Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Sklu_2360.537237219900.0
Kwal_56.2307937237018420.0
Scas_661.2437237218040.0
CAGL0H10142g37237217630.0
KLLA0F18744g37237117630.0
YDR035W (ARO3)37037217190.0
ABL102C37337016230.0
Scas_597.1337235911571e-158
CAGL0C01573g35635811491e-157
YBR249C (ARO4)37035911481e-157
AFL047W36436011371e-156
Sklu_1187.136835411291e-154
KLLA0F06556g36435911221e-153
Kwal_14.155436435911091e-151
Scas_26.11831678971e-122
AFR270W381107910.003
Scas_706.2446039701.1
KLLA0D02398g1205100691.9
Scas_689.51294201672.7
Kwal_33.13646125353673.0
Scas_687.2486211663.2
Kwal_27.1276670786645.6
YCR033W (SNT1)122648646.7
CAGL0L08162g135642637.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Sklu_2360.5
         (372 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Sklu_2360.5 YDR035W, Contig c2360 14257-15375                         771   0.0  
Kwal_56.23079                                                         714   0.0  
Scas_661.24                                                           699   0.0  
CAGL0H10142g 989652..990770 highly similar to sp|P14843 Saccharo...   683   0.0  
KLLA0F18744g complement(1723008..1724126) highly similar to sp|P...   683   0.0  
YDR035W (ARO3) [888] chr4 (521811..522923) 2-Dehydro-3-deoxyphos...   666   0.0  
ABL102C [490] [Homologous to ScYDR035W (ARO3) - SH] (206411..207...   629   0.0  
Scas_597.13                                                           450   e-158
CAGL0C01573g 170694..171764 highly similar to sp|P32449 Saccharo...   447   e-157
YBR249C (ARO4) [428] chr2 complement(716839..717951) 2-Dehydro-3...   446   e-157
AFL047W [3146] [Homologous to ScYBR249C (ARO4) - SH] complement(...   442   e-156
Sklu_1187.1 YBR249C, Contig c1187 489-1595                            439   e-154
KLLA0F06556g 633167..634261 highly similar to sp|P32449 Saccharo...   436   e-153
Kwal_14.1554                                                          431   e-151
Scas_26.1                                                             350   e-122
AFR270W [3462] [Homologous to NOHBY] complement(919886..921031) ...    40   0.003
Scas_706.24                                                            32   1.1  
KLLA0D02398g complement(202446..206063) similar to sp|P06105 Sac...    31   1.9  
Scas_689.5                                                             30   2.7  
Kwal_33.13646                                                          30   3.0  
Scas_687.2                                                             30   3.2  
Kwal_27.12766                                                          29   5.6  
YCR033W (SNT1) [567] chr3 (186484..190164) Component of Set3p co...    29   6.7  
CAGL0L08162g 899222..903292 similar to sp|P25357 Saccharomyces c...    29   7.9  

>Sklu_2360.5 YDR035W, Contig c2360 14257-15375
          Length = 372

 Score =  771 bits (1990), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 372/372 (100%), Positives = 372/372 (100%)

Query: 1   MFIKNDHVGDRTRLEDWRIKGYDPLTPPDLLQHEYPISEKGHKTIVDAREQVCEILNGKD 60
           MFIKNDHVGDRTRLEDWRIKGYDPLTPPDLLQHEYPISEKGHKTIVDAREQVCEILNGKD
Sbjct: 1   MFIKNDHVGDRTRLEDWRIKGYDPLTPPDLLQHEYPISEKGHKTIVDAREQVCEILNGKD 60

Query: 61  DRLVIVIGPCSIHDPKAAYEYADKLAALSEKLSKDLLIIMRAYLEKPRTTVGWKGLINDP 120
           DRLVIVIGPCSIHDPKAAYEYADKLAALSEKLSKDLLIIMRAYLEKPRTTVGWKGLINDP
Sbjct: 61  DRLVIVIGPCSIHDPKAAYEYADKLAALSEKLSKDLLIIMRAYLEKPRTTVGWKGLINDP 120

Query: 121 DIDNSFQINKGLRISREMFTNLVEKLPIAGEMLDTISPQFLSDCFSLGAIGARTTESQLH 180
           DIDNSFQINKGLRISREMFTNLVEKLPIAGEMLDTISPQFLSDCFSLGAIGARTTESQLH
Sbjct: 121 DIDNSFQINKGLRISREMFTNLVEKLPIAGEMLDTISPQFLSDCFSLGAIGARTTESQLH 180

Query: 181 RELASGLSFPIGFKNGTDGGLQVSIDAMRAAAHSHYFLSVTKPGITAIVGTEGNSDTFVI 240
           RELASGLSFPIGFKNGTDGGLQVSIDAMRAAAHSHYFLSVTKPGITAIVGTEGNSDTFVI
Sbjct: 181 RELASGLSFPIGFKNGTDGGLQVSIDAMRAAAHSHYFLSVTKPGITAIVGTEGNSDTFVI 240

Query: 241 LRGGKKGTNYDSANVKETQKELIKAKLADENGTQRRIMIDCSHGNSSKDFRNQPKVAQSI 300
           LRGGKKGTNYDSANVKETQKELIKAKLADENGTQRRIMIDCSHGNSSKDFRNQPKVAQSI
Sbjct: 241 LRGGKKGTNYDSANVKETQKELIKAKLADENGTQRRIMIDCSHGNSSKDFRNQPKVAQSI 300

Query: 301 YDQLTAGENAICGVMIESNLVEGRQDVPPEGGREGLKYGCSITDACIGWESTEQVLELLA 360
           YDQLTAGENAICGVMIESNLVEGRQDVPPEGGREGLKYGCSITDACIGWESTEQVLELLA
Sbjct: 301 YDQLTAGENAICGVMIESNLVEGRQDVPPEGGREGLKYGCSITDACIGWESTEQVLELLA 360

Query: 361 KGVQNRRATLKK 372
           KGVQNRRATLKK
Sbjct: 361 KGVQNRRATLKK 372

>Kwal_56.23079
          Length = 372

 Score =  714 bits (1842), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 338/370 (91%), Positives = 357/370 (96%)

Query: 1   MFIKNDHVGDRTRLEDWRIKGYDPLTPPDLLQHEYPISEKGHKTIVDAREQVCEILNGKD 60
           MFIKNDHVGDRTRLEDWRIKGYDPLTPPDLLQHE PIS KGHKTIVDAREQVC+ILNGKD
Sbjct: 1   MFIKNDHVGDRTRLEDWRIKGYDPLTPPDLLQHELPISAKGHKTIVDAREQVCDILNGKD 60

Query: 61  DRLVIVIGPCSIHDPKAAYEYADKLAALSEKLSKDLLIIMRAYLEKPRTTVGWKGLINDP 120
           DRLVIVIGPCSIHDPKAAYEY D+LAA S+K +KDLLIIMRAYLEKPRTTVGWKGLINDP
Sbjct: 61  DRLVIVIGPCSIHDPKAAYEYCDRLAAESKKHAKDLLIIMRAYLEKPRTTVGWKGLINDP 120

Query: 121 DIDNSFQINKGLRISREMFTNLVEKLPIAGEMLDTISPQFLSDCFSLGAIGARTTESQLH 180
           DIDNSFQINKGLRISRE+FTNLVEK+PIAGEMLDTISPQFLSDCFSLGAIGARTTESQLH
Sbjct: 121 DIDNSFQINKGLRISRELFTNLVEKMPIAGEMLDTISPQFLSDCFSLGAIGARTTESQLH 180

Query: 181 RELASGLSFPIGFKNGTDGGLQVSIDAMRAAAHSHYFLSVTKPGITAIVGTEGNSDTFVI 240
           RELASGLSFPIGFKNGTDGGLQVS+DAMRAAAHSHYFLSVTKPG+TAIVGTEGNSDTFVI
Sbjct: 181 RELASGLSFPIGFKNGTDGGLQVSVDAMRAAAHSHYFLSVTKPGVTAIVGTEGNSDTFVI 240

Query: 241 LRGGKKGTNYDSANVKETQKELIKAKLADENGTQRRIMIDCSHGNSSKDFRNQPKVAQSI 300
           LRGGK GTNYD+ NVK+TQ+EL+KAK+A+ENG  RRIMIDCSHGNSSKD+RNQPKVAQSI
Sbjct: 241 LRGGKTGTNYDAENVKKTQEELVKAKIAEENGKTRRIMIDCSHGNSSKDYRNQPKVAQSI 300

Query: 301 YDQLTAGENAICGVMIESNLVEGRQDVPPEGGREGLKYGCSITDACIGWESTEQVLELLA 360
           Y+QLT G+NAICGVMIESNLVEGRQDVP EGGREGLKYGCSITDACIGWE+TE+VL LLA
Sbjct: 301 YEQLTDGQNAICGVMIESNLVEGRQDVPAEGGREGLKYGCSITDACIGWETTEEVLALLA 360

Query: 361 KGVQNRRATL 370
           KGVQNRR TL
Sbjct: 361 KGVQNRRKTL 370

>Scas_661.24
          Length = 372

 Score =  699 bits (1804), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 333/372 (89%), Positives = 349/372 (93%)

Query: 1   MFIKNDHVGDRTRLEDWRIKGYDPLTPPDLLQHEYPISEKGHKTIVDAREQVCEILNGKD 60
           MFIKNDH GDRTRLEDWRIKGYDPLTPPDLLQHEYPISE+GHK IVDARE VC+ILNGKD
Sbjct: 1   MFIKNDHAGDRTRLEDWRIKGYDPLTPPDLLQHEYPISERGHKIIVDAREAVCDILNGKD 60

Query: 61  DRLVIVIGPCSIHDPKAAYEYADKLAALSEKLSKDLLIIMRAYLEKPRTTVGWKGLINDP 120
           DRLVIVIGPCSIHDPKAAYEYAD+LA ++  LSKDLLIIMRAYLEKPRTTVGWKGLINDP
Sbjct: 61  DRLVIVIGPCSIHDPKAAYEYADRLAKIAATLSKDLLIIMRAYLEKPRTTVGWKGLINDP 120

Query: 121 DIDNSFQINKGLRISREMFTNLVEKLPIAGEMLDTISPQFLSDCFSLGAIGARTTESQLH 180
           DIDNSFQINKGLRISREMFT LVEKLPIAGEMLDTISPQFLSDCFSLGAIGARTTESQLH
Sbjct: 121 DIDNSFQINKGLRISREMFTKLVEKLPIAGEMLDTISPQFLSDCFSLGAIGARTTESQLH 180

Query: 181 RELASGLSFPIGFKNGTDGGLQVSIDAMRAAAHSHYFLSVTKPGITAIVGTEGNSDTFVI 240
           RELASGLSFPIGFKNGTDGGLQVSIDAMRAAAH HYFLSVTKPG+TAIVGTEGN DTFVI
Sbjct: 181 RELASGLSFPIGFKNGTDGGLQVSIDAMRAAAHEHYFLSVTKPGVTAIVGTEGNKDTFVI 240

Query: 241 LRGGKKGTNYDSANVKETQKELIKAKLADENGTQRRIMIDCSHGNSSKDFRNQPKVAQSI 300
           LRGGK GTN+D+ +V+ T+KEL K  L D N TQRRIMIDCSHGNS+KD+RNQPKVAQSI
Sbjct: 241 LRGGKHGTNFDAESVQITKKELKKTNLIDANDTQRRIMIDCSHGNSNKDYRNQPKVAQSI 300

Query: 301 YDQLTAGENAICGVMIESNLVEGRQDVPPEGGREGLKYGCSITDACIGWESTEQVLELLA 360
           YDQLTAGENAICGVMIESNLVEGRQDVPPEGGR GLKYGCSITDACIGWESTE VL+ LA
Sbjct: 301 YDQLTAGENAICGVMIESNLVEGRQDVPPEGGRAGLKYGCSITDACIGWESTEDVLKQLA 360

Query: 361 KGVQNRRATLKK 372
           +GV+NRRA L K
Sbjct: 361 EGVRNRRAALSK 372

>CAGL0H10142g 989652..990770 highly similar to sp|P14843
           Saccharomyces cerevisiae YDR035w ARO3
           2-dehydro-3-deoxyphosphoheptonate aldolase, start by
           similarity
          Length = 372

 Score =  683 bits (1763), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 322/372 (86%), Positives = 348/372 (93%)

Query: 1   MFIKNDHVGDRTRLEDWRIKGYDPLTPPDLLQHEYPISEKGHKTIVDAREQVCEILNGKD 60
           MFIKND+ GDRTRLEDWRIKGYDPLTPPDLLQHEYPISEKG   I+ AR+ VC+ILNGKD
Sbjct: 1   MFIKNDYRGDRTRLEDWRIKGYDPLTPPDLLQHEYPISEKGAANILKARDSVCDILNGKD 60

Query: 61  DRLVIVIGPCSIHDPKAAYEYADKLAALSEKLSKDLLIIMRAYLEKPRTTVGWKGLINDP 120
           DR+VIVIGPCSIHDPKAAYEYADKLA ++EKLS DLLIIMRAYLEKPRTTVGWKGLINDP
Sbjct: 61  DRMVIVIGPCSIHDPKAAYEYADKLAVIAEKLSDDLLIIMRAYLEKPRTTVGWKGLINDP 120

Query: 121 DIDNSFQINKGLRISREMFTNLVEKLPIAGEMLDTISPQFLSDCFSLGAIGARTTESQLH 180
           DIDNSFQINKGLRISREMFT L+EKLPIAGEMLDTISPQFLSDCFSLGAIGARTTESQLH
Sbjct: 121 DIDNSFQINKGLRISREMFTKLIEKLPIAGEMLDTISPQFLSDCFSLGAIGARTTESQLH 180

Query: 181 RELASGLSFPIGFKNGTDGGLQVSIDAMRAAAHSHYFLSVTKPGITAIVGTEGNSDTFVI 240
           RELASGLSFPIGFKNGTDGGLQV+IDAMRAA+H HYFLSVTKPG+TAIVGTEGNSDTF+I
Sbjct: 181 RELASGLSFPIGFKNGTDGGLQVAIDAMRAASHEHYFLSVTKPGVTAIVGTEGNSDTFII 240

Query: 241 LRGGKKGTNYDSANVKETQKELIKAKLADENGTQRRIMIDCSHGNSSKDFRNQPKVAQSI 300
           LRGGK GTNYD+ NVK T+++L KAKL DE  + RRIMIDCSHGNS+KD+RNQPKVAQ I
Sbjct: 241 LRGGKHGTNYDAENVKSTKEQLRKAKLIDEADSTRRIMIDCSHGNSNKDYRNQPKVAQEI 300

Query: 301 YDQLTAGENAICGVMIESNLVEGRQDVPPEGGREGLKYGCSITDACIGWESTEQVLELLA 360
           Y+QL+AGEN +CGVMIESNLVEGRQDVPPEGGREGLKYGCSITDACIGW++TE VLELLA
Sbjct: 301 YNQLSAGENGLCGVMIESNLVEGRQDVPPEGGREGLKYGCSITDACIGWDTTESVLELLA 360

Query: 361 KGVQNRRATLKK 372
           +GV+NRR  L K
Sbjct: 361 EGVRNRRKHLSK 372

>KLLA0F18744g complement(1723008..1724126) highly similar to
           sp|P14843 Saccharomyces cerevisiae YDR035w ARO3
           2-dehydro-3-deoxyphosphoheptonate aldolase,
           phenylalanine-inhibited, start by similarity
          Length = 372

 Score =  683 bits (1763), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 320/371 (86%), Positives = 345/371 (92%)

Query: 1   MFIKNDHVGDRTRLEDWRIKGYDPLTPPDLLQHEYPISEKGHKTIVDAREQVCEILNGKD 60
           MFI NDH+GDR+ LEDWRIKGYDPLTPPDLLQHEYPI EK  K IV+ARE+VC+ILNGKD
Sbjct: 1   MFITNDHIGDRSSLEDWRIKGYDPLTPPDLLQHEYPIGEKAKKIIVEAREKVCDILNGKD 60

Query: 61  DRLVIVIGPCSIHDPKAAYEYADKLAALSEKLSKDLLIIMRAYLEKPRTTVGWKGLINDP 120
           DRLV+VIGPCSIHDPKAAYEYAD L  +S++LS DLLIIMRAYLEKPRTTVGWKGLINDP
Sbjct: 61  DRLVVVIGPCSIHDPKAAYEYADLLKKISDELSDDLLIIMRAYLEKPRTTVGWKGLINDP 120

Query: 121 DIDNSFQINKGLRISREMFTNLVEKLPIAGEMLDTISPQFLSDCFSLGAIGARTTESQLH 180
           DIDNSFQINKGLRISREMFT L EKLPIAGEMLDTISPQFLSDCFSLGAIGARTTESQLH
Sbjct: 121 DIDNSFQINKGLRISREMFTRLTEKLPIAGEMLDTISPQFLSDCFSLGAIGARTTESQLH 180

Query: 181 RELASGLSFPIGFKNGTDGGLQVSIDAMRAAAHSHYFLSVTKPGITAIVGTEGNSDTFVI 240
           RELASGLSFPIGFKNGTDGGLQV++DAMR+AAHSHYFLSVTKPG+TAIVGTEGN DTFVI
Sbjct: 181 RELASGLSFPIGFKNGTDGGLQVAVDAMRSAAHSHYFLSVTKPGVTAIVGTEGNEDTFVI 240

Query: 241 LRGGKKGTNYDSANVKETQKELIKAKLADENGTQRRIMIDCSHGNSSKDFRNQPKVAQSI 300
           LRGGK GTN+D+ NVK+TQ EL+KAK+AD  G QRRIM+DCSHGNS KDFRNQPKVAQS+
Sbjct: 241 LRGGKTGTNFDAENVKKTQAELVKAKVADAEGVQRRIMVDCSHGNSKKDFRNQPKVAQSL 300

Query: 301 YDQLTAGENAICGVMIESNLVEGRQDVPPEGGREGLKYGCSITDACIGWESTEQVLELLA 360
           Y+QL+AG+NAICGVMIESNLVEGRQDVPPEGGRE L YGCSITDACIGWE+TE VL LLA
Sbjct: 301 YEQLSAGQNAICGVMIESNLVEGRQDVPPEGGREKLIYGCSITDACIGWETTEDVLRLLA 360

Query: 361 KGVQNRRATLK 371
           KGV+NRRA  K
Sbjct: 361 KGVKNRRALSK 371

>YDR035W (ARO3) [888] chr4 (521811..522923)
           2-Dehydro-3-deoxyphosphoheptonate aldolase (DAHPS),
           inhibited by phenylalanine [1113 bp, 370 aa]
          Length = 370

 Score =  666 bits (1719), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 313/372 (84%), Positives = 345/372 (92%), Gaps = 2/372 (0%)

Query: 1   MFIKNDHVGDRTRLEDWRIKGYDPLTPPDLLQHEYPISEKGHKTIVDAREQVCEILNGKD 60
           MFIKNDH GDR RLEDWRIKGYDPLTPPDLLQHE+PIS KG + I+ AR+ VC+ILNGKD
Sbjct: 1   MFIKNDHAGDRKRLEDWRIKGYDPLTPPDLLQHEFPISAKGEENIIKARDSVCDILNGKD 60

Query: 61  DRLVIVIGPCSIHDPKAAYEYADKLAALSEKLSKDLLIIMRAYLEKPRTTVGWKGLINDP 120
           DRLVIVIGPCS+HDPKAAY+YAD+LA +SEKLSKDLLIIMRAYLEKPRTTVGWKGLINDP
Sbjct: 61  DRLVIVIGPCSLHDPKAAYDYADRLAKISEKLSKDLLIIMRAYLEKPRTTVGWKGLINDP 120

Query: 121 DIDNSFQINKGLRISREMFTNLVEKLPIAGEMLDTISPQFLSDCFSLGAIGARTTESQLH 180
           D++NSFQINKGLRISREMF  LVEKLPIAGEMLDTISPQFLSDCFSLGAIGARTTESQLH
Sbjct: 121 DMNNSFQINKGLRISREMFIKLVEKLPIAGEMLDTISPQFLSDCFSLGAIGARTTESQLH 180

Query: 181 RELASGLSFPIGFKNGTDGGLQVSIDAMRAAAHSHYFLSVTKPGITAIVGTEGNSDTFVI 240
           RELASGLSFPIGFKNGTDGGLQV+IDAMRAAAH HYFLSVTKPG+TAIVGTEGN DTF+I
Sbjct: 181 RELASGLSFPIGFKNGTDGGLQVAIDAMRAAAHEHYFLSVTKPGVTAIVGTEGNKDTFLI 240

Query: 241 LRGGKKGTNYDSANVKETQKELIKAKLADENGTQRRIMIDCSHGNSSKDFRNQPKVAQSI 300
           LRGGK GTN+D  +V+ T+K+L KA L D+  +Q+RIMIDCSHGNS+KDF+NQPKVA+ I
Sbjct: 241 LRGGKNGTNFDKESVQNTKKQLEKAGLTDD--SQKRIMIDCSHGNSNKDFKNQPKVAKCI 298

Query: 301 YDQLTAGENAICGVMIESNLVEGRQDVPPEGGREGLKYGCSITDACIGWESTEQVLELLA 360
           YDQLT GEN++CGVMIESN+ EGRQD+P EGGREGLKYGCS+TDACIGWESTEQVLELLA
Sbjct: 299 YDQLTEGENSLCGVMIESNINEGRQDIPKEGGREGLKYGCSVTDACIGWESTEQVLELLA 358

Query: 361 KGVQNRRATLKK 372
           +GV+NRR  LKK
Sbjct: 359 EGVRNRRKALKK 370

>ABL102C [490] [Homologous to ScYDR035W (ARO3) - SH]
           (206411..207532) [1122 bp, 373 aa]
          Length = 373

 Score =  629 bits (1623), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 289/370 (78%), Positives = 334/370 (90%)

Query: 1   MFIKNDHVGDRTRLEDWRIKGYDPLTPPDLLQHEYPISEKGHKTIVDAREQVCEILNGKD 60
           MFIKN+++GD++RLEDWRIKGYDPLTPP++LQHE P+S  G   IV ARE V ++L+G+D
Sbjct: 1   MFIKNEYIGDKSRLEDWRIKGYDPLTPPNVLQHELPVSANGRAIIVRAREGVVQVLSGRD 60

Query: 61  DRLVIVIGPCSIHDPKAAYEYADKLAALSEKLSKDLLIIMRAYLEKPRTTVGWKGLINDP 120
           DRL++V+GPCSIHDP+AA EYA +L+ ++ +L  +LL+IMRAYLEKPRTTVGWKGLINDP
Sbjct: 61  DRLLVVVGPCSIHDPEAALEYAQRLSEVASRLRGELLVIMRAYLEKPRTTVGWKGLINDP 120

Query: 121 DIDNSFQINKGLRISREMFTNLVEKLPIAGEMLDTISPQFLSDCFSLGAIGARTTESQLH 180
           DIDNSFQINKGLRISREM+T LVE +PIAGEMLDTISPQFLSDCFSLGAIGARTTESQLH
Sbjct: 121 DIDNSFQINKGLRISREMYTQLVEHIPIAGEMLDTISPQFLSDCFSLGAIGARTTESQLH 180

Query: 181 RELASGLSFPIGFKNGTDGGLQVSIDAMRAAAHSHYFLSVTKPGITAIVGTEGNSDTFVI 240
           RELASGLSFPIGFKNGTDG LQV+IDAMRAAAHSHYFLSVTKPG+TAIVGTEGN DTF+I
Sbjct: 181 RELASGLSFPIGFKNGTDGCLQVAIDAMRAAAHSHYFLSVTKPGVTAIVGTEGNEDTFII 240

Query: 241 LRGGKKGTNYDSANVKETQKELIKAKLADENGTQRRIMIDCSHGNSSKDFRNQPKVAQSI 300
           LRGGK GTNYD+A+V++ +++L+ AKL D  G QRRIMIDCSHGNS+KD+RNQPKVAQ I
Sbjct: 241 LRGGKDGTNYDAASVQQAKQDLVNAKLVDSAGVQRRIMIDCSHGNSNKDYRNQPKVAQDI 300

Query: 301 YDQLTAGENAICGVMIESNLVEGRQDVPPEGGREGLKYGCSITDACIGWESTEQVLELLA 360
           Y+QL+ GENAICGVMIESNLVEGRQD+P   GR GLKYGCSITDACIGW+ T +VLELLA
Sbjct: 301 YEQLSKGENAICGVMIESNLVEGRQDIPEGNGRVGLKYGCSITDACIGWDQTVEVLELLA 360

Query: 361 KGVQNRRATL 370
           KGV N+RA +
Sbjct: 361 KGVINKRAVM 370

>Scas_597.13
          Length = 372

 Score =  450 bits (1157), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 223/359 (62%), Positives = 276/359 (76%), Gaps = 10/359 (2%)

Query: 15  EDWRIKGYDPLTPPDLLQHEYPISEKGHKTIVDAREQVCEILNGKDDRLVIVIGPCSIHD 74
           ED RI GYDPL  P LLQ + P +EK  +T    R +  EI++G+DDR+++++GPCSIHD
Sbjct: 21  EDVRILGYDPLVSPALLQVQIPATEKCIETAKKGRRESIEIISGRDDRVLVIVGPCSIHD 80

Query: 75  PKAAYEYADKLAALSEKLSKDLLIIMRAYLEKPRTTVGWKGLINDPDIDNSFQINKGLRI 134
             AA EYA KL  L+++LS+DL++IMRAYLEKPRTTVGWKGLINDPD++N+F INKGL+ 
Sbjct: 81  LDAAQEYALKLKKLADELSQDLVVIMRAYLEKPRTTVGWKGLINDPDVNNTFNINKGLQS 140

Query: 135 SREMFTNLVE-KLPIAGEMLDTISPQFLSDCFSLGAIGARTTESQLHRELASGLSFPIGF 193
           +R++F NL    LPI  EMLDTISPQ+L+D  S GAIGARTTESQLHRELASGLSFPIGF
Sbjct: 141 ARQLFVNLTNIGLPIGSEMLDTISPQYLADLLSFGAIGARTTESQLHRELASGLSFPIGF 200

Query: 194 KNGTDGGLQVSIDAMRAAAHSHYFLSVTKPGITAIVGTEGNSDTFVILRGGKKGTNYDSA 253
           KNGTDG L V++DA +AA+HSH+F+ VTK G+ AI  T+GN   FVILRGGKKGTNYD+ 
Sbjct: 201 KNGTDGTLGVAVDACQAASHSHHFMGVTKHGVAAITTTKGNEHCFVILRGGKKGTNYDAK 260

Query: 254 NVKETQKELIKAKLADENGTQRRIMIDCSHGNSSKDFRNQPKVAQSIYDQLTAGENAICG 313
           +V E + +L     A  NG    +MID SHGNS+KDFRNQPKV  ++ +Q+  GENAI G
Sbjct: 261 SVAEAKAQL----PAGSNG----LMIDYSHGNSNKDFRNQPKVNDAVCEQIANGENAIIG 312

Query: 314 VMIESNLVEGRQDVPPEGGREGLKYGCSITDACIGWESTEQVLELLAKGVQNRRATLKK 372
           VMIESN+ EG Q +PPE G+ GLKYG SITDACI +E+TE VL+ LA  V+ RR   K+
Sbjct: 313 VMIESNINEGSQKIPPE-GKAGLKYGVSITDACISFETTEDVLKKLAAAVRQRREVNKQ 370

>CAGL0C01573g 170694..171764 highly similar to sp|P32449
           Saccharomyces cerevisiae YBR249c ARO4, start by
           similarity
          Length = 356

 Score =  447 bits (1149), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 220/358 (61%), Positives = 271/358 (75%), Gaps = 10/358 (2%)

Query: 15  EDWRIKGYDPLTPPDLLQHEYPISEKGHKTIVDAREQVCEILNGKDDRLVIVIGPCSIHD 74
           ED RI GYDPL  P LLQ + P +E   +T    R++  EI+ G+DDR+++++GPCS+HD
Sbjct: 8   EDVRILGYDPLVSPALLQVQVPATEVSIQTARRGRKESIEIITGRDDRVLVIVGPCSVHD 67

Query: 75  PKAAYEYADKLAALSEKLSKDLLIIMRAYLEKPRTTVGWKGLINDPDIDNSFQINKGLRI 134
             AA EYA +L  LS++L KDL I+MRAYLEKPRTTVGWKGLINDPD++N+F INKGL+ 
Sbjct: 68  LDAAQEYAQRLKKLSDELQKDLCIVMRAYLEKPRTTVGWKGLINDPDVNNTFNINKGLQS 127

Query: 135 SREMFTNLVEK-LPIAGEMLDTISPQFLSDCFSLGAIGARTTESQLHRELASGLSFPIGF 193
           +R++F NL    +PI  EMLDTISPQ+L+D  S GAIGARTTESQLHRELASGLSFPIGF
Sbjct: 128 ARQLFVNLTNTGVPIGSEMLDTISPQYLADLLSFGAIGARTTESQLHRELASGLSFPIGF 187

Query: 194 KNGTDGGLQVSIDAMRAAAHSHYFLSVTKPGITAIVGTEGNSDTFVILRGGKKGTNYDSA 253
           KNGTDG L V++DA +AA+HSH+F+ VTK G+ AI  T+GN   FVILRGGKKGTNYD+ 
Sbjct: 188 KNGTDGTLGVAVDACQAASHSHHFMGVTKHGVAAITTTKGNEHCFVILRGGKKGTNYDAK 247

Query: 254 NVKETQKELIKAKLADENGTQRRIMIDCSHGNSSKDFRNQPKVAQSIYDQLTAGENAICG 313
           +V E +K+L +      NG    +MID SHGNS+KDFRNQPKV  ++ +Q+  GE AI G
Sbjct: 248 SVAEAKKQLPEGA----NG----LMIDYSHGNSNKDFRNQPKVNDAVCEQIANGEKAIVG 299

Query: 314 VMIESNLVEGRQDVPPEGGREGLKYGCSITDACIGWESTEQVLELLAKGVQNRRATLK 371
           VMIESN+ EG Q +PPE G+ GLKYG SITDACI WE+TE VL  LA  V+ RR   K
Sbjct: 300 VMIESNINEGNQCIPPE-GKAGLKYGVSITDACISWETTEDVLRKLAAAVRQRREHYK 356

>YBR249C (ARO4) [428] chr2 complement(716839..717951)
           2-Dehydro-3-deoxyphosphoheptonate aldolase
           (3-deoxy-D-arabino-heptulosonate-7-phosphate synthase or
           DAHP synthase), inhibited by tyrosine [1113 bp, 370 aa]
          Length = 370

 Score =  446 bits (1148), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 223/359 (62%), Positives = 269/359 (74%), Gaps = 10/359 (2%)

Query: 15  EDWRIKGYDPLTPPDLLQHEYPISEKGHKTIVDAREQVCEILNGKDDRLVIVIGPCSIHD 74
           ED RI GYDPL  P LLQ + P +    +T    R +  +I+ GKDDR+++++GPCSIHD
Sbjct: 21  EDVRILGYDPLASPALLQVQIPATPTSLETAKRGRREAIDIITGKDDRVLVIVGPCSIHD 80

Query: 75  PKAAYEYADKLAALSEKLSKDLLIIMRAYLEKPRTTVGWKGLINDPDIDNSFQINKGLRI 134
            +AA EYA +L  LS++L  DL IIMRAYLEKPRTTVGWKGLINDPD++N+F INKGL+ 
Sbjct: 81  LEAAQEYALRLKKLSDELKGDLSIIMRAYLEKPRTTVGWKGLINDPDVNNTFNINKGLQS 140

Query: 135 SREMFTNLVE-KLPIAGEMLDTISPQFLSDCFSLGAIGARTTESQLHRELASGLSFPIGF 193
           +R++F NL    LPI  EMLDTISPQ+L+D  S GAIGARTTESQLHRELASGLSFP+GF
Sbjct: 141 ARQLFVNLTNIGLPIGSEMLDTISPQYLADLVSFGAIGARTTESQLHRELASGLSFPVGF 200

Query: 194 KNGTDGGLQVSIDAMRAAAHSHYFLSVTKPGITAIVGTEGNSDTFVILRGGKKGTNYDSA 253
           KNGTDG L V++DA +AAAHSH+F+ VTK G+ AI  T+GN   FVILRGGKKGTNYD+ 
Sbjct: 201 KNGTDGTLNVAVDACQAAAHSHHFMGVTKHGVAAITTTKGNEHCFVILRGGKKGTNYDAK 260

Query: 254 NVKETQKELIKAKLADENGTQRRIMIDCSHGNSSKDFRNQPKVAQSIYDQLTAGENAICG 313
           +V E + +L     A  NG    +MID SHGNS+KDFRNQPKV   + +Q+  GENAI G
Sbjct: 261 SVAEAKAQL----PAGSNG----LMIDYSHGNSNKDFRNQPKVNDVVCEQIANGENAITG 312

Query: 314 VMIESNLVEGRQDVPPEGGREGLKYGCSITDACIGWESTEQVLELLAKGVQNRRATLKK 372
           VMIESN+ EG Q +P E G+ GLKYG SITDACIGWE+TE VL  LA  V+ RR   KK
Sbjct: 313 VMIESNINEGNQGIPAE-GKAGLKYGVSITDACIGWETTEDVLRKLAAAVRQRREVNKK 370

>AFL047W [3146] [Homologous to ScYBR249C (ARO4) - SH]
           complement(351599..352693) [1095 bp, 364 aa]
          Length = 364

 Score =  442 bits (1137), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 212/360 (58%), Positives = 269/360 (74%), Gaps = 11/360 (3%)

Query: 9   GDRTRLEDWRIKGYDPLTPPDLLQHEYPISEKGHKTIVDAREQVCEILNGKDDRLVIVIG 68
            D  + ED RI GYDPL  P LLQ + P ++   +T    R +  +I+ GKDDR+++V+G
Sbjct: 9   ADADQAEDVRILGYDPLVSPALLQSQIPATQACLETAQKGRREAIDIITGKDDRVLVVVG 68

Query: 69  PCSIHDPKAAYEYADKLAALSEKLSKDLLIIMRAYLEKPRTTVGWKGLINDPDIDNSFQI 128
           PCSIHD  AA EYA +L  L+E+L  DL+++MRAYLEKPRTTVGWKGLINDPD++N+F I
Sbjct: 69  PCSIHDLDAAQEYAQRLKKLAEELEGDLVVVMRAYLEKPRTTVGWKGLINDPDVNNTFNI 128

Query: 129 NKGLRISREMFTNLVE-KLPIAGEMLDTISPQFLSDCFSLGAIGARTTESQLHRELASGL 187
           NKGL+ +R++F NL    +PI  EMLDTISPQ+L+D  S GAIGARTTESQLHRELASGL
Sbjct: 129 NKGLQAARQLFVNLTSIGVPIGSEMLDTISPQYLTDLLSFGAIGARTTESQLHRELASGL 188

Query: 188 SFPIGFKNGTDGGLQVSIDAMRAAAHSHYFLSVTKPGITAIVGTEGNSDTFVILRGGKKG 247
           SFPIGFKNGTDG L V++DA++A++HSH+F+ VTK G+ AI  T+GN   FVILRGGK+G
Sbjct: 189 SFPIGFKNGTDGSLDVALDAVKASSHSHHFMGVTKHGVAAITTTKGNEHCFVILRGGKRG 248

Query: 248 TNYDSANVKETQKELIKAKLADENGTQRRIMIDCSHGNSSKDFRNQPKVAQSIYDQLTAG 307
           TNYD+ +V E + +L    +         +MID SHGNS+KDFRNQPKV + + +Q+  G
Sbjct: 249 TNYDATSVAEAKAKLPPTGV---------LMIDYSHGNSNKDFRNQPKVNEVVSEQIANG 299

Query: 308 ENAICGVMIESNLVEGRQDVPPEGGREGLKYGCSITDACIGWESTEQVLELLAKGVQNRR 367
           E+ I GVMIESN+ EG Q +PPE G+ GLKYG SITD CI WE+TE+VL  LA  V+ RR
Sbjct: 300 EDKIVGVMIESNINEGSQKIPPE-GKAGLKYGVSITDGCISWETTEEVLRKLAGAVRKRR 358

>Sklu_1187.1 YBR249C, Contig c1187 489-1595
          Length = 368

 Score =  439 bits (1129), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 214/354 (60%), Positives = 268/354 (75%), Gaps = 11/354 (3%)

Query: 15  EDWRIKGYDPLTPPDLLQHEYPISEKGHKTIVDAREQVCEILNGKDDRLVIVIGPCSIHD 74
           ED RI GYDPL  P LLQ + P ++   +T    R++  +I+ GKDDR+++++GPCSIHD
Sbjct: 19  EDVRILGYDPLVSPALLQSQVPATQVSLQTAQRGRKESIDIITGKDDRVLVIVGPCSIHD 78

Query: 75  PKAAYEYADKLAALSEKLSKDLLIIMRAYLEKPRTTVGWKGLINDPDIDNSFQINKGLRI 134
            + A EY  +L  LS++L  DL IIMRAYLEKPRTTVGWKGLINDPD++N+F INKGL+ 
Sbjct: 79  LELAQEYGTRLKKLSDELQGDLCIIMRAYLEKPRTTVGWKGLINDPDVNNTFNINKGLQY 138

Query: 135 SREMFTNLVE-KLPIAGEMLDTISPQFLSDCFSLGAIGARTTESQLHRELASGLSFPIGF 193
           +R++F NL    +PI  EMLDTISPQ+L+D  S GAIGARTTESQLHRELASGLSFPIGF
Sbjct: 139 ARQLFVNLTSLGVPIGSEMLDTISPQYLTDLLSFGAIGARTTESQLHRELASGLSFPIGF 198

Query: 194 KNGTDGGLQVSIDAMRAAAHSHYFLSVTKPGITAIVGTEGNSDTFVILRGGKKGTNYDSA 253
           KNGTDG L V++DA++AA+HSH+F+ VTK G+ AI  T+GN   F+ILRGGKKGTNYD+ 
Sbjct: 199 KNGTDGTLGVALDAVKAASHSHHFMGVTKHGVAAITTTKGNEHCFIILRGGKKGTNYDAQ 258

Query: 254 NVKETQKELIKAKLADENGTQRRIMIDCSHGNSSKDFRNQPKVAQSIYDQLTAGENAICG 313
           +V E      KA+L         +M+D SHGNS+KDFRNQPKV  ++ +Q+  GE+ I G
Sbjct: 259 SVAEA-----KAQLPPTGA----LMVDYSHGNSNKDFRNQPKVNDAVCEQIANGEDKIIG 309

Query: 314 VMIESNLVEGRQDVPPEGGREGLKYGCSITDACIGWESTEQVLELLAKGVQNRR 367
           VMIES++ EG+Q +PPE G+ GLKYG SITD CIGWESTEQVL  LA  V+ RR
Sbjct: 310 VMIESHINEGQQSIPPE-GKAGLKYGVSITDGCIGWESTEQVLRKLAAAVRQRR 362

>KLLA0F06556g 633167..634261 highly similar to sp|P32449
           Saccharomyces cerevisiae YBR249c ARO4
           2-dehydro-3-deoxyphosphoheptonate aldolase,
           tyrosine-inhibited, start by similarity
          Length = 364

 Score =  436 bits (1122), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 216/359 (60%), Positives = 269/359 (74%), Gaps = 11/359 (3%)

Query: 15  EDWRIKGYDPLTPPDLLQHEYPISEKGHKTIVDAREQVCEILNGKDDRLVIVIGPCSIHD 74
           ED RI GYDPL  P LLQ + P S++  +T    R++  +I+ GKDDR+++V+GPCSIHD
Sbjct: 13  EDVRILGYDPLVSPALLQAQVPASQECLETAQKGRKESIDIITGKDDRVLVVVGPCSIHD 72

Query: 75  PKAAYEYADKLAALSEKLSKDLLIIMRAYLEKPRTTVGWKGLINDPDIDNSFQINKGLRI 134
            K A +YA  L ALS++L  DL IIMRAYLEKPRTTVGWKGLINDPD+DN++ INKGL++
Sbjct: 73  LKEAQDYAKGLKALSDELKGDLCIIMRAYLEKPRTTVGWKGLINDPDVDNTYNINKGLQV 132

Query: 135 SREMFTNLVE-KLPIAGEMLDTISPQFLSDCFSLGAIGARTTESQLHRELASGLSFPIGF 193
           SR++F NL    LPI  EMLDTISPQ+L+D  S GAIGARTTESQLHRELASGLSFP+GF
Sbjct: 133 SRQLFVNLTSLGLPIGSEMLDTISPQYLADLLSFGAIGARTTESQLHRELASGLSFPVGF 192

Query: 194 KNGTDGGLQVSIDAMRAAAHSHYFLSVTKPGITAIVGTEGNSDTFVILRGGKKGTNYDSA 253
           KNGTDG L V++DA++AA+HSH+F+ VTK G+ AI  T+GN   FVILRGGK+GTNYDS 
Sbjct: 193 KNGTDGTLGVALDAVQAASHSHHFMGVTKHGVAAITTTKGNEHCFVILRGGKQGTNYDSV 252

Query: 254 NVKETQKELIKAKLADENGTQRRIMIDCSHGNSSKDFRNQPKVAQSIYDQLTAGENAICG 313
           +V E +K L    +         +MID SHGNS+KDFRNQPKV  ++ +Q+  GE+ I G
Sbjct: 253 SVAEAKKALPPTGV---------LMIDYSHGNSNKDFRNQPKVNDAVCEQIANGEDKIIG 303

Query: 314 VMIESNLVEGRQDVPPEGGREGLKYGCSITDACIGWESTEQVLELLAKGVQNRRATLKK 372
           VMIES++ EG+Q +P E G+ GLKYG SITD CI  E+T +VL  LA  V+ RR   KK
Sbjct: 304 VMIESHINEGKQSIPAE-GKAGLKYGVSITDGCISLETTAEVLRKLAAAVRARRELKKK 361

>Kwal_14.1554
          Length = 364

 Score =  431 bits (1109), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 213/359 (59%), Positives = 268/359 (74%), Gaps = 12/359 (3%)

Query: 15  EDWRIKGYDPLTPPDLLQHEYPISEKGHKTIVDAREQVCEILNGKDDRLVIVIGPCSIHD 74
           ED RI G DPL  P LLQ + P + +  +T+   R    +I+ G+DDRL++++GPCSIHD
Sbjct: 14  EDVRILGLDPLVSPALLQSQIPATPECLRTVQKGRVGASKIIMGEDDRLLVIVGPCSIHD 73

Query: 75  PKAAYEYADKLAALSEKLSKDLLIIMRAYLEKPRTTVGWKGLINDPDIDNSFQINKGLRI 134
              A EYA +L  ++++L  +L IIMRAYLEKPRTTVGWKGLINDPD++NSF INKGL+ 
Sbjct: 74  LDLAQEYARRLKKVADELEGELCIIMRAYLEKPRTTVGWKGLINDPDVNNSFNINKGLQC 133

Query: 135 SREMFTNLVEK-LPIAGEMLDTISPQFLSDCFSLGAIGARTTESQLHRELASGLSFPIGF 193
           +R++F NL    LPI  EMLDTISPQ+L+D  S GAIGARTTESQLHRELASGLSFP+GF
Sbjct: 134 ARQLFVNLTSAGLPIGSEMLDTISPQYLADLLSFGAIGARTTESQLHRELASGLSFPVGF 193

Query: 194 KNGTDGGLQVSIDAMRAAAHSHYFLSVTKPGITAIVGTEGNSDTFVILRGGKKGTNYDSA 253
           KNGTDG + V+IDAM AA+HSH+F+ VTK G  AI  T+GN   FVILRGG KGTNYD+ 
Sbjct: 194 KNGTDGTMGVAIDAMLAASHSHHFMGVTKHGFAAITTTKGNEHCFVILRGGTKGTNYDAK 253

Query: 254 NVKETQKELIKAKLADENGTQRRIMIDCSHGNSSKDFRNQPKVAQSIYDQLTAGENAICG 313
           +V E + +L         GT   +M+DCSHGNS+KD+RNQPKV  ++ +Q+  GE+ I G
Sbjct: 254 SVAEAKAQL------PPGGT---LMVDCSHGNSNKDYRNQPKVNDAVCEQVANGEDKIIG 304

Query: 314 VMIESNLVEGRQDVPPEGGREGLKYGCSITDACIGWESTEQVLELLAKGVQNRRATLKK 372
           VMIES++ EG+Q +PPE G+ GLKYG SITD CIGWE+TE+VL  L+  V+ RR  LKK
Sbjct: 305 VMIESHINEGKQSIPPE-GKAGLKYGVSITDGCIGWETTEEVLRKLSNAVKQRR-ELKK 361

>Scas_26.1
          Length = 183

 Score =  350 bits (897), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 166/167 (99%), Positives = 167/167 (100%)

Query: 1   MFIKNDHVGDRTRLEDWRIKGYDPLTPPDLLQHEYPISEKGHKTIVDAREQVCEILNGKD 60
           MFIKNDHVGDRTRLEDWRIKGYDPLTPPDLLQHEYPISEKGHKTIVDAREQVCEILNGKD
Sbjct: 3   MFIKNDHVGDRTRLEDWRIKGYDPLTPPDLLQHEYPISEKGHKTIVDAREQVCEILNGKD 62

Query: 61  DRLVIVIGPCSIHDPKAAYEYADKLAALSEKLSKDLLIIMRAYLEKPRTTVGWKGLINDP 120
           DRLVIVIGPCSIHDPKAAYEYADKLAALSEKLSKDLLIIMRAYLEKPRTTVGWKGLINDP
Sbjct: 63  DRLVIVIGPCSIHDPKAAYEYADKLAALSEKLSKDLLIIMRAYLEKPRTTVGWKGLINDP 122

Query: 121 DIDNSFQINKGLRISREMFTNLVEKLPIAGEMLDTISPQFLSDCFSL 167
           DIDNSFQINKGLRISREMFTNLVEKLPIAGEMLDTISPQFLSDCFS+
Sbjct: 123 DIDNSFQINKGLRISREMFTNLVEKLPIAGEMLDTISPQFLSDCFSV 169

>AFR270W [3462] [Homologous to NOHBY] complement(919886..921031)
           [1146 bp, 381 aa]
          Length = 381

 Score = 39.7 bits (91), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 27/107 (25%), Positives = 51/107 (47%), Gaps = 2/107 (1%)

Query: 135 SREMFTNLVEKLPIAGEMLDTISPQFLSDCFSLGAIGARTTESQLHRELASGLSFPIGFK 194
           +R++   + E   +  ++LD     F+SD  SL  + AR+ +  L  ++ASGL   +  +
Sbjct: 126 TRDVLRAICEHTGVCLDILDNTLMNFVSDIPSLVVLDARSPDISL--KVASGLPSNVAVR 183

Query: 195 NGTDGGLQVSIDAMRAAAHSHYFLSVTKPGITAIVGTEGNSDTFVIL 241
                 +  +I  +   A    + +V+  G+   + T GN DTF+ L
Sbjct: 184 CRNANEIFSAIKILEHIAQPTLYPTVSHDGLPICIHTTGNPDTFLAL 230

>Scas_706.24
          Length = 460

 Score = 31.6 bits (70), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 26/39 (66%), Gaps = 2/39 (5%)

Query: 55  ILNGKDDRLVIVIGPCSIHDPKAAY--EYADKLAALSEK 91
           IL+G++D L    GP SI DP   +  +YA+KL++L+ +
Sbjct: 350 ILSGENDTLESYCGPVSITDPLLLWKSDYANKLSSLNTR 388

>KLLA0D02398g complement(202446..206063) similar to sp|P06105
            Saccharomyces cerevisiae YJL080c SCP160 required for
            maintenance of exact ploidy singleton, start by
            similarity
          Length = 1205

 Score = 31.2 bits (69), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 28/100 (28%), Positives = 45/100 (45%), Gaps = 11/100 (11%)

Query: 279  IDCSHGNSSKDFRNQPKVAQSIYDQLTAGENAICGVMIES-NLVEGRQDVPPEGGREGLK 337
            ID SHGN ++  ++  +    + + +  GEN    V+I+S    E + D  P      L 
Sbjct: 1038 IDVSHGNLTRTAQSLSRANYKVPENVAGGENESSNVLIQSVTETEAKVDTIP----WRLT 1093

Query: 338  YGCSITDACIG------WESTEQVLELLAKGVQNRRATLK 371
            Y        +G       ES +QVLE  +K +++R A  K
Sbjct: 1094 YSPIDLSDVLGEDYKKDEESKDQVLEKASKLIEDRIAEAK 1133

>Scas_689.5
          Length = 1294

 Score = 30.4 bits (67), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 43/201 (21%), Positives = 80/201 (39%), Gaps = 22/201 (10%)

Query: 75   PKAAYEYADKLAALSEKLSKDLLIIMRAYLEKPRTTVGWKGLINDPDIDNSFQINKGLRI 134
            P+   E+  + + +S+K+      ++R Y ++     GWK L+ D D +    I  G   
Sbjct: 959  PELLKEFGSQWSLISQKIGSKSTTMVRNYYQRNSAHFGWKLLVEDAD-NRRNAIRSGSVH 1017

Query: 135  SREMFTNLVEKLPIAGEMLDTISPQ------FL---SDCFSLGAIGARTTESQLHRELAS 185
              +M     + LP    +   I PQ      F    SD     + GA T  +  H E+  
Sbjct: 1018 QSQMLLQPEQMLPT---LSSGIPPQQRPALHFFGNQSDLDHRYSQGAGTPTNPFHSEIGR 1074

Query: 186  GLSFPIGFKNGTDGGLQVSIDAMRAAAHSHYF-LSVTK------PGITAIVGTEGNSDTF 238
              SF +     T       + +++  +H   F L+V++      P +T +  +   +   
Sbjct: 1075 D-SFSVVTTPST-ALPPPRLPSIQLQSHEPSFPLNVSQQQATNVPHMTPVPSSNVTNPLP 1132

Query: 239  VILRGGKKGTNYDSANVKETQ 259
             +   G+ G++  +ANV   Q
Sbjct: 1133 TVTESGRTGSSTSAANVNSIQ 1153

>Kwal_33.13646
          Length = 1253

 Score = 30.4 bits (67), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 13/53 (24%), Positives = 30/53 (56%), Gaps = 2/53 (3%)

Query: 75  PKAAYEYADKLAALSEKLSKDLLIIMRAYLEKPRTTVGWKGLIND--PDIDNS 125
           P+   E+  + A +SE+L      ++R Y ++    +GW+ L+++  P ++N+
Sbjct: 902 PELLKEFGTQWALISERLGTKSTTMVRNYFQRNAEQMGWQSLVDNSSPSVENN 954

>Scas_687.2
          Length = 486

 Score = 30.0 bits (66), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 45/211 (21%), Positives = 83/211 (39%), Gaps = 40/211 (18%)

Query: 124 NSFQINKGLRISR---EMFTNLVEKLPIAGEMLDTISPQFLSD------CFSLGAIGART 174
           + ++I  G+R ++   E+F  + + L      L+ I P+ ++        FS  A   + 
Sbjct: 110 SKYKIPDGMRTTQNPDELFEFIADSL---AAFLEEIYPEGVTKNLPLGFTFSYPASQDKI 166

Query: 175 TESQLHRELASGLSFPIGFKNGTDGG-----LQVSIDAMRAAAHSHYFLSVTKPGITAIV 229
            E  L R    G   P     G +G      LQ  +D  +        ++ T   + A +
Sbjct: 167 NEGILQR-WTKGFDIP-----GVEGHDVVQMLQKQLDKKKIPIDLVALINDTTGTLVASL 220

Query: 230 GTEGNSDTFVILRGGKKGTNYDSANVKETQKELIKAKLADENGTQRRIMIDCSHGNSSKD 289
            T+G +   VI   G  G  YD   V +  K  ++ KLAD+      + I+C +G+   +
Sbjct: 221 YTDGETKMGVIFGTGVNGAYYD--KVSDIPK--LEGKLADDIPGSSVMAINCEYGSFDNE 276

Query: 290 F-------------RNQPKVAQSIYDQLTAG 307
                            P+  Q  ++++T+G
Sbjct: 277 HSVLPRTKYDVQIDEESPRPGQQAFEKMTSG 307

>Kwal_27.12766
          Length = 707

 Score = 29.3 bits (64), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 24/86 (27%), Positives = 38/86 (44%), Gaps = 7/86 (8%)

Query: 202 QVSIDAMRAAAHSHYFLSVTKPGITAIVGTEGNSDTFV-ILRGGKKGTNYDSAN------ 254
           Q ++DA R +  S  F S++KP I  +     +    + ILR G   T+   AN      
Sbjct: 594 QAAVDAQRTSGISRTFNSLSKPQIATLDAITSHFSRLIKILRMGSSETSEALANEFIFSI 653

Query: 255 VKETQKELIKAKLADENGTQRRIMID 280
            +E    +I+ KL D N    ++  D
Sbjct: 654 SQEFANCIIEVKLPDGNDLGYKVFSD 679

>YCR033W (SNT1) [567] chr3 (186484..190164) Component of Set3p
           complex (Set3p-Yil112p-Snt1p-Hst1p-Hos2p-Cph1p-Sif2p)
           that has histone deacetylase activity and a role in
           repression of meiotic-specific sporulation gene
           expression [3681 bp, 1226 aa]
          Length = 1226

 Score = 29.3 bits (64), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 13/48 (27%), Positives = 26/48 (54%)

Query: 75  PKAAYEYADKLAALSEKLSKDLLIIMRAYLEKPRTTVGWKGLINDPDI 122
           P+   E+  + + +SEKL      ++R Y ++     GWK L+++ D+
Sbjct: 901 PELLKEFGSQWSLISEKLGTKSTTMVRNYYQRNAARNGWKLLVDETDL 948

>CAGL0L08162g 899222..903292 similar to sp|P25357 Saccharomyces
            cerevisiae YCR033w, start by similarity
          Length = 1356

 Score = 28.9 bits (63), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 10/42 (23%), Positives = 23/42 (54%)

Query: 80   EYADKLAALSEKLSKDLLIIMRAYLEKPRTTVGWKGLINDPD 121
            E+  + + +S+KL+     ++R Y ++     GWK ++ + D
Sbjct: 1005 EFGSQWSLISQKLATKSTTMVRNYYQRNAAQFGWKSIVEEAD 1046

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.316    0.135    0.395 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 12,315,248
Number of extensions: 533897
Number of successful extensions: 1367
Number of sequences better than 10.0: 27
Number of HSP's gapped: 1364
Number of HSP's successfully gapped: 27
Length of query: 372
Length of database: 16,596,109
Length adjustment: 103
Effective length of query: 269
Effective length of database: 13,030,455
Effective search space: 3505192395
Effective search space used: 3505192395
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 62 (28.5 bits)