Y+
Sbjct: 254 ----ESTLQATSRIYGKIGFPGLWNGLAVRILMIGTLTSFQWLIYD 295

 Score = 44.3 bits (103), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 49/198 (24%), Positives = 83/198 (41%), Gaps = 24/198 (12%)

Query: 129 GALCGGCSVLATYPLDLVRTRLSIQTANLTKLSKSRAHNISKPPGVWDLLCRTYKEEGGI 188
           G +  G +  A  PLDLV+ R  +  +    L KS           W  + R+   EG  
Sbjct: 26  GLVACGPTHSAVTPLDLVKCRRQVDAS----LYKSNLDG-------WRQIVRS---EGAT 71

Query: 189 KGLYRGVWPTSLGVVPYVALNFAVYEQFKEFMPEGTDNTLANFYK----LSIGALSGGVA 244
           K ++ GV  T++G     A  +  YE FK    +      A+ Y+    L+  A +  +A
Sbjct: 72  K-VFTGVGATAIGYSLQGAFKYGGYEFFKHQYSQLVSPETAHSYRTGIFLAASASAEFIA 130

Query: 245 QTVTYPFDLLRRRFQVLAMGGNELGFRYKSVMDALITIGKTEGFRGYYKGLTANLFKVIP 304
                P++ ++ R Q             ++V DA   +   EGF   YKG+T   F+ IP
Sbjct: 131 DIFLCPWEAIKVRQQTAVPPPFA-----RNVFDAYSKMVGAEGFASLYKGITPLWFRQIP 185

Query: 305 STAVSWLVYEVVCDLMHV 322
            T   +  +E + ++++ 
Sbjct: 186 YTMCKFTSFERIVEMIYA 203

>KLLA0B11319g 988293..989360 similar to sgd|S0006332 Saccharomyces
           cerevisiae YPR128c, start by similarity
          Length = 355

 Score = 50.1 bits (118), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 55/251 (21%), Positives = 100/251 (39%), Gaps = 37/251 (14%)

Query: 64  VGAVRQVYREEGTPGLFRGNGLNCIRIFPYSAVQFVVYEACKKHFFHVDGSKGR-EQLQN 122
           +  + +VYR EG  GL+ G   + +  F  S   F  Y   ++H+F V   KG   +   
Sbjct: 91  LDVIVKVYRNEGFGGLYHGLSASLLGTFIQSFSYFFWYTLIRRHYFRVKKVKGEAARFST 150

Query: 123 WQRLFSGALCGGCSVLATYPLDLVRTRLSIQTANLTKLSKSRAHNISKPPGVWDLLCRTY 182
            + L    L    S L T P+++V T             K +     +    +  + +  
Sbjct: 151 IEELLLSMLAAATSQLFTNPINIVST-------------KQQTRRGLEGDNSFKAIAKEV 197

Query: 183 KEEGGIKGLYRGVWPTSLGVVPYVALNFAVYEQFKEFM-------PEGTDNTL-----AN 230
            +E GI G ++ +   SL +    ++ +A  E+ K+ +        +  D++L      N
Sbjct: 198 YDEDGITGFWKSL-KVSLVLTINPSITYASAEKLKDILYHVEWNAKDLNDSSLQLKPGQN 256

Query: 231 FYKLSIGALSGGVAQTVTYPFDLLRRRFQVLAMGGNELGFRYKSVMDALITIGKTEGFRG 290
           F    IG LS  ++  +T+P  + +   Q           ++ S  + L  + + EG   
Sbjct: 257 FL---IGVLSKIISTCLTHPLIVAKASLQ-------RSSSKFTSFQEVLTYLYRHEGAHA 306

Query: 291 YYKGLTANLFK 301
            +KGL   L K
Sbjct: 307 LWKGLLPQLTK 317

 Score = 42.0 bits (97), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 54/244 (22%), Positives = 93/244 (38%), Gaps = 51/244 (20%)

Query: 120 LQNWQRLFSGALCGGCSVLATYPLDLVRTRLSIQ-----------------TANLTKLSK 162
           + + +  F GA+  G + LA YPLDL +T +  Q                 T   T  SK
Sbjct: 1   MASLENAFVGAVSSGFANLAVYPLDLAKTVIQTQLKQGDLYPSSDVQADVSTKESTGSSK 60

Query: 163 SRAHNISK------PP------------GVWDLLCRTYKEEGGIKGLYRGVWPTSLGVVP 204
            + H I +      PP               D++ + Y+ E G  GLY G+  + LG   
Sbjct: 61  PKKHGIQQIKPKPEPPTATKESLEQRYKHALDVIVKVYRNE-GFGGLYHGLSASLLGTFI 119

Query: 205 YVALNFAVY-----EQFKEFMPEGTDNTLANFYKLSIGALSGGVAQTVTYPFDLLRRRFQ 259
                F  Y       F+    +G     +   +L +  L+   +Q  T P +++  + Q
Sbjct: 120 QSFSYFFWYTLIRRHYFRVKKVKGEAARFSTIEELLLSMLAAATSQLFTNPINIVSTKQQ 179

Query: 260 VL--AMGGNELGFRYKSVMDALITIGKTEGFRGYYKGLTANLFKVIPSTAVSWLVYEVVC 317
                 G N      K V D        +G  G++K L  +L   I + ++++   E + 
Sbjct: 180 TRRGLEGDNSFKAIAKEVYDE-------DGITGFWKSLKVSLVLTI-NPSITYASAEKLK 231

Query: 318 DLMH 321
           D+++
Sbjct: 232 DILY 235

>Scas_687.15*
          Length = 328

 Score = 49.7 bits (117), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 51/230 (22%), Positives = 85/230 (36%), Gaps = 35/230 (15%)

Query: 120 LQNWQRLFSGALCGGCSVLATYPLDLVRTRLSIQTANLTK-----------LSKSRAHNI 168
           L+  + L +G L G    L   P + V+  +   +  L++           L K    ++
Sbjct: 97  LKGPRLLLAGILTGAVESLCIIPFENVKVTMIENSLQLSESKPTEKEIAGTLKKKVTFHV 156

Query: 169 SKPPGV-----WDLLCRTYKEEG------------GIKGLYRGVWPTSLGVVPYVALNFA 211
           +KP  +     W  +   Y                G++G  +G  PT    V    + F 
Sbjct: 157 AKPKQLSPQEQWRQVYSKYPSSNIFSVVKEIYLTRGLRGFAQGAMPTVFRQVSNSTVRFT 216

Query: 212 VYEQFKEFMPEGTDNTLANFYKLSIGALSGGVAQTVTYPFDLLRRRFQVLAMGGNELGFR 271
            Y   K+ +       L   Y   IG  S      +T P D+++ R Q          + 
Sbjct: 217 AYTTLKQLI--SPTQPLNEVYAFGIGLFSSCAVVALTQPIDVVKTRMQ-----SKTAHYF 269

Query: 272 YKSVMDALITIGKTEGFRGYYKGLTANLFKVIPSTAVSWLVYEVVCDLMH 321
           YK+ ++    +   EG    +KG    LFKV  S  +S+ VY+ V +L H
Sbjct: 270 YKNSLNCAYRVFVEEGMVSLWKGWLPRLFKVGLSGGISFGVYQYVENLSH 319

 Score = 36.2 bits (82), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 40/156 (25%), Positives = 62/156 (39%), Gaps = 21/156 (13%)

Query: 60  NQGIVGAVRQVYREEGTPGLFRGNGLNCIRIFPYSAVQFVVYEACKKHFFHVDGSKGREQ 119
           +  I   V+++Y   G  G  +G      R    S V+F  Y   K+            Q
Sbjct: 177 SSNIFSVVKEIYLTRGLRGFAQGAMPTVFRQVSNSTVRFTAYTTLKQLI-------SPTQ 229

Query: 120 LQNWQRLFSGALCGGCSVLA-TYPLDLVRTRLSIQTANLTKLSKSRAHNISKPPGVWDLL 178
             N    F   L   C+V+A T P+D+V+TR+  +T          AH   K     +  
Sbjct: 230 PLNEVYAFGIGLFSSCAVVALTQPIDVVKTRMQSKT----------AHYFYK--NSLNCA 277

Query: 179 CRTYKEEGGIKGLYRGVWPTSLGVVPYVALNFAVYE 214
            R + EEG +  L++G  P    V     ++F VY+
Sbjct: 278 YRVFVEEGMV-SLWKGWLPRLFKVGLSGGISFGVYQ 312

>Scas_715.45
          Length = 305

 Score = 49.7 bits (117), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 63/294 (21%), Positives = 121/294 (41%), Gaps = 45/294 (15%)

Query: 36  SRTVVSPFERVKILLQVQNSTTAYNQGIVGAVRQVYREEGTPGLFRGNGLNCIRIFPYSA 95
           + + V+P + +K  LQV    T Y     G + Q+ ++EG   LF G G  CI      A
Sbjct: 30  THSSVTPLDLIKCRLQVD--PTLYRSNTSGII-QILKKEGLGKLFTGVGATCIGYSLQGA 86

Query: 96  VQFVVYEACKK----HFFHVDGSKGREQLQNWQRLFSGALCGGCSVLATYPLDLVRTRLS 151
            ++  YE  K+    H    + +  + +   +  L S A     + +   P + ++ +  
Sbjct: 87  GKYGGYELFKRLYSTHLVKDEATAYKYRTSIY--LLSSATAEFFADIMLCPFEAIKVK-- 142

Query: 152 IQTANLTKLSKSRAHNISKPPGVWDLL---CRTYKEEGGIKGLYRGVWPTSLGVVPYVAL 208
                            + PP   +++    + Y +EG + G Y+G+ P     +PY   
Sbjct: 143 --------------QQTTMPPWCNNVIEGWKKMYAKEG-LNGFYKGITPLWCRQIPYTMC 187

Query: 209 NFAVYEQFKEF----MPEGTDNTLANFYKLSI----GALSGGVAQTVTYPFDLLRRRFQV 260
            F  +E+  E     +P    + ++   ++S+    G ++G +   V++P D++  +   
Sbjct: 188 KFTSFERIVEAIYARLPT-KKSEMSALQQISVSFVGGYMAGILCAIVSHPADVMVSKIN- 245

Query: 261 LAMGGNELGFRYKSVMDALITIGKTEGFRGYYKGLTANLFKVIPSTAVSWLVYE 314
                NE     +S+  AL  I    GF G + GL   +  +   T+  WL+Y+
Sbjct: 246 -----NERKVN-ESMNVALKRIYSRIGFVGLWNGLPVRILMIGTLTSFQWLIYD 293

 Score = 39.3 bits (90), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 40/186 (21%), Positives = 87/186 (46%), Gaps = 22/186 (11%)

Query: 39  VVSPFERVKILLQVQNSTTAYNQGIVGAVRQVYREEGTPGLFRGNGLNCIRIFPYSAVQF 98
           ++ PFE +K+  + Q +   +   ++   +++Y +EG  G ++G      R  PY+  +F
Sbjct: 132 MLCPFEAIKV--KQQTTMPPWCNNVIEGWKKMYAKEGLNGFYKGITPLWCRQIPYTMCKF 189

Query: 99  VVYEACKKHFFHVDGSKGREQ--LQNWQRLFSGALCGG--CSVLATYPLDLVRTRLSIQT 154
             +E   +  +    +K  E   LQ     F G    G  C+++ ++P D++ ++++   
Sbjct: 190 TSFERIVEAIYARLPTKKSEMSALQQISVSFVGGYMAGILCAIV-SHPADVMVSKIN--- 245

Query: 155 ANLTKLSKSRAHNISKPPGVWDLLCRTYKEEGGIKGLYRGVWPTSLGVVPYVALNFAVYE 214
            N  K+++S   N++        L R Y   G + GL+ G+    L +    +  + +Y+
Sbjct: 246 -NERKVNES--MNVA--------LKRIYSRIGFV-GLWNGLPVRILMIGTLTSFQWLIYD 293

Query: 215 QFKEFM 220
            FK ++
Sbjct: 294 SFKAYV 299

 Score = 38.9 bits (89), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 45/186 (24%), Positives = 76/186 (40%), Gaps = 27/186 (14%)

Query: 142 PLDLVRTRLSIQTANLTKLSKSRAHNISKPPGVWDLLCRTYKEEGGIKGLYRGVWPTSLG 201
           PLDL++ RL +       L +S    I           +  K+EG +  L+ GV  T +G
Sbjct: 36  PLDLIKCRLQVDPT----LYRSNTSGI----------IQILKKEG-LGKLFTGVGATCIG 80

Query: 202 VVPYVALNFAVYEQFKEFMPEG--TDNTLANFYKLSIGALSGGVAQ----TVTYPFDLLR 255
                A  +  YE FK         D   A  Y+ SI  LS   A+     +  PF+ ++
Sbjct: 81  YSLQGAGKYGGYELFKRLYSTHLVKDEATAYKYRTSIYLLSSATAEFFADIMLCPFEAIK 140

Query: 256 RRFQVLAMGGNELGFRYKSVMDALITIGKTEGFRGYYKGLTANLFKVIPSTAVSWLVYEV 315
            + Q        +     +V++    +   EG  G+YKG+T    + IP T   +  +E 
Sbjct: 141 VKQQ------TTMPPWCNNVIEGWKKMYAKEGLNGFYKGITPLWCRQIPYTMCKFTSFER 194

Query: 316 VCDLMH 321
           + + ++
Sbjct: 195 IVEAIY 200

>CAGL0C02013g complement(209930..210919) weakly similar to sp|P38152
           Saccharomyces cerevisiae YBR291c CTP1, hypothetical
           start
          Length = 329

 Score = 49.7 bits (117), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 65/314 (20%), Positives = 122/314 (38%), Gaps = 46/314 (14%)

Query: 36  SRTVVSPFERVKILLQV-QNSTTAYNQGIVGAVRQVYREEGTPGLFRGNGLNCIRIFPYS 94
           S T+  PFE +K  LQ+ +N   A    ++G   + Y        F G     I +   +
Sbjct: 23  SATITYPFEFLKTGLQLHRNVVAAKPFEVLGYQVRTY--------FAGCSAVNIGVVMKT 74

Query: 95  AVQFVVYEACKKHFFHVDGSKGREQLQNWQRLFSGALCGGCSVLATYPLDLVRT------ 148
           +++F+ ++   + +           L   Q L +GAL G    L   P + V+       
Sbjct: 75  SLRFLAFDKASE-WLRPPALAKDAPLSGVQLLMAGALTGTMESLCIIPFENVKVAMIQNS 133

Query: 149 -----RLSIQTANLT-KLSKSRAHNISKPP----------------GVWDLLCRTYKEEG 186
                RL+  T+N+  +++        K P                 V       Y++ G
Sbjct: 134 LLSHERLNTTTSNVQGQVANEVKKTFHKKPTLRSSYEALFPEKLPTNVLTTAAELYRQHG 193

Query: 187 GIKGLYRGVWPTSLGVVPYVALNFAVYEQFKEFMPEGTDNTLANFYKLSIGALSGGVAQT 246
            ++  ++G  PT +  V    + F  +   K+F P+   N    ++   +G +S      
Sbjct: 194 -LRAYFKGTMPTLMRQVGNSVVRFTTFTMLKQFAPKEYQNN--EYFATLLGLISSCAVVG 250

Query: 247 VTYPFDLLRRRFQVLAMGGNELGFRYKSVMDALITIGKTEGFRGYYKGLTANLFKVIPST 306
            T P D+++ R Q       +    Y++ ++    I   EGF   +KG    L KV  S 
Sbjct: 251 ATQPLDVIKTRMQ-----AKDSVLLYRNSINCAYRIFVEEGFAMLWKGWLPRLMKVGLSG 305

Query: 307 AVSWLVYEVVCDLM 320
           +VS+ +Y+   +++
Sbjct: 306 SVSFGIYQYTENMI 319

>KLLA0A00979g complement(92561..93592) weakly similar to sp|P38152
           Saccharomyces cerevisiae YBR291c CTP1 citrate transport
           protein, mitochondrial (MCF), start by similarity
          Length = 343

 Score = 49.7 bits (117), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 38/137 (27%), Positives = 60/137 (43%), Gaps = 13/137 (9%)

Query: 187 GIKGLYRGVWPTSLGVVPYVALNFAVYEQFKEFMPEGTDNTLANFYKLSIGALSGGVAQT 246
           G    ++G  PT    V   A+ F  Y   K+ +    +  L+ +Y   IG  S      
Sbjct: 205 GFTTFFQGSMPTIFRQVGNSAVRFTTYTTLKQMI--SPNKPLSEYYAFGIGVFSSCAVVA 262

Query: 247 VTYPFDLLRRRFQ---VLAMGGNELGFRYKSVMDALITIGKTEGFRGYYKGLTANLFKVI 303
           +T P D+++ R Q     ++  N L   Y++ ++        EG    +KG    LFKV 
Sbjct: 263 LTQPIDVVKTRMQSKYTWSLYRNSLNCVYRTFIE--------EGLTSLWKGWVPRLFKVG 314

Query: 304 PSTAVSWLVYEVVCDLM 320
            S  VS+ VY+ V +LM
Sbjct: 315 LSGGVSFGVYQYVDNLM 331

 Score = 33.1 bits (74), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 40/160 (25%), Positives = 68/160 (42%), Gaps = 21/160 (13%)

Query: 62  GIVGAVRQVYREEGTPGLFRGNGLNCIRIFPYSAVQFVVYEACKKHFFHVDGSKGREQLQ 121
            I   VR++ +  G    F+G+     R    SAV+F  Y   K+    +  +K   +  
Sbjct: 192 NIFTTVREMVQTRGFTTFFQGSMPTIFRQVGNSAVRFTTYTTLKQ---MISPNKPLSEYY 248

Query: 122 NWQRLFSGALCGGCSVLA-TYPLDLVRTRLSIQTANLTKLSKSRAHNISKPPGVWDLLCR 180
                F   +   C+V+A T P+D+V+TR+       +K + S   N        + + R
Sbjct: 249 ----AFGIGVFSSCAVVALTQPIDVVKTRMQ------SKYTWSLYRN------SLNCVYR 292

Query: 181 TYKEEGGIKGLYRGVWPTSLGVVPYVALNFAVYEQFKEFM 220
           T+ EE G+  L++G  P    V     ++F VY+     M
Sbjct: 293 TFIEE-GLTSLWKGWVPRLFKVGLSGGVSFGVYQYVDNLM 331

>AGL064W [4247] [Homologous to ScYBR291C (CTP1) - SH]
           complement(587623..588513) [891 bp, 296 aa]
          Length = 296

 Score = 48.9 bits (115), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 71/320 (22%), Positives = 117/320 (36%), Gaps = 53/320 (16%)

Query: 21  DSNVAFXXXXXXXXVSRTVVSPFERVKILLQVQNSTTAYNQGIVGAVRQVYREEGTPGLF 80
           D+  +F        +   V  PFE  K  LQ+    +  ++  +  + +  R +G   L+
Sbjct: 9   DAARSFVAGAAAGAIEGCVTYPFEFAKTRLQLAQQGSGESRNPLVLLYRTARTQGAGALY 68

Query: 81  RGNGLNCIRIFPYSAVQFVVYEACKKHFFHVDGSKGREQLQNWQRLFSGALCGGCSVLAT 140
            G               FVV   CK     +     R  LQ+ +    GAL G   +LA 
Sbjct: 69  VG------------CPAFVVGNTCKAGVRFLGFDALRRALQDER----GALSGPRGMLAG 112

Query: 141 YPLDLVRTRLSIQTANLTKLSKSRAHNISKPPGVWDLLCRTYKEEGGIKGLYRG------ 194
               L+ + L++      K +       ++P          Y+  G  +G  R       
Sbjct: 113 LGAGLLESVLAVTPFEAVKTALIDDRQAARP---------RYQHNG--RGAARNYALLLR 161

Query: 195 ----------VWPTSLGVVPYVALNFAVYEQFKEFMPE--GT--DNTLANFYKLSIGALS 240
                     + P +L      A+ F  Y Q K+ +    GT  D  L +     +GALS
Sbjct: 162 ELGLRGLYGGLVPVALRQASNQAVRFGCYTQLKQAVQRYAGTPADQPLGSGQTFLVGALS 221

Query: 241 GGVAQTVTYPFDLLRRRFQVLAMGGNELGFRYKSVMDALITIGKTEGFRGYYKGLTANLF 300
           G V    T P D ++ R Q L         RY S +     + + EG R  ++G T  L 
Sbjct: 222 GIVTVYATMPVDTVKTRMQALDAA------RYGSTVGCFRAVVREEGVRALWRGATPRLG 275

Query: 301 KVIPSTAVSWLVYEVVCDLM 320
           +++ S  + +  YE +  L+
Sbjct: 276 RLVLSGGIVFTAYEKLLVLL 295

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 35/127 (27%), Positives = 55/127 (43%), Gaps = 14/127 (11%)

Query: 95  AVQFVVYEACKKHFFHVDGSKGREQLQNWQRLFSGALCGGCSVLATYPLDLVRTRLSIQT 154
           AV+F  Y   K+      G+   + L + Q    GAL G  +V AT P+D V+TR+    
Sbjct: 184 AVRFGCYTQLKQAVQRYAGTPADQPLGSGQTFLVGALSGIVTVYATMPVDTVKTRMQ--- 240

Query: 155 ANLTKLSKSRAHNISKPPGVWDLLCRTYKEEGGIKGLYRGVWPTSLGVVPYVALNFAVYE 214
                L  +R  +     G +  + R    E G++ L+RG  P    +V    + F  YE
Sbjct: 241 ----ALDAARYGSTV---GCFRAVVR----EEGVRALWRGATPRLGRLVLSGGIVFTAYE 289

Query: 215 QFKEFMP 221
           +    +P
Sbjct: 290 KLLVLLP 296

>YDL198C (GGC1) [676] chr4 complement(103650..104552) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters, overexpression suppresses loss of Abf2p
           [903 bp, 300 aa]
          Length = 300

 Score = 48.1 bits (113), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 44/181 (24%), Positives = 78/181 (43%), Gaps = 24/181 (13%)

Query: 35  VSRTVVSPFERVKILLQVQNSTTAYNQGIVGAVRQVYREEGTPGLFRGNGLNCIRIFPYS 94
           +   V+ P + +KI  Q  N  +   +G +    ++ R+EG   L+RG G    R  P S
Sbjct: 131 IGEIVLLPLDVLKIKRQT-NPESFKGRGFI----KILRDEGLFNLYRGWGWTAARNAPGS 185

Query: 95  AVQFVVYEACKKHFFHVDGSKGREQLQNWQRLFSGALCGGCS-VLATYPLDLVRTRLSIQ 153
              F      K++     G K   Q   W + F  ++ G CS ++ + PLD+++TR+   
Sbjct: 186 FALFGGNAFAKEYIL---GLKDYSQ-ATWSQNFISSIVGACSSLIVSAPLDVIKTRI--- 238

Query: 154 TANLTKLSKSRAHNISKPPGVWDLLCRTYKEEGGIKGLYRGVWPTSLGVVPYVALNFAVY 213
                     +  N   P     ++  T K E G+   ++G+ P  L   P +  +FA+ 
Sbjct: 239 ----------QNRNFDNPESGLRIVKNTLKNE-GVTAFFKGLTPKLLTTGPKLVFSFALA 287

Query: 214 E 214
           +
Sbjct: 288 Q 288

 Score = 31.2 bits (69), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 34/132 (25%), Positives = 55/132 (41%), Gaps = 7/132 (5%)

Query: 184 EEGGIKGLYRGVWPTSLGVVPYVALNFAVYEQFKEFMPEGTDNTLANFYKLSIGALSGGV 243
            + G+  LYRG   T+    P     F      KE++    D + A + +  I ++ G  
Sbjct: 163 RDEGLFNLYRGWGWTAARNAPGSFALFGGNAFAKEYILGLKDYSQATWSQNFISSIVGAC 222

Query: 244 AQ-TVTYPFDLLRRRFQVLAMGGNELGFRYKSVMDALITIGKTEGFRGYYKGLTANLFKV 302
           +   V+ P D+++ R Q       E G R   V + L    K EG   ++KGLT  L   
Sbjct: 223 SSLIVSAPLDVIKTRIQNRNFDNPESGLRI--VKNTL----KNEGVTAFFKGLTPKLLTT 276

Query: 303 IPSTAVSWLVYE 314
            P    S+ + +
Sbjct: 277 GPKLVFSFALAQ 288

>Sklu_2260.5 YER053C, Contig c2260 6981-7889 reverse complement
          Length = 302

 Score = 47.4 bits (111), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 58/287 (20%), Positives = 114/287 (39%), Gaps = 33/287 (11%)

Query: 36  SRTVVSPFERVKILLQVQNSTTAYNQGIVGAVRQVYREEGTPGLFRGNGLNCIRIFPYSA 95
           + + V+P + VK  LQV       N   +   + + R EG   +F G G   I      A
Sbjct: 29  THSSVTPLDLVKCRLQVNPQLYRSN---LDGWKTIVRSEGLSKVFTGVGATFIGYSLQGA 85

Query: 96  VQFVVYEACKKHFFHVDGSKGREQLQNWQRLFSGALCGGCSVLATYPLDLVRTRLSIQTA 155
            ++  YE  K+ + ++   +   + +    L + A     + +   P + ++ +   Q  
Sbjct: 86  CKYGGYEYFKQTYSNLLSPETAHRHRTAVYLCASASAEFLADILLCPWEAIKVK---QQT 142

Query: 156 NLTKLSKSRAHNISKPPGVWDLLCRTYKEEGGIKGLYRGVWPTSLGVVPYVALNFAVYEQ 215
            +    K+     SK                G+ GLY+G+ P     +PY    F  +E+
Sbjct: 143 TIPPFCKNFLEGWSK-----------ITAAEGLSGLYKGITPLWCRQIPYTMCKFTSFER 191

Query: 216 FKEF----MPEGTDNTLANFYKLSI----GALSGGVAQTVTYPFDLLRRRFQVLAMGGNE 267
             E     +P  +   ++   ++ +    G L+G +   V++P D++  +       G  
Sbjct: 192 IVEMIYAKLPR-SKQEMSPSQQIGVSFVGGYLAGILCAVVSHPADVMVSKVNADRKQG-- 248

Query: 268 LGFRYKSVMDALITIGKTEGFRGYYKGLTANLFKVIPSTAVSWLVYE 314
                +S+++A   I    GF G + GL   +F +   T+  WL+Y+
Sbjct: 249 -----ESMVEASKRIYSRIGFGGLWNGLPVRIFMIGTLTSFQWLIYD 290

 Score = 37.7 bits (86), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 42/185 (22%), Positives = 75/185 (40%), Gaps = 27/185 (14%)

Query: 142 PLDLVRTRLSIQTANLTKLSKSRAHNISKPPGVWDLLCRTYKEEGGIKGLYRGVWPTSLG 201
           PLDLV+ RL +      +L +S           W  + R+     G+  ++ GV  T +G
Sbjct: 35  PLDLVKCRLQVNP----QLYRSNLDG-------WKTIVRS----EGLSKVFTGVGATFIG 79

Query: 202 VVPYVALNFAVYEQFKE-----FMPEGTDNTLANFYKLSIGALSGGVAQTVTYPFDLLRR 256
                A  +  YE FK+       PE         Y L   A +  +A  +  P++ ++ 
Sbjct: 80  YSLQGACKYGGYEYFKQTYSNLLSPETAHRHRTAVY-LCASASAEFLADILLCPWEAIKV 138

Query: 257 RFQVLAMGGNELGFRYKSVMDALITIGKTEGFRGYYKGLTANLFKVIPSTAVSWLVYEVV 316
           + Q        +    K+ ++    I   EG  G YKG+T    + IP T   +  +E +
Sbjct: 139 KQQ------TTIPPFCKNFLEGWSKITAAEGLSGLYKGITPLWCRQIPYTMCKFTSFERI 192

Query: 317 CDLMH 321
            ++++
Sbjct: 193 VEMIY 197

>Sklu_2442.8 YNL003C, Contig c2442 12309-13136
          Length = 275

 Score = 46.6 bits (109), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 54/255 (21%), Positives = 104/255 (40%), Gaps = 35/255 (13%)

Query: 75  GTPGLFRGNGLNCIRIFPYSAVQFVVYEACKKHFFHVDG---SKGREQLQNWQRLFSGAL 131
           G  G++RG G   I   P +++ FV Y++ K +   V     +   +       +FS ++
Sbjct: 45  GYKGVYRGLGSAVIASAPSASLFFVSYDSMKVYSKPVISKYVTSNNQMADTLSHMFSSSI 104

Query: 132 CGGCSVLATYPLDLVRTRLSIQTANLTKLSKSRAHNISKPPGVWDLLCRTYKEEGG---I 188
               + L   P ++++ R      N +                W    +  + E G   +
Sbjct: 105 GEVSACLVRVPAEVIKQRTQTHKTNSS----------------WQTFTKILQNENGEGVL 148

Query: 189 KGLYRGVWPTSLGVVPYVALNFAVYEQFKE-FMPEGTDNTLANFYKLSIGALSGGVAQTV 247
           + LYRG   T +  +P+  + F +YE  K+ +      + +A +     G+++G +A   
Sbjct: 149 RNLYRGWNTTIMREIPFTCIQFPLYEFLKKTWAKRNGQDHVAPWQGSVCGSVAGAIAAAT 208

Query: 248 TYPFDLLRRRFQVLAMGGNELGFRYKSVMDALIT--IGKTEGFRGYYKGLTANLFKVIPS 305
           T P D+L+ R          L   +KS+  A +   I   EGF+ ++ G+      +   
Sbjct: 209 TTPLDVLKTR----------LMLSHKSIPVAQLAKNIYAEEGFKVFFSGVGPRTMWISAG 258

Query: 306 TAVSWLVYEVVCDLM 320
            A+   VYE V  ++
Sbjct: 259 GAIFLGVYETVHSIL 273

 Score = 46.6 bits (109), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 43/177 (24%), Positives = 76/177 (42%), Gaps = 28/177 (15%)

Query: 42  PFERVKILLQVQNSTTAYNQGIVGAVRQVYREEGTPG----LFRGNGLNCIRIFPYSAVQ 97
           P E +K   Q   + +++         ++ + E   G    L+RG     +R  P++ +Q
Sbjct: 115 PAEVIKQRTQTHKTNSSWQ-----TFTKILQNENGEGVLRNLYRGWNTTIMREIPFTCIQ 169

Query: 98  FVVYEACKKHFFHVDGSKGREQLQNWQRLFSGALCGGCSVLATYPLDLVRTRLSIQTANL 157
           F +YE  KK +   +G   ++ +  WQ    G++ G  +   T PLD+++TRL +   ++
Sbjct: 170 FPLYEFLKKTWAKRNG---QDHVAPWQGSVCGSVAGAIAAATTTPLDVLKTRLMLSHKSI 226

Query: 158 TKLSKSRAHNISKPPGVWDLLCRTYKEEGGIKGLYRGVWPTSLGVVPYVALNFAVYE 214
                           V  L    Y EE G K  + GV P ++ +    A+   VYE
Sbjct: 227 P---------------VAQLAKNIYAEE-GFKVFFSGVGPRTMWISAGGAIFLGVYE 267

 Score = 46.2 bits (108), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 44/199 (22%), Positives = 78/199 (39%), Gaps = 44/199 (22%)

Query: 126 LFSGALCGGCSVLATYPLDLVRTRLSIQTANLTKLSKSRAHNISKPPGVWDLLCRTYKEE 185
           L SGA  G  + LA +P+D ++TRL  +                            +   
Sbjct: 10  LASGAAAGTSTDLAFFPIDTLKTRLQAKGG--------------------------FFAN 43

Query: 186 GGIKGLYRGVWPTSLGVVPYVALNFAVYEQFKEFMP----------EGTDNTLANFYKLS 235
           GG KG+YRG+    +   P  +L F  Y+  K +                +TL++ +  S
Sbjct: 44  GGYKGVYRGLGSAVIASAPSASLFFVSYDSMKVYSKPVISKYVTSNNQMADTLSHMFSSS 103

Query: 236 IGALSGGVAQTVTYPFDLLRRRFQVLAMGGNELGFRYKSVMDALITIGKTEGFRGYYKGL 295
           IG +S   A  V  P +++++R Q      ++    +++    L         R  Y+G 
Sbjct: 104 IGEVS---ACLVRVPAEVIKQRTQT-----HKTNSSWQTFTKILQNENGEGVLRNLYRGW 155

Query: 296 TANLFKVIPSTAVSWLVYE 314
              + + IP T + + +YE
Sbjct: 156 NTTIMREIPFTCIQFPLYE 174

>Scas_562.12
          Length = 300

 Score = 46.2 bits (108), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 42/180 (23%), Positives = 75/180 (41%), Gaps = 22/180 (12%)

Query: 35  VSRTVVSPFERVKILLQVQNSTTAYNQGIVGAVRQVYREEGTPGLFRGNGLNCIRIFPYS 94
           +   V+ P + +KI  Q  N      +G V    ++ ++EG   L+RG G    R  P S
Sbjct: 131 IGEIVLLPLDVLKIKRQT-NPEAFKGRGFV----KILKDEGIFNLYRGWGWTAARNAPGS 185

Query: 95  AVQFVVYEACKKHFFHVDGSKGREQLQNWQRLFSGALCGGCSVLATYPLDLVRTRLSIQT 154
              F      K++     G +   Q    Q   S  +   CS++ + PLD+++TR+    
Sbjct: 186 FALFGGNAFAKEYIL---GLEDYSQASWSQNFISSIVGASCSLIVSAPLDVIKTRI---- 238

Query: 155 ANLTKLSKSRAHNISKPPGVWDLLCRTYKEEGGIKGLYRGVWPTSLGVVPYVALNFAVYE 214
                    +  +   P     ++  T+K E GI   ++G+ P  L   P +  +FA+ +
Sbjct: 239 ---------QNRSFDNPETGLTIVKNTFKNE-GITAFFKGLTPKLLTTGPKLVFSFALAQ 288

 Score = 30.8 bits (68), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 52/228 (22%), Positives = 89/228 (39%), Gaps = 27/228 (11%)

Query: 89  RIFPYSAVQFVVYEACKKHFF-HVDGSKGREQLQNWQRLFSGALCGGCSVLATYPLDLVR 147
           R++ Y    F   E   KH+    D + G +  +  +   +G+L G    +   PLD+  
Sbjct: 86  RVYKYGGQPFA-NEFLNKHYKKDFDSAFGEKTGKAMRSATAGSLIG-IGEIVLLPLDV-- 141

Query: 148 TRLSIQTANLTKLSKSRAHNISKPPGVWDLLCRTYKEEGGIKGLYRGVWPTSLGVVPYVA 207
             L I+     +  K R               +  K+EG I  LYRG   T+    P   
Sbjct: 142 --LKIKRQTNPEAFKGRG------------FVKILKDEG-IFNLYRGWGWTAARNAPGSF 186

Query: 208 LNFAVYEQFKEFMPEGTDNTLANFYKLSIGALSGG-VAQTVTYPFDLLRRRFQVLAMGGN 266
             F      KE++    D + A++ +  I ++ G   +  V+ P D+++ R Q  +    
Sbjct: 187 ALFGGNAFAKEYILGLEDYSQASWSQNFISSIVGASCSLIVSAPLDVIKTRIQNRSFDNP 246

Query: 267 ELGFRYKSVMDALITIGKTEGFRGYYKGLTANLFKVIPSTAVSWLVYE 314
           E G      +  +    K EG   ++KGLT  L    P    S+ + +
Sbjct: 247 ETG------LTIVKNTFKNEGITAFFKGLTPKLLTTGPKLVFSFALAQ 288

>YER053C (PIC2) [1481] chr5 complement(258736..259638) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters, has similarity to C. elegans mitochondrial
           phosphate carrier protein [903 bp, 300 aa]
          Length = 300

 Score = 45.8 bits (107), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 31/143 (21%), Positives = 61/143 (42%), Gaps = 16/143 (11%)

Query: 180 RTYKEEGGIKGLYRGVWPTSLGVVPYVALNFAVYEQFKE----FMPEGTDNTLANFYKLS 235
           + Y E GG+K  Y+G+ P     +PY    F  +E+  +     +P+  +   A   ++S
Sbjct: 154 KMYAESGGMKAFYKGIVPLWCRQIPYTMCKFTSFEKIVQKIYSVLPKKKEEMNA-LQQIS 212

Query: 236 I----GALSGGVAQTVTYPFDLLRRRFQVLAMGGNELGFRYKSVMDALITIGKTEGFRGY 291
           +    G L+G +   V++P D++  +          +    K +   +       GF G 
Sbjct: 213 VSFVGGYLAGILCAAVSHPADVMVSKINSERKANESMSVASKRIYQKI-------GFTGL 265

Query: 292 YKGLTANLFKVIPSTAVSWLVYE 314
           + GL   +  +   T+  WL+Y+
Sbjct: 266 WNGLMVRIVMIGTLTSFQWLIYD 288

 Score = 36.2 bits (82), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 35/191 (18%), Positives = 82/191 (42%), Gaps = 23/191 (12%)

Query: 35  VSRTVVSPFERVKILLQVQNSTTAYNQGIVGAVRQVYREEG-TPGLFRGNGLNCIRIFPY 93
           ++  ++ PFE +K+  + Q +   +   +V   +++Y E G     ++G      R  PY
Sbjct: 122 LADIMLCPFEAIKV--KQQTTMPPFCNNVVDGWKKMYAESGGMKAFYKGIVPLWCRQIPY 179

Query: 94  SAVQFVVYEACKKHFFHVDGSKGREQLQNWQRL----FSGALCGGCSVLATYPLDLVRTR 149
           +  +F  +E   +  + V   K +E++   Q++      G L G      ++P D++   
Sbjct: 180 TMCKFTSFEKIVQKIYSVLPKK-KEEMNALQQISVSFVGGYLAGILCAAVSHPADVM--- 235

Query: 150 LSIQTANLTKLSKSRAHNISKPPGVWDLLCRTYKEEGGIKGLYRGVWPTSLGVVPYVALN 209
                  ++K++  R  N S       +  +   ++ G  GL+ G+    + +    +  
Sbjct: 236 -------VSKINSERKANESM-----SVASKRIYQKIGFTGLWNGLMVRIVMIGTLTSFQ 283

Query: 210 FAVYEQFKEFM 220
           + +Y+ FK ++
Sbjct: 284 WLIYDSFKAYV 294

>CAGL0D04774g complement(467712..468680) similar to tr|Q06497
           Saccharomyces cerevisiae YPR128c, start by similarity
          Length = 322

 Score = 44.3 bits (103), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 24/67 (35%), Positives = 36/67 (53%), Gaps = 4/67 (5%)

Query: 237 GALSGGVAQTVTYPFDLLRRRFQV----LAMGGNELGFRYKSVMDALITIGKTEGFRGYY 292
           GA++  +A T  YP DL +   Q        G ++   +YK+V+D +I I K  GF G Y
Sbjct: 10  GAVASSLAATTVYPLDLAKTLIQTQHKNADSGDSKEEEKYKNVIDCIIKIFKKRGFLGLY 69

Query: 293 KGLTANL 299
           +GL  N+
Sbjct: 70  QGLATNV 76

 Score = 42.4 bits (98), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 38/161 (23%), Positives = 69/161 (42%), Gaps = 21/161 (13%)

Query: 120 LQNWQRLFSGALCGGCSVLATYPLDLVRTRLSIQTANLTKLSKSRAHNISKPPGVWDLLC 179
           + + +  F+GA+    +    YPLDL +T +  Q  N        +    K   V D + 
Sbjct: 1   MASLESAFTGAVASSLAATTVYPLDLAKTLIQTQHKN---ADSGDSKEEEKYKNVIDCII 57

Query: 180 RTYKEEGGIKGLYRGVWPTSLGVVPYVALNF----------AVYEQFKEFMPEGTDNT-- 227
           + +K+ G + GLY+G+   +  V      NF          + Y  FK    +  D++  
Sbjct: 58  KIFKKRGFL-GLYQGL---ATNVAANFVQNFIYFFWYSLIRSNYFVFKAGRLQLKDDSKF 113

Query: 228 --LANFYKLSIGALSGGVAQTVTYPFDLLRRRFQVLAMGGN 266
             L+   +L++G  +G + Q VT P  ++  R Q+   G +
Sbjct: 114 IELSTIEELALGMSAGAMTQVVTNPISVISTRQQLTKDGED 154

 Score = 40.8 bits (94), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 57/289 (19%), Positives = 119/289 (41%), Gaps = 53/289 (18%)

Query: 35  VSRTVVSPFERVKILLQVQNSTTAYN--------QGIVGAVRQVYREEGTPGLFRGNGLN 86
           ++ T V P +  K L+Q Q+              + ++  + +++++ G  GL++G   N
Sbjct: 16  LAATTVYPLDLAKTLIQTQHKNADSGDSKEEEKYKNVIDCIIKIFKKRGFLGLYQGLATN 75

Query: 87  CIRIFPYSAVQFVVYEACKKHFFHVDGSKGREQLQN---------WQRLFSGALCGGCSV 137
               F  + + F  Y   + ++F      GR QL++          + L  G   G  + 
Sbjct: 76  VAANFVQNFIYFFWYSLIRSNYFVFKA--GRLQLKDDSKFIELSTIEELALGMSAGAMTQ 133

Query: 138 LATYPLDLVRTRLSIQTANLTKLSKSRAHNISKPPGVWDLLCRTYKEEGG-IKGLYRGVW 196
           + T P+ ++ TR         +L+K       +   +  ++ + Y+E  G +   ++G +
Sbjct: 134 VVTNPISVISTR--------QQLTKD-----GEDASLKAVIKQIYEESNGDLTAFWKG-F 179

Query: 197 PTSLGVVPYVALNFAVYEQFKEFMPEGTDNTLANFYKLS----------IGALSGGVAQT 246
             +L +    A+ +  Y++ K  +   T   L+   K+S          +G  S  ++  
Sbjct: 180 KVALVLSTNPAITYGSYQKLKSMIL--TAKGLSGSQKISTQLSAGENFLLGMFSKMISTF 237

Query: 247 VTYPFDLLRRRFQVLAMGGNELGFRYKSVMDALITIGKTEGFRGYYKGL 295
           VT P  + +   Q     G   G ++K+  + L  I + EGF   +KG+
Sbjct: 238 VTQPLIVAKITLQ-----GK--GSKFKTFQEVLQHIYQNEGFLSLWKGV 279

>Scas_696.9
          Length = 312

 Score = 43.9 bits (102), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 32/134 (23%), Positives = 63/134 (47%), Gaps = 18/134 (13%)

Query: 68  RQVYREEGTPGLFRGNGLNCIRIFPYSAVQFVVYEACKKHFFHVDG-SKGREQLQNWQRL 126
           R +Y +EG  G+++G     IR       +F      +       G +K  ++L  W+++
Sbjct: 158 RSIYAKEGLRGIYKGVNAVAIRQMTNWGSRFGFSRLVEDWVRKATGKTKPEDRLNAWEKI 217

Query: 127 FSGALCGGCSVLATYPLDLVRTRLSIQTANLTKLSKSRAHNISKPPGVWDLLCRTYK--- 183
            + A+ GG S     P++++R  +           +S+  + ++P  +   + +T+K   
Sbjct: 218 GATAVGGGLSAW-NQPIEVIRVEM-----------QSKKEDPNRPKNL--TVAKTFKYIM 263

Query: 184 EEGGIKGLYRGVWP 197
           +  G+KGLYRGV P
Sbjct: 264 KTNGVKGLYRGVTP 277

 Score = 32.7 bits (73), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 33/153 (21%), Positives = 68/153 (44%), Gaps = 11/153 (7%)

Query: 152 IQTANLTKLSKSRAHNISKPPGVWDLLCRTYKEEGGIKGLYRGVWPTSLGVVPYVALNFA 211
           ++T  +T+L  + A   +     W++    Y +EG ++G+Y+GV   ++  +      F 
Sbjct: 133 MKTVEITRLKSASAG--APVQSSWNVFRSIYAKEG-LRGIYKGVNAVAIRQMTNWGSRFG 189

Query: 212 VYEQFKEFMPEGTDNT-----LANFYKLSIGALSGGVAQTVTYPFDLLRRRFQVLAMGGN 266
                ++++ + T  T     L  + K+   A+ GG++     P +++R   Q      N
Sbjct: 190 FSRLVEDWVRKATGKTKPEDRLNAWEKIGATAVGGGLS-AWNQPIEVIRVEMQSKKEDPN 248

Query: 267 ELGFRYKSVMDALITIGKTEGFRGYYKGLTANL 299
               +  +V      I KT G +G Y+G+T  +
Sbjct: 249 RP--KNLTVAKTFKYIMKTNGVKGLYRGVTPRI 279

>YDL119C (YDL119C) [751] chr4 complement(246689..247612) Member of
           the mitochondrial carrier family (MCF) of membrane
           transporters [924 bp, 307 aa]
          Length = 307

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 46/216 (21%), Positives = 80/216 (37%), Gaps = 35/216 (16%)

Query: 112 DGSKGREQLQNWQRLFSGALCGGCSVLATYPLDLVRTRLSIQTANLTKLSKSRAHNISKP 171
           + S    +L  ++ L +GA   G     T P+ +++ R      N + L ++  H     
Sbjct: 107 NKSSSLPRLTMYENLLTGAFARGLVGYITMPITVIKVRYESTLYNYSSLKEAITH----- 161

Query: 172 PGVWDLLCRTYKEEGGIKGLYRGVWPTSLGVVPYVALNFAVYEQFKEFMPE--------- 222
                     Y +EG           T L   PY  L   +YE+ K+ +P          
Sbjct: 162 ---------IYTKEGLFGFFRGFG-ATCLRDAPYAGLYVLLYEKSKQLLPMVLPSRFIHY 211

Query: 223 ----GTDNTLANFYKLSIGALSGGVAQTVTYPFDLLRRRFQVLAMGGNELGFRYKSVMDA 278
               G     +     +   LS  +A TVT PFD ++ R Q+          ++ +  + 
Sbjct: 212 NPEGGFTTYTSTTVNTTSAVLSASLATTVTAPFDTIKTRMQLEPS-------KFTNSFNT 264

Query: 279 LITIGKTEGFRGYYKGLTANLFKVIPSTAVSWLVYE 314
             +I K E     + GL+  L +   S  ++W +YE
Sbjct: 265 FTSIVKNENVLKLFSGLSMRLARKAFSAGIAWGIYE 300

 Score = 37.4 bits (85), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 31/120 (25%), Positives = 54/120 (45%), Gaps = 10/120 (8%)

Query: 49  LLQVQNSTTAYN-QGIVGAVRQVYREEGTPGLFRGNGLNCIRIFPYSAVQFVVYEACKK- 106
           +++V+  +T YN   +  A+  +Y +EG  G FRG G  C+R  PY+ +  ++YE  K+ 
Sbjct: 140 VIKVRYESTLYNYSSLKEAITHIYTKEGLFGFFRGFGATCLRDAPYAGLYVLLYEKSKQL 199

Query: 107 -------HFFHVDGSKG-REQLQNWQRLFSGALCGGCSVLATYPLDLVRTRLSIQTANLT 158
                   F H +   G            S  L    +   T P D ++TR+ ++ +  T
Sbjct: 200 LPMVLPSRFIHYNPEGGFTTYTSTTVNTTSAVLSASLATTVTAPFDTIKTRMQLEPSKFT 259

 Score = 32.0 bits (71), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 50/219 (22%), Positives = 88/219 (40%), Gaps = 46/219 (21%)

Query: 121 QNWQRLFSGALCGGCSVLATYPLDLVRTRLSIQTANLTKLSKSRAHNISKPPGVWDLLCR 180
           +N   L  G   G  S +A  PLDL++TR+                   K   +W    +
Sbjct: 9   RNSSHLIGGFFGGLTSAVALQPLDLLKTRIQQD----------------KKATLW----K 48

Query: 181 TYKEEGGIKGLYRGVWP----TSLGVVPYVA-LNF--AVYEQFKEFMPEGTDNT------ 227
             KE      L+RG  P    TS+G   Y++ LN   +   + +  +P  T+++      
Sbjct: 49  NLKEIDSPLQLWRGTLPSALRTSIGSALYLSCLNLMRSSLAKRRNAVPSLTNDSNIVYNK 108

Query: 228 ------LANFYKLSIGALSGGVAQTVTYPFDLLRRRFQVLAMGGNELGFRYKSVMDALIT 281
                 L  +  L  GA + G+   +T P  +++ R++          + Y S+ +A+  
Sbjct: 109 SSSLPRLTMYENLLTGAFARGLVGYITMPITVIKVRYESTL-------YNYSSLKEAITH 161

Query: 282 IGKTEGFRGYYKGLTANLFKVIPSTAVSWLVYEVVCDLM 320
           I   EG  G+++G  A   +  P   +  L+YE    L+
Sbjct: 162 IYTKEGLFGFFRGFGATCLRDAPYAGLYVLLYEKSKQLL 200

>Sklu_2117.2 YDL198C, Contig c2117 3737-4633
          Length = 298

 Score = 43.1 bits (100), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 44/181 (24%), Positives = 77/181 (42%), Gaps = 25/181 (13%)

Query: 35  VSRTVVSPFERVKILLQVQNSTTAYNQGIVGAVRQVYREEGTPGLFRGNGLNCIRIFPYS 94
           +   V+ P + +KI  Q  N      +G V    ++ ++EG  GL+RG G    R  P S
Sbjct: 130 IGEIVLLPLDVLKIKRQT-NPEAFKGRGFV----KILKDEGL-GLYRGWGWTAARNAPGS 183

Query: 95  AVQFVVYEACKKHFFHVDGSKGREQLQNWQRLFSGALCGG-CSVLATYPLDLVRTRLSIQ 153
              F      K++     G K   Q   W + F  ++ G   S++ + PLD+++TR+   
Sbjct: 184 FALFGGNAFAKEYIL---GLKDYSQ-ATWSQNFVSSIVGASASLIISAPLDVIKTRI--- 236

Query: 154 TANLTKLSKSRAHNISKPPGVWDLLCRTYKEEGGIKGLYRGVWPTSLGVVPYVALNFAVY 213
                     +  N   P   + ++  T K E G    ++G+ P  L   P +  +FA+ 
Sbjct: 237 ----------QNKNFENPESGFTIVKNTLKNE-GFSAFFKGLTPKLLTTGPKLVFSFALA 285

Query: 214 E 214
           +
Sbjct: 286 Q 286

 Score = 35.8 bits (81), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 37/141 (26%), Positives = 60/141 (42%), Gaps = 9/141 (6%)

Query: 178 LCRTYKEEGGIKGLYRGVWPTSLGVVPYVALNFAVYEQFKEFMPEGTDNTLANFYKLSIG 237
             +  K+EG   GLYRG   T+    P     F      KE++    D + A + +  + 
Sbjct: 157 FVKILKDEG--LGLYRGWGWTAARNAPGSFALFGGNAFAKEYILGLKDYSQATWSQNFVS 214

Query: 238 ALSGGVAQ-TVTYPFDLLRRRFQVLAMGGNELGFRYKSVMDALITIGKTEGFRGYYKGLT 296
           ++ G  A   ++ P D+++ R Q       E GF    V + L    K EGF  ++KGLT
Sbjct: 215 SIVGASASLIISAPLDVIKTRIQNKNFENPESGFTI--VKNTL----KNEGFSAFFKGLT 268

Query: 297 ANLFKVIPSTAVSWLVYEVVC 317
             L    P    S+ + + + 
Sbjct: 269 PKLLTTGPKLVFSFALAQTLI 289

>YFR045W (YFR045W) [1727] chr6 (242129..242986) Member of the
           mitochondrial carrier family (MCF) family of membrane
           transporters [858 bp, 285 aa]
          Length = 285

 Score = 42.4 bits (98), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 66/296 (22%), Positives = 118/296 (39%), Gaps = 37/296 (12%)

Query: 42  PFERVKILLQVQNSTTAYNQGIVGAVRQVYREEGTPGLFRGNGLNCIRIFPYSAVQFVVY 101
           PFE +K  LQ+Q   TA+ + I+  ++           F G     +  F  + ++FV +
Sbjct: 4   PFEYLKTGLQLQPKGTAF-EIILPQIK---------SYFVGCSALNVAAFGKTILRFVTF 53

Query: 102 EA-CKKHFFHVDGSKGREQLQNWQRLFSGALCGGCSVLATYPLDLVRTRLSIQTANL--T 158
           +  C     ++D +   ++L  +  L +G L G    L   P + ++T L IQ+A +   
Sbjct: 54  DKLCHSLNNNIDNNDNFQRLTGYNLLIAGTLTGIVESLFIIPFENIKTTL-IQSAMIDHK 112

Query: 159 KLSKSRA--------HNI---SKPPGVWDLLCRTYK---EEGGIKGLYRGVWPTSLGVVP 204
           KL K++         H +   S P    + L    K   +  G     +G   T    + 
Sbjct: 113 KLEKNQPVVNAKATFHKVATKSTPVARIEKLLPAVKHMYQTRGPAAFVQGTTATIFRQIA 172

Query: 205 YVALNFAVYEQFKEFMPEGTDNTLANFYKLSIGALSGGVAQTVTYPFDLLRRRFQVLAMG 264
             ++ F  Y  FK  +    D   +    +  G  +      +T P D+++ R     M 
Sbjct: 173 NTSIQFTAYTAFKRLLQARNDKASS----VITGLATSFTLVAMTQPIDVVKTR-----MM 223

Query: 265 GNELGFRYKSVMDALITIGKTEGFRGYYKGLTANLFKVIPSTAVSWLVYEVVCDLM 320
                  YK+ ++ +  I   EG   ++KG      KV  S  +++ VYE V  L+
Sbjct: 224 SQNAKTEYKNTLNCMYRIFVQEGMATFWKGSIFRFMKVGISGGLTFTVYEQVSLLL 279

>CAGL0B03883g 383602..384522 weakly similar to sp|P32331
           Saccharomyces cerevisiae YPR058w YMC1 or sp|P38087
           Saccharomyces cerevisiae YBR104w YMC2, hypothetical
           start
          Length = 306

 Score = 42.4 bits (98), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 25/80 (31%), Positives = 37/80 (46%), Gaps = 1/80 (1%)

Query: 224 TDNTLANFYKLSIGALSGGVAQTVTYPFDLLRRRFQVLAMGGNELGFRYKSVMDALITIG 283
           ++ T +       G  SG    TV +PFD ++ R Q   +G    G ++K  +D +    
Sbjct: 3   SEETYSRVMGFVAGMFSGVAKNTVGHPFDTVKVRLQTSQVGSGA-GIQFKGPLDCVYKTL 61

Query: 284 KTEGFRGYYKGLTANLFKVI 303
           K +G RG Y G T  LF  I
Sbjct: 62  KNQGIRGLYLGFTPPLFGWI 81

 Score = 40.0 bits (92), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 60/292 (20%), Positives = 118/292 (40%), Gaps = 32/292 (10%)

Query: 38  TVVSPFERVKILLQVQNSTTAYN---QGIVGAVRQVYREEGTPGLFRGNGLNCIRIFPYS 94
           TV  PF+ VK+ LQ     +      +G +  V +  + +G  GL+ G       +F + 
Sbjct: 25  TVGHPFDTVKVRLQTSQVGSGAGIQFKGPLDCVYKTLKNQGIRGLYLGF---TPPLFGWI 81

Query: 95  AVQFVVYEACKKH--FFHVDGSKGREQLQNWQRLFSGALCGGCSVLATYPLDLVRTRLSI 152
            +   +  +   +    H       ++L     + SG + G        P++L + +L +
Sbjct: 82  MMDSALLGSLHNYRMLLHKYVYPEHDKLPLSGCIISGVMAGWTVSFIAAPVELAKAKLQV 141

Query: 153 QTANLTKLSKSRAHNISKPPGVWDLLCRTYKEE-------GGIKGLYRGVWPTSLGVVPY 205
           Q    T          +K  G  D++ + +K+        GG++ LY+G+  T +    +
Sbjct: 142 QYDAKT----------TKYTGPIDVVQKVFKQGMATNGILGGVRSLYKGLISTLIFRSNF 191

Query: 206 VALNFAVYEQFKEFMPEGTDNTLANFYKLSIGALSGGVA-QTVTYPFDLLRRRFQVLAMG 264
           V   +  YE   ++  + T N  A       G LS      T  YP D++++    + + 
Sbjct: 192 V-FWWGSYELITQWFQKNT-NLSAPAINFWAGGLSASFGFWTSAYPSDVVKQ----VVLC 245

Query: 265 GNELGFRYKSVMDALITIGKTEGFRGYYKGLTANLFKVIPSTAVSWLVYEVV 316
            ++    +KS   A+  I +  G  G++KG   +  +  P+ A +   +E V
Sbjct: 246 NDKYDGSFKSWRTAVSDIYRQRGIHGFFKGFLPSFLRSFPANAAALAAFEFV 297

>KLLA0F13464g 1246646..1247548 highly similar to sp|P38988
           Saccharomyces cerevisiae YDL198c YHM1 member of the
           mitochondrial carrier family (MCF), start by similarity
          Length = 300

 Score = 42.0 bits (97), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 43/181 (23%), Positives = 78/181 (43%), Gaps = 25/181 (13%)

Query: 35  VSRTVVSPFERVKILLQVQNSTTAYNQGIVGAVRQVYREEGTPGLFRGNGLNCIRIFPYS 94
           +   V+ P + +KI  Q  N  +   +G +    ++ ++EG  GL+RG G    R  P S
Sbjct: 131 IGEIVLLPLDVLKIKRQT-NPESFKGRGFL----KIIKDEGF-GLYRGWGWTAARNAPGS 184

Query: 95  AVQFVVYEACKKHFFHVDGSKGREQLQNWQRLFSGALCGG-CSVLATYPLDLVRTRLSIQ 153
              F      K++     G K   Q   W + F  ++ G   S++ + PLD+++TR+   
Sbjct: 185 FALFGGNAFAKEYIL---GLKDYGQ-ATWSQNFVSSIVGASASLIVSAPLDVIKTRI--- 237

Query: 154 TANLTKLSKSRAHNISKPPGVWDLLCRTYKEEGGIKGLYRGVWPTSLGVVPYVALNFAVY 213
                     +  N   P   + ++  T K E G    ++G+ P  L   P +  +FA+ 
Sbjct: 238 ----------QNRNFDNPESGFKIIKNTLKNE-GFTAFFKGLTPKLLTTGPKLVFSFALA 286

Query: 214 E 214
           +
Sbjct: 287 Q 287

 Score = 36.2 bits (82), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 38/145 (26%), Positives = 61/145 (42%), Gaps = 9/145 (6%)

Query: 178 LCRTYKEEGGIKGLYRGVWPTSLGVVPYVALNFAVYEQFKEFMPEGTDNTLANFYKLSIG 237
             +  K+EG   GLYRG   T+    P     F      KE++    D   A + +  + 
Sbjct: 158 FLKIIKDEG--FGLYRGWGWTAARNAPGSFALFGGNAFAKEYILGLKDYGQATWSQNFVS 215

Query: 238 ALSGGVAQ-TVTYPFDLLRRRFQVLAMGGNELGFRYKSVMDALITIGKTEGFRGYYKGLT 296
           ++ G  A   V+ P D+++ R Q       E GF  K + + L    K EGF  ++KGLT
Sbjct: 216 SIVGASASLIVSAPLDVIKTRIQNRNFDNPESGF--KIIKNTL----KNEGFTAFFKGLT 269

Query: 297 ANLFKVIPSTAVSWLVYEVVCDLMH 321
             L    P    S+ + + +  +  
Sbjct: 270 PKLLTTGPKLVFSFALAQTLIPIFD 294

>AFR542W [3734] [Homologous to ScYMR241W (YHM2) - SH]
           complement(1408478..1409410) [933 bp, 310 aa]
          Length = 310

 Score = 41.6 bits (96), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 34/139 (24%), Positives = 65/139 (46%), Gaps = 18/139 (12%)

Query: 68  RQVYREEGTPGLFRGNGLNCIRIFPYSAVQFVVYEACKKHFFHVDGSKGREQLQNWQRLF 127
           +Q++  EG  G+ +G     IR       +F +    +     V   +  E+L   +++ 
Sbjct: 158 KQIFAAEGLRGINKGVNAVAIRQMTNWGSRFGLSRLVEDGIRRVTHKRSDEKLSAMEKIV 217

Query: 128 SGALCGGCSVLATYPLDLVRTRLSIQTANLTKLSKSRAHNISKPPGVWDLLCRTYK---E 184
           + AL GG S     P++++R  +           +SR ++ ++P  +   + +T++   E
Sbjct: 218 ASALGGGLSAW-NQPIEVIRVEM-----------QSRTNDPNRPKNL--TVGKTFRYIYE 263

Query: 185 EGGIKGLYRGVWP-TSLGV 202
             G++GLYRGV P   LGV
Sbjct: 264 NNGLRGLYRGVTPRIGLGV 282

 Score = 28.9 bits (63), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 33/116 (28%), Positives = 48/116 (41%), Gaps = 8/116 (6%)

Query: 186 GGIKGLYRGV--WPTSLGVVPYVALNFAVYEQFKEFMPEGTDNTLANFYKLSIGALSGGV 243
           GG+ G Y+G+  W           L F   E   +F   G    L+NF    +G +SGGV
Sbjct: 64  GGVFGFYQGLIPWAWIEASTKGAVLLFVSAEAEYQFRRLG----LSNFGAGILGGVSGGV 119

Query: 244 AQT-VTYPFDLLRRRFQVL-AMGGNELGFRYKSVMDALITIGKTEGFRGYYKGLTA 297
           AQ  +T  F    +  ++  +   +  G    S +     I   EG RG  KG+ A
Sbjct: 120 AQAYLTMGFCTCMKTVEITRSKAASAPGVPVPSSLQVFKQIFAAEGLRGINKGVNA 175

>Scas_705.9
          Length = 323

 Score = 41.6 bits (96), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 49/275 (17%), Positives = 107/275 (38%), Gaps = 35/275 (12%)

Query: 61  QGIVGAVRQVYREEGTPGLFRGNGLNCIRIFPYSAVQFVVYEACKKHFFHVD---GSKGR 117
           + ++  + +++R+ G  GL++G   +    F  S   F  Y   ++ +F +     ++ R
Sbjct: 54  ENVIRCLIRIFRKRGLRGLYQGMSTSVFSKFVQSFCYFFWYSFLRRKYFSLKLLRNTQAR 113

Query: 118 --EQLQNWQRLFSGALCGGCSVLATYPLDLVRTRLSIQTANLTKLSKSRAHNISKPPGVW 175
               +   + L  G      + +   P++++             L+K +  +       +
Sbjct: 114 PINSISTVEELIVGVGAAALTQVVNNPIEVI-------------LTKQQTTDDKDNVDFY 160

Query: 176 DLLCRTYKEEGGIKGLYRGVWPTSLGVVPYVALNFAVYEQFKEFMPEGTDNTLANF---- 231
            +L + Y E  G    Y   +  SL +    ++ FA Y++FK+ + +   N+  ++    
Sbjct: 161 SVLKQIYVESNGKLSSYWKGFKVSLILTVNPSITFAAYQRFKDILLKQVSNSEKSYSGQL 220

Query: 232 ---YKLSIGALSGGVAQTVTYPFDLLRRRFQVLAMGGNELGFRYKSVMDALITIGKTEGF 288
                  +GAL+  ++  +T P  + +   Q           ++K   + L  + K EG 
Sbjct: 221 TVNQNFILGALAKIISTIITQPLIVAKVSLQ-------RSNSKFKHFEEVLRYLYKEEGV 273

Query: 289 RGYYKGLTANLFKVIPSTAVSWLVYEVVCDLMHVW 323
              +KG+   L K      V  LV+    +L   W
Sbjct: 274 LALWKGVGPQLTK---GVLVQGLVFAFKGELTKSW 305

 Score = 37.7 bits (86), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 22/81 (27%), Positives = 40/81 (49%), Gaps = 8/81 (9%)

Query: 228 LANFYKLSIGALSGGVAQTVTYPFDLLRRRFQ--VLAMGGNELG------FRYKSVMDAL 279
           ++N      GA++  +A  + YP D+ +   Q    A   +EL        R ++V+  L
Sbjct: 1   MSNLESAITGAIASTMANVIVYPLDVAKTVIQSETKAKETDELSEKDKRILRQENVIRCL 60

Query: 280 ITIGKTEGFRGYYKGLTANLF 300
           I I +  G RG Y+G++ ++F
Sbjct: 61  IRIFRKRGLRGLYQGMSTSVF 81

 Score = 34.3 bits (77), Expect = 0.095,   Method: Compositional matrix adjust.
 Identities = 42/214 (19%), Positives = 90/214 (42%), Gaps = 22/214 (10%)

Query: 120 LQNWQRLFSGALCGGCSVLATYPLDLVRTRLSIQT-ANLTKLSKSRAHNISKPPGVWDLL 178
           + N +   +GA+    + +  YPLD+ +T +  +T A  T     +   I +   V   L
Sbjct: 1   MSNLESAITGAIASTMANVIVYPLDVAKTVIQSETKAKETDELSEKDKRILRQENVIRCL 60

Query: 179 CRTYKEEGGIKGLYRGVWPTSLGVVPYVALNFAVY--------EQFKEFMPEGTD----N 226
            R +++  G++GLY+G+   S  V      +F  +        + F   +   T     N
Sbjct: 61  IRIFRKR-GLRGLYQGM---STSVFSKFVQSFCYFFWYSFLRRKYFSLKLLRNTQARPIN 116

Query: 227 TLANFYKLSIGALSGGVAQTVTYPFDLLRRRFQVLAMGGNELGFRYKSVMDALITIGKTE 286
           +++   +L +G  +  + Q V  P +++  + Q      N     + SV+   I +    
Sbjct: 117 SISTVEELIVGVGAAALTQVVNNPIEVILTKQQTTDDKDN---VDFYSVLKQ-IYVESNG 172

Query: 287 GFRGYYKGLTANLFKVIPSTAVSWLVYEVVCDLM 320
               Y+KG   +L   + + ++++  Y+   D++
Sbjct: 173 KLSSYWKGFKVSLILTV-NPSITFAAYQRFKDIL 205

>Kwal_27.11626
          Length = 299

 Score = 40.8 bits (94), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 40/181 (22%), Positives = 77/181 (42%), Gaps = 25/181 (13%)

Query: 35  VSRTVVSPFERVKILLQVQNSTTAYNQGIVGAVRQVYREEGTPGLFRGNGLNCIRIFPYS 94
           +   V+ P + +KI  Q  N  +   +G +    ++ ++EG  GL+RG G    R  P S
Sbjct: 130 IGEIVLLPLDVLKIKRQT-NPESFKGRGFI----KILKDEGF-GLYRGWGWTAARNAPGS 183

Query: 95  AVQFVVYEACKKHFFHVDGSKGREQLQNWQRLFSGALCGG-CSVLATYPLDLVRTRLSIQ 153
              F      K++   +           W + F  ++ G   S++ + PLD+++TR+   
Sbjct: 184 FALFGGNAFAKEYILGLKDYSS----ATWSQNFVSSIVGASASLIVSAPLDVIKTRI--- 236

Query: 154 TANLTKLSKSRAHNISKPPGVWDLLCRTYKEEGGIKGLYRGVWPTSLGVVPYVALNFAVY 213
                     +  +   P   + ++  T K E GI   ++G+ P  L   P +  +FA+ 
Sbjct: 237 ----------QNRHFDNPESGFRIVQNTLKNE-GITAFFKGLTPKLLTTGPKLVFSFALA 285

Query: 214 E 214
           +
Sbjct: 286 Q 286

 Score = 36.2 bits (82), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 38/141 (26%), Positives = 60/141 (42%), Gaps = 9/141 (6%)

Query: 178 LCRTYKEEGGIKGLYRGVWPTSLGVVPYVALNFAVYEQFKEFMPEGTDNTLANFYKLSIG 237
             +  K+EG   GLYRG   T+    P     F      KE++    D + A + +  + 
Sbjct: 157 FIKILKDEG--FGLYRGWGWTAARNAPGSFALFGGNAFAKEYILGLKDYSSATWSQNFVS 214

Query: 238 ALSGGVAQ-TVTYPFDLLRRRFQVLAMGGNELGFRYKSVMDALITIGKTEGFRGYYKGLT 296
           ++ G  A   V+ P D+++ R Q       E GFR   V + L    K EG   ++KGLT
Sbjct: 215 SIVGASASLIVSAPLDVIKTRIQNRHFDNPESGFRI--VQNTL----KNEGITAFFKGLT 268

Query: 297 ANLFKVIPSTAVSWLVYEVVC 317
             L    P    S+ + + + 
Sbjct: 269 PKLLTTGPKLVFSFALAQSLI 289

>CAGL0K07436g complement(734496..735419) highly similar to sp|Q04013
           Saccharomyces cerevisiae YMR241w, hypothetical start
          Length = 307

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 30/134 (22%), Positives = 64/134 (47%), Gaps = 18/134 (13%)

Query: 68  RQVYREEGTPGLFRGNGLNCIRIFPYSAVQFVVYEACKKHFFHVDGSKGRE-QLQNWQRL 126
           + +Y++EG  G+ +G     IR       +F +    +     + G  G++ +L   +++
Sbjct: 153 KSIYKKEGIRGINKGVNAVAIRQMTNWGSRFGLSRLVEDGIRKLTGKTGKDDKLTALEKI 212

Query: 127 FSGALCGGCSVLATYPLDLVRTRLSIQTANLTKLSKSRAHNISKPPGVWDLLCRTYK--- 183
            + A+ GG S     P++++R  +           +S+  + ++P  +   + +T+K   
Sbjct: 213 MASAIGGGLSAW-NQPIEVIRVEM-----------QSKKEDPNRPKNL--TVGKTFKYIY 258

Query: 184 EEGGIKGLYRGVWP 197
           +  G+KGLYRGV P
Sbjct: 259 QSNGLKGLYRGVTP 272

>YMR241W (YHM2) [4197] chr13 (751960..752904) Suppressor of abf1
           mutant that affects mitochondrial HMG-like DNA-binding
           protein, member of the mitochondrial carrier family
           (MCF) of membrane transporters [945 bp, 314 aa]
          Length = 314

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 38/165 (23%), Positives = 76/165 (46%), Gaps = 20/165 (12%)

Query: 68  RQVYREEGTPGLFRGNGLNCIRIFPYSAVQFVVYEACKKHFFHVDGSKGRE-QLQNWQRL 126
           + +Y++EG  G+ +G     IR       +F +    +     + G   ++ +L  ++++
Sbjct: 160 KNIYKKEGIRGINKGVNAVAIRQMTNWGSRFGLSRLVEDGIRKITGKTNKDDKLNPFEKI 219

Query: 127 FSGALCGGCSVLATYPLDLVRTRLSIQTANLTKLSKSRAHNISKPPGVWDLLCRTYK--- 183
            + AL GG S     P++++R  +           +S+  + ++P  +   + +T+K   
Sbjct: 220 GASALGGGLSAW-NQPIEVIRVEM-----------QSKKEDPNRPKNL--TVGKTFKYIY 265

Query: 184 EEGGIKGLYRGVWP-TSLGVVPYVALNFAVYEQFKEFMPEGTDNT 227
           +  G+KGLYRGV P   LG+   V +     +  KEF+   T  T
Sbjct: 266 QSNGLKGLYRGVTPRIGLGIWQTVFM-VGFGDMAKEFVARMTGET 309

>Kwal_34.15907
          Length = 312

 Score = 40.0 bits (92), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 38/139 (27%), Positives = 61/139 (43%), Gaps = 13/139 (9%)

Query: 66  AVRQVYREEGTPGLFRGNGLNCIRIFPYSAVQFVVYEACKKHFFHVDG-SKGREQLQNWQ 124
           A +++Y +EG  G+ +G     IR       +F +    ++      G +   ++L   +
Sbjct: 156 AFKEIYSKEGIKGINKGVNAVAIRQMTNWGSRFGLSRLVEQGIRDFTGKTNPDDKLTALE 215

Query: 125 RLFSGALCGGCSVLATYPLDLVRTRLSIQTANLTKLSKSRAHNISKPPGVWDLLCRTYKE 184
           ++F+ AL GG S     P++++R  +          SK    N  K   V       Y+ 
Sbjct: 216 KIFASALGGGLSAW-NQPIEVIRVEMQ---------SKKEDPNRPKKLTVGSAFKYIYQS 265

Query: 185 EGGIKGLYRGVWP-TSLGV 202
            G IKGLYRGV P   LGV
Sbjct: 266 SG-IKGLYRGVAPRIGLGV 283

 Score = 30.0 bits (66), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 44/163 (26%), Positives = 65/163 (39%), Gaps = 32/163 (19%)

Query: 142 PLDLVRTRLSIQTANLTKLSKSRAHNISKPPGVWDLLCRTYKEEGGIKGLYRGVWP---- 197
           PL++++T ++    NL    +S  H       VW          GG+ G Y+G+ P    
Sbjct: 38  PLEVIKTTMAANR-NLN-FGQSVKH-------VWS--------RGGVFGFYQGLIPWAWI 80

Query: 198 --TSLGVVPYVALNFAVYEQFKEFMPEGTDNTLANFYKLSIGALSGGVAQT-VTYPFDLL 254
             ++ G V       A Y QFK          L NF    +G +SGGVAQ  +T  F   
Sbjct: 81  EASTKGAVLLFVSAEAEY-QFKRL-------GLGNFGAGIMGGVSGGVAQAYLTMGFCTC 132

Query: 255 RRRFQVLAMGGNELGFRYKSVMDALITIGKTEGFRGYYKGLTA 297
            +  ++        G   +S   A   I   EG +G  KG+ A
Sbjct: 133 MKTVEITKAKSAVAGAIPQSSWSAFKEIYSKEGIKGINKGVNA 175

>Scas_613.24
          Length = 177

 Score = 38.9 bits (89), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 47/190 (24%), Positives = 75/190 (39%), Gaps = 37/190 (19%)

Query: 125 RLFSGALCGGCSVLATYPLDLVRTRLSIQTANLTKLSKSRAHNISKPPGVWDLLCRTYKE 184
            L SG + G  S +   PLDL++TR+  Q    T  S  +  +I  P   W         
Sbjct: 11  HLVSGFIGGLSSAVTLQPLDLLKTRIQ-QHKGATLWSAIK--DIKDPIQFW--------- 58

Query: 185 EGGIKGLYRGVWP----TSLGVVPYVALNFAVYEQFKEFMPEGTDNT------LANFYKL 234
                   RG  P    TS+G   Y++    +  Q          +       L  +  L
Sbjct: 59  --------RGTLPSALRTSIGSALYLSCLNIMRTQLVHGKKGSAASKSSSLPQLTMYENL 110

Query: 235 SIGALSGGVAQTVTYPFDLLRRRFQVLAMGGNELGFRYKSVMDALITIGKTEGFRGYYKG 294
             GA++ G+   +T P  +L+ R++          + YKS+ +A+  I K EG  G++KG
Sbjct: 111 LTGAMARGLVGYITMPITILKVRYE-------STYYSYKSMNEAIKDIYKMEGISGFFKG 163

Query: 295 LTANLFKVIP 304
               +   IP
Sbjct: 164 FGPTVGIGIP 173

>CAGL0J09790g complement(957759..958661) highly similar to sp|P38988
           Saccharomyces cerevisiae YDL198c YHM1, start by
           similarity
          Length = 300

 Score = 38.9 bits (89), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 59/234 (25%), Positives = 93/234 (39%), Gaps = 27/234 (11%)

Query: 89  RIFPYSAVQFVVYEACKKHFF-HVDGSKGREQLQNWQRLFSGALCGGCSVLATYPLDLVR 147
           R++ Y    F   E   KHF    D + G +  +  +   +G+L G    +   PLD+  
Sbjct: 86  RVYKYGGQPFA-NEFLNKHFKKDFDSAFGDKTGKALRSATAGSLIG-IGEIVLLPLDV-- 141

Query: 148 TRLSIQTANLTKLSKSRAHNISKPPGVWDLLCRTYKEEGGIKGLYRGVWPTSLGVVPYVA 207
             L I+     +  K R               +  K+EG I  LYRG   T+    P   
Sbjct: 142 --LKIKRQTNPEAFKGRG------------FLKILKDEG-IFNLYRGWGWTAARNAPGSF 186

Query: 208 LNFAVYEQFKEFMPEGTDNTLANFYKLSIGALSGGVAQ-TVTYPFDLLRRRFQVLAMGGN 266
             F      KE++    D + A + +  I ++ G  A   V+ P D+++ R Q       
Sbjct: 187 ALFGGNAFAKEYILGLQDYSQATWSQNFISSIVGASASLIVSAPLDVIKTRIQNRNFDNP 246

Query: 267 ELGFRYKSVMDALITIGKTEGFRGYYKGLTANLFKVIPSTAVSWLVYEVVCDLM 320
           E GF  K V + L    K EGF  ++KGLT  L    P    S+ + + +  + 
Sbjct: 247 ESGF--KIVKNTL----KNEGFTAFFKGLTPKLLTTGPKLVFSFALAQSLIPMF 294

>Sklu_2194.3 YMR241W, Contig c2194 5245-6183
          Length = 312

 Score = 38.9 bits (89), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 37/165 (22%), Positives = 74/165 (44%), Gaps = 19/165 (11%)

Query: 43  FERVKILLQVQNSTTAYNQGIVGAVRQVYREEGTPGLFRGNGLNCIRIFPYSAVQFVVYE 102
            + V+I  +      A  Q   GA +++Y+++G  G+ +G     IR       +F    
Sbjct: 133 MKTVEITKKKSAGAGAIPQSSWGAFKEIYKKDGIKGINKGVNAVAIRQMTNWGSRFGFSR 192

Query: 103 ACKKHFFHVDG-SKGREQLQNWQRLFSGALCGGCSVLATYPLDLVRTRLSIQTANLTKLS 161
             ++   +  G +   ++L   +++ + A+ GG S     P++++R  +           
Sbjct: 193 LVEEGIRNATGKTNPDDKLTALEKIAASAIGGGLSAW-NQPIEVIRVEM----------- 240

Query: 162 KSRAHNISKPPGVWDLLCRTYK---EEGGIKGLYRGVWP-TSLGV 202
           +S+  + ++P  +   +   +K   +  GIKGLYRGV P   LGV
Sbjct: 241 QSKKEDPNRPKNL--TVSSAFKYIYQSSGIKGLYRGVAPRIGLGV 283

 Score = 30.0 bits (66), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 32/115 (27%), Positives = 48/115 (41%), Gaps = 7/115 (6%)

Query: 186 GGIKGLYRGV--WPTSLGVVPYVALNFAVYEQFKEFMPEGTDNTLANFYKLSIGALSGGV 243
           GG+ G Y+G+  W           L F   E   +F   G    L+NF    +G ++GGV
Sbjct: 65  GGVFGFYQGLIPWAWIEASTKGAVLLFVSAESEYQFKRMG----LSNFGSGIMGGVTGGV 120

Query: 244 AQT-VTYPFDLLRRRFQVLAMGGNELGFRYKSVMDALITIGKTEGFRGYYKGLTA 297
           AQ  +T  F    +  ++        G   +S   A   I K +G +G  KG+ A
Sbjct: 121 AQAYLTMGFCTCMKTVEITKKKSAGAGAIPQSSWGAFKEIYKKDGIKGINKGVNA 175

>AGR191W [4502] [Homologous to ScYDL198C (YHM1) - SH]
           complement(1114974..1115870) [897 bp, 298 aa]
          Length = 298

 Score = 38.1 bits (87), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 54/234 (23%), Positives = 92/234 (39%), Gaps = 28/234 (11%)

Query: 89  RIFPYSAVQFVVYEACKKHF-FHVDGSKGREQLQNWQRLFSGALCGGCSVLATYPLDLVR 147
           R++ Y    F   E   KHF    DG+ G +  +  +   +G+L G    +   PLD+++
Sbjct: 85  RVYKYGGQPFA-NEFLNKHFKADFDGAFGEKTGKALRSATAGSLIG-IGEIVLLPLDVLK 142

Query: 148 TRLSIQTANLTKLSKSRAHNISKPPGVWDLLCRTYKEEGGIKGLYRGVWPTSLGVVPYVA 207
            +      +     + R               R  ++EG   GLYRG   T+    P   
Sbjct: 143 IKRQTNPESF----RGRG------------FLRILRDEG--MGLYRGWGWTAARNAPGSF 184

Query: 208 LNFAVYEQFKEFMPEGTDNTLANFYKLSIGALSGGVAQ-TVTYPFDLLRRRFQVLAMGGN 266
             F      KE++    D + A + +  + ++ G  A   V+ P D+++ R Q       
Sbjct: 185 ALFGGNAFAKEYILGLKDYSQATWGQNFVSSIFGASASLIVSAPLDVIKTRIQSRNFESA 244

Query: 267 ELGFRYKSVMDALITIGKTEGFRGYYKGLTANLFKVIPSTAVSWLVYEVVCDLM 320
           E GF    V + L    K EG   ++KGLT  L    P    S+ + + +  + 
Sbjct: 245 ESGFTI--VKNTL----KNEGATAFFKGLTPKLLTTGPKLVFSFAIAQTLIPMF 292

>KLLA0F08547g 796328..797254 similar to sp|Q04013 Saccharomyces
           cerevisiae YMR241w YHM2 yeast suppressor gene of HM
           (mitochondrial histone) mutant (ABF2) singleton, start
           by similarity
          Length = 308

 Score = 37.4 bits (85), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 35/153 (22%), Positives = 68/153 (44%), Gaps = 26/153 (16%)

Query: 53  QNSTTAYNQGIVGAVRQVYREEGTPGLFRGNGLNCIRIFPYSAVQF----VVYEACKKHF 108
           +++     Q    A +++Y +EG  G+ +G     IR       +F    +V E  +K  
Sbjct: 139 KSAAAGAKQSSWAAFKEIYNKEGIRGINKGVNAVAIRQMTNWGSRFGFSRLVEEGLRKF- 197

Query: 109 FHVDGSKGREQLQNWQRLFSGALCGGCSVLATYPLDLVRTRLSIQTANLTKLSKSRAHNI 168
                +   ++L   +++F+ A+ GG S     P++++R  +           +S+ ++ 
Sbjct: 198 --TGKTNPDDKLTALEKIFASAIGGGLSAW-NQPIEVIRVEM-----------QSKTNDP 243

Query: 169 SKPPGVWDLLC----RTYKEEGGIKGLYRGVWP 197
           ++P    DL      R   +  G+KGLYRGV P
Sbjct: 244 NRPK---DLTVGKAFRYIYQSNGVKGLYRGVTP 273

 Score = 28.9 bits (63), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 34/115 (29%), Positives = 46/115 (40%), Gaps = 8/115 (6%)

Query: 186 GGIKGLYRGV--WPTSLGVVPYVALNFAVYEQFKEFMPEGTDNTLANFYKLSIGALSGGV 243
           GG+ G Y+G+  W           L F   E    F   G    L NF    +G +SGGV
Sbjct: 62  GGVFGFYQGLIPWAWIEASTKGAVLLFVSAEAEYHFKKLG----LNNFGAGIMGGVSGGV 117

Query: 244 AQT-VTYPFDLLRRRFQVLAMGGNELGFRYKSVMDALITIGKTEGFRGYYKGLTA 297
           AQ  +T  F    +  ++        G + +S   A   I   EG RG  KG+ A
Sbjct: 118 AQAYLTMGFCTCMKTVEITKHKSAAAGAK-QSSWAAFKEIYNKEGIRGINKGVNA 171

>Scas_671.1*
          Length = 123

 Score = 34.7 bits (78), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 30/127 (23%), Positives = 59/127 (46%), Gaps = 15/127 (11%)

Query: 190 GLYRGVWPTSLGVVP-YVALNFAVYEQFKEFMPEGTDNTLANFYKLSIGAL-SGGVAQTV 247
           GLY  ++  S  ++P ++  +   Y++  +F    + +T+ N    S+ A+ S  +A  +
Sbjct: 3   GLYVLLYEKSKQILPKFLPKSLIHYKEDMKF--STSTSTVVN----SVSAIASASLATAI 56

Query: 248 TYPFDLLRRRFQVLAMGGNELGFRYKSVMDALITIGKTEGFRGYYKGLTANLFKVIPSTA 307
           T PFD ++ R Q+           + +    L+ I K E     + GL+  L +   S  
Sbjct: 57  TAPFDTIKTRMQLKPKV-------FTNFFTTLVLITKNESIFQLFSGLSMRLTRKALSAG 109

Query: 308 VSWLVYE 314
           ++W +YE
Sbjct: 110 IAWGIYE 116

>Sklu_2436.18 YDR470C, Contig c2436 37947-39431 reverse complement
          Length = 494

 Score = 32.0 bits (71), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 28/91 (30%), Positives = 40/91 (43%), Gaps = 4/91 (4%)

Query: 67  VRQVYREEGTPGLFRGNGLNCIRIFPYSAVQFVVYEACKKHFFHVDGSKGREQLQNWQRL 126
           +  V  EEGT GL+R N    I  F  SA     +      F  +      + + +    
Sbjct: 237 MNSVMDEEGTRGLWRANNTTFIYNF-LSATLDAWFTGMLSPFLQIPDPYFIDIIHSPDPQ 295

Query: 127 FSGALCGGCSV---LATYPLDLVRTRLSIQT 154
            S AL    SV   +A  PLDL++TRL+I +
Sbjct: 296 KSIALTLAASVFTGIALLPLDLIKTRLTITS 326

>AER193W [2695] [Homologous to ScYCR009C (RVS161) - SH]
           complement(999903..1000700) [798 bp, 265 aa]
          Length = 265

 Score = 31.6 bits (70), Expect = 0.71,   Method: Compositional matrix adjust.
 Identities = 15/45 (33%), Positives = 24/45 (53%)

Query: 242 GVAQTVTYPFDLLRRRFQVLAMGGNELGFRYKSVMDALITIGKTE 286
            V +TV   +DL  RR++VL   G EL    K  +D+L  +  ++
Sbjct: 21  NVDKTVDKDYDLEERRYRVLERAGRELQKEAKGYLDSLRAVTASQ 65

>Sklu_2127.4 , Contig c2127 6322-7293
          Length = 323

 Score = 30.4 bits (67), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 17/74 (22%), Positives = 36/74 (48%), Gaps = 3/74 (4%)

Query: 244 AQTVTYPFDLLRRRFQVLAMGGNELGFRYKSVMDALITIGKTEGFRGYYKGLTANLFKVI 303
           +  +TYP   +  + Q     GN+   + KS ++ +  I + +G  G+Y GL + ++ + 
Sbjct: 27  SMALTYPLVTITTKLQT---QGNDENNQVKSKLETIKEIYRKDGLLGFYAGLESAIYGMA 83

Query: 304 PSTAVSWLVYEVVC 317
            +  V +  YE+  
Sbjct: 84  LTNFVYYYFYELTS 97

 Score = 30.0 bits (66), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 43/193 (22%), Positives = 73/193 (37%), Gaps = 29/193 (15%)

Query: 136 SVLATYPLDLVRTRLSIQTANLTKLSKSRAHNISKPPGVWDLLCRTYKEEGGIKGLYRGV 195
           S+  TYPL  + T+L  Q  +     KS+   I +           Y+++ G+ G Y G+
Sbjct: 27  SMALTYPLVTITTKLQTQGNDENNQVKSKLETIKE----------IYRKD-GLLGFYAGL 75

Query: 196 WPTSLGVVPYVALNFAVYEQFKEFMPEGT-----DNTLANFYKLSIGALSGGVAQTVTYP 250
                G    +AL   VY  F E              L     +  G ++G V    + P
Sbjct: 76  ESAIYG----MALTNFVYYYFYELTSRNVLKVRKHKKLNTLESMLTGCVAGSVTAIASNP 131

Query: 251 FDLLRRRFQVLAMGGNELGFRYKSVMDALITIGKTEGFRGYYKGLTANLFKVIPSTAVSW 310
             +   R  V            K+ +  +I I K +  +  + GL   L  V+ +  V +
Sbjct: 132 IWVANTRMTVTK--------SEKTALATIIEIVKKDSAKTLFNGLKPALVLVM-NPIVQY 182

Query: 311 LVYEVVCDLMHVW 323
            V+E + +L+  W
Sbjct: 183 TVFEQLKNLVLAW 195

>Scas_560.11*
          Length = 753

 Score = 30.0 bits (66), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 21/67 (31%), Positives = 34/67 (50%), Gaps = 12/67 (17%)

Query: 195 VWPTSLGVVPYVALNFAVYEQFKEFMPEGTDNTL--ANFYKLSIGALSGGVAQTVTYPFD 252
           +  T +GV P+  L+FA +         GTDN L  +N YK+ +  L G +  T +Y F 
Sbjct: 557 IEATKVGVYPF-GLDFAWH---------GTDNGLLFSNSYKMKLSILMGFIHMTYSYMFS 606

Query: 253 LLRRRFQ 259
            +  +F+
Sbjct: 607 YINYKFR 613

>KLLA0F26477g complement(2453526..2456141) similar to sp|P37296
           Saccharomyces cerevisiae YMR054w STV1 H+-ATPase V0
           domain 102 KD subunit, not vacuolar, start by similarity
          Length = 871

 Score = 30.0 bits (66), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 34/64 (53%), Gaps = 12/64 (18%)

Query: 198 TSLGVVPYVALNFAVYEQFKEFMPEGTDNTL--ANFYKLSIGALSGGVAQTVTYPFDLLR 255
           T +GV P+  L++A +         GT+N L  +N YK+ +  L G +  T ++ F L+ 
Sbjct: 545 TQVGVYPF-GLDYAWH---------GTENALLFSNSYKMKLSILMGFIHMTYSFMFSLVN 594

Query: 256 RRFQ 259
            RF+
Sbjct: 595 YRFK 598

>Scas_433.1
          Length = 1167

 Score = 28.5 bits (62), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 39/152 (25%), Positives = 58/152 (38%), Gaps = 29/152 (19%)

Query: 173  GVWDLLCRTYKEEGGIKGLYRGVWPTSLGV-VPYVALNFAVYEQFKEFMPEGTDNTLANF 231
            GVWDL    Y+      G      P  LG+ +    L+FA    F      G  +++A F
Sbjct: 877  GVWDLFYEPYQ------GYMMNDRPQELGIHLAKGGLSFAKKTVF------GLSDSMAKF 924

Query: 232  YKLSIGALSGGVAQTVTYPFDLLRRRFQ--------VLAMGGNE----LGFRYKSVMDAL 279
                 G+++ G++ T    F   RR  Q        V A         LG  +  V    
Sbjct: 925  ----TGSVAKGLSVTQDSDFQKARRLQQRMNSTSRNVFATSAQSFASTLGSGFSGVALDP 980

Query: 280  ITIGKTEGFRGYYKGLTANLFKVIPSTAVSWL 311
                + EG  G++KGL   L  +   TA+ +L
Sbjct: 981  YKAAQKEGTSGFFKGLGKGLIGLPTKTAIGFL 1012

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.322    0.138    0.422 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 9,925,499
Number of extensions: 396571
Number of successful extensions: 2549
Number of sequences better than 10.0: 214
Number of HSP's gapped: 1405
Number of HSP's successfully gapped: 588
Length of query: 323
Length of database: 16,596,109
Length adjustment: 102
Effective length of query: 221
Effective length of database: 13,065,073
Effective search space: 2887381133
Effective search space used: 2887381133
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 61 (28.1 bits)