Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Sklu_2357.91021025542e-75
AGR029W1121024744e-63
KLLA0F18568g1121024641e-61
Scas_569.4*1101024353e-57
YDR045C (RPC11)1101024344e-57
CAGL0H08415g1001024335e-57
Kwal_27.109391101024191e-54
KLLA0B13860g160741153e-08
YGL043W (DST1)309341156e-08
Scas_621.15307341147e-08
Kwal_27.9972125431107e-08
Sklu_2213.5287341139e-08
Scas_673.30*148431119e-08
CAGL0D06160g306341131e-07
KLLA0F09361g292341131e-07
Kwal_26.7521301341131e-07
AGR011W304901122e-07
Sklu_2119.4125731072e-07
YJR063W (RPA12)125431072e-07
AFR417W125431063e-07
CAGL0F00561g128671038e-07
KLLA0D03234g122102915e-05
YGL070C (RPB9)12260790.002
Kwal_56.2405412287790.002
Sklu_1830.311060790.002
AFL088W12255780.003
CAGL0H03509g12260780.004
Scas_720.22*12287760.007
Scas_238.163153630.62
AER381C143521601.7
CAGL0L08888g119355592.4
CAGL0G06666g145421574.1
Kwal_26.8405145821574.2
Scas_698.7103029574.5
Scas_666.7145421574.6
Sklu_2014.363144557.8
KLLA0C03564g139979558.6
KLLA0C09735g78448558.6
YPL146C45552549.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Sklu_2357.9
         (102 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Sklu_2357.9 YDR045C, Contig c2357 12849-13157 reverse complement      218   2e-75
AGR029W [4339] [Homologous to ScYDR045C (RPC11) - SH] complement...   187   4e-63
KLLA0F18568g complement(1708319..1708657) highly similar to sp|Q...   183   1e-61
Scas_569.4*                                                           172   3e-57
YDR045C (RPC11) [898] chr4 complement(547974..548306) RNA polyme...   171   4e-57
CAGL0H08415g 824631..824933 highly similar to sp|Q04307 Saccharo...   171   5e-57
Kwal_27.10939                                                         166   1e-54
KLLA0B13860g 1215461..1215943 some similarities with sp|P32529 S...    49   3e-08
YGL043W (DST1) [1934] chr7 (417485..418414) Transcription elonga...    49   6e-08
Scas_621.15                                                            49   7e-08
Kwal_27.9972                                                           47   7e-08
Sklu_2213.5 YGL043W, Contig c2213 7532-8395                            48   9e-08
Scas_673.30*                                                           47   9e-08
CAGL0D06160g complement(580707..581627) highly similar to sp|P07...    48   1e-07
KLLA0F09361g complement(864425..865303) similar to sp|P07273 Sac...    48   1e-07
Kwal_26.7521                                                           48   1e-07
AGR011W [4321] [Homologous to ScYGL043W (DST1) - SH] complement(...    48   2e-07
Sklu_2119.4 YJR063W, Contig c2119 5697-6074 reverse complement         46   2e-07
YJR063W (RPA12) [2957] chr10 (555109..555486) RNA polymerase I s...    46   2e-07
AFR417W [3609] [Homologous to ScYJR063W (RPA12) - SH] complement...    45   3e-07
CAGL0F00561g complement(58585..58971) highly similar to sp|P3252...    44   8e-07
KLLA0D03234g 270311..270679 highly similar to sp|P27999 Saccharo...    40   5e-05
YGL070C (RPB9) [1910] chr7 complement(374460..374828) RNA polyme...    35   0.002
Kwal_56.24054                                                          35   0.002
Sklu_1830.3 YGL070C, Contig c1830 5480-5812 reverse complement         35   0.002
AFL088W [3105] [Homologous to ScYGL070C (RPB9) - SH] complement(...    35   0.003
CAGL0H03509g complement(326276..326644) highly similar to sp|P27...    35   0.004
Scas_720.22*                                                           34   0.007
Scas_238.1                                                             29   0.62 
AER381C [2882] [Homologous to ScYNL102W (POL1) - SH] (1352212..1...    28   1.7  
CAGL0L08888g 967838..971419 similar to tr|Q12200 Saccharomyces c...    27   2.4  
CAGL0G06666g complement(635311..639675) highly similar to sp|P13...    27   4.1  
Kwal_26.8405                                                           27   4.2  
Scas_698.7                                                             27   4.5  
Scas_666.7                                                             27   4.6  
Sklu_2014.3 YGR194C, Contig c2014 3590-5485 reverse complement         26   7.8  
KLLA0C03564g complement(323354..327553) some similarities with s...    26   8.6  
KLLA0C09735g 841867..844221 similar to sgd|S0005782 Saccharomyce...    26   8.6  
YPL146C (YPL146C) [5301] chr16 complement(276161..277528) Nuclea...    25   9.4  

>Sklu_2357.9 YDR045C, Contig c2357 12849-13157 reverse complement
          Length = 102

 Score =  218 bits (554), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 102/102 (100%), Positives = 102/102 (100%)

Query: 1   MLLIATNDAGIYKLNCPSCPYEFPIEGIEVYDRKTLVRKEVDDVLGGEGAWDNVDQTGAQ 60
           MLLIATNDAGIYKLNCPSCPYEFPIEGIEVYDRKTLVRKEVDDVLGGEGAWDNVDQTGAQ
Sbjct: 1   MLLIATNDAGIYKLNCPSCPYEFPIEGIEVYDRKTLVRKEVDDVLGGEGAWDNVDQTGAQ 60

Query: 61  CPNHDNCGGNKAYFFQLQIRSADEPMTTFYKCVTCGHKWREN 102
           CPNHDNCGGNKAYFFQLQIRSADEPMTTFYKCVTCGHKWREN
Sbjct: 61  CPNHDNCGGNKAYFFQLQIRSADEPMTTFYKCVTCGHKWREN 102

>AGR029W [4339] [Homologous to ScYDR045C (RPC11) - SH]
           complement(768240..768578) [339 bp, 112 aa]
          Length = 112

 Score =  187 bits (474), Expect = 4e-63,   Method: Compositional matrix adjust.
 Identities = 82/102 (80%), Positives = 91/102 (89%)

Query: 1   MLLIATNDAGIYKLNCPSCPYEFPIEGIEVYDRKTLVRKEVDDVLGGEGAWDNVDQTGAQ 60
           ML ++  D+G+Y+L CPSCPYEFPIEG+E+YDR+ L RKEVDDVLGGEGAWDNVDQT  Q
Sbjct: 11  MLPVSKGDSGVYRLGCPSCPYEFPIEGVEIYDRRNLPRKEVDDVLGGEGAWDNVDQTAVQ 70

Query: 61  CPNHDNCGGNKAYFFQLQIRSADEPMTTFYKCVTCGHKWREN 102
           CP H+ CGG KAYFFQLQIRSADEPMTTFYKCVTCGHKWREN
Sbjct: 71  CPQHETCGGEKAYFFQLQIRSADEPMTTFYKCVTCGHKWREN 112

>KLLA0F18568g complement(1708319..1708657) highly similar to
           sp|Q04307 Saccharomyces cerevisiae YDR045c RPC11 RNA
           polymerase III subunit C11, required for RNA cleavage
           activity and transcription termination singleton, start
           by similarity
          Length = 112

 Score =  183 bits (464), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 83/102 (81%), Positives = 90/102 (88%)

Query: 1   MLLIATNDAGIYKLNCPSCPYEFPIEGIEVYDRKTLVRKEVDDVLGGEGAWDNVDQTGAQ 60
           MLL++  D+G+YKL C SCPY+F I+GIEVYDRK L RKEVDDVLGGEGAWDNVDQT AQ
Sbjct: 11  MLLVSKADSGLYKLACGSCPYQFLIDGIEVYDRKNLPRKEVDDVLGGEGAWDNVDQTAAQ 70

Query: 61  CPNHDNCGGNKAYFFQLQIRSADEPMTTFYKCVTCGHKWREN 102
           CPNHD C G +AYFFQLQIRSADEPMTTFYKCV CGHKWREN
Sbjct: 71  CPNHDQCAGERAYFFQLQIRSADEPMTTFYKCVNCGHKWREN 112

>Scas_569.4*
          Length = 110

 Score =  172 bits (435), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 79/102 (77%), Positives = 86/102 (84%), Gaps = 2/102 (1%)

Query: 1   MLLIATNDAGIYKLNCPSCPYEFPIEGIEVYDRKTLVRKEVDDVLGGEGAWDNVDQTGAQ 60
           MLLI T D+G+Y L C SCPYEFPIEGIE+YDRKTL RKEVDDVLGG   WDNVDQT  Q
Sbjct: 11  MLLITTADSGVYTLTCRSCPYEFPIEGIEIYDRKTLPRKEVDDVLGG--GWDNVDQTKVQ 68

Query: 61  CPNHDNCGGNKAYFFQLQIRSADEPMTTFYKCVTCGHKWREN 102
           CPN++ CGG  AYFFQLQIRSADEPMTTFYKCV C H+W+EN
Sbjct: 69  CPNYEKCGGESAYFFQLQIRSADEPMTTFYKCVNCAHRWKEN 110

>YDR045C (RPC11) [898] chr4 complement(547974..548306) RNA
           polymerase III subunit C11, required for RNA cleavage
           activity and transcription termination [333 bp, 110 aa]
          Length = 110

 Score =  171 bits (434), Expect = 4e-57,   Method: Compositional matrix adjust.
 Identities = 79/102 (77%), Positives = 86/102 (84%), Gaps = 2/102 (1%)

Query: 1   MLLIATNDAGIYKLNCPSCPYEFPIEGIEVYDRKTLVRKEVDDVLGGEGAWDNVDQTGAQ 60
           MLLI + D+G+Y L C SCPYEFPIEGIE+YDRK L RKEVDDVLGG   WDNVDQT  Q
Sbjct: 11  MLLITSGDSGVYTLACRSCPYEFPIEGIEIYDRKKLPRKEVDDVLGG--GWDNVDQTKTQ 68

Query: 61  CPNHDNCGGNKAYFFQLQIRSADEPMTTFYKCVTCGHKWREN 102
           CPN+D CGG  AYFFQLQIRSADEPMTTFYKCV CGH+W+EN
Sbjct: 69  CPNYDTCGGESAYFFQLQIRSADEPMTTFYKCVNCGHRWKEN 110

>CAGL0H08415g 824631..824933 highly similar to sp|Q04307
           Saccharomyces cerevisiae YDR045c RPC11, start by
           similarity
          Length = 100

 Score =  171 bits (433), Expect = 5e-57,   Method: Compositional matrix adjust.
 Identities = 78/102 (76%), Positives = 86/102 (84%), Gaps = 2/102 (1%)

Query: 1   MLLIATNDAGIYKLNCPSCPYEFPIEGIEVYDRKTLVRKEVDDVLGGEGAWDNVDQTGAQ 60
           MLL+AT+D G+Y L+C SCPYEFPIE IE+YDRK L RKEVDDVLGG   WDNVDQT  Q
Sbjct: 1   MLLVATSDNGVYNLSCRSCPYEFPIESIEIYDRKKLPRKEVDDVLGG--GWDNVDQTKVQ 58

Query: 61  CPNHDNCGGNKAYFFQLQIRSADEPMTTFYKCVTCGHKWREN 102
           CPN+D CGG  AYFFQLQIRSADEPMTTFYKCV C H+W+EN
Sbjct: 59  CPNYDTCGGESAYFFQLQIRSADEPMTTFYKCVNCAHRWKEN 100

>Kwal_27.10939
          Length = 110

 Score =  166 bits (419), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 75/102 (73%), Positives = 86/102 (84%), Gaps = 2/102 (1%)

Query: 1   MLLIATNDAGIYKLNCPSCPYEFPIEGIEVYDRKTLVRKEVDDVLGGEGAWDNVDQTGAQ 60
           ML+++  ++G Y L C SCPY FPIEG+EVYDRKTL RKEVDDVLGG   WDNVDQT  Q
Sbjct: 11  MLVVSPAESGAYALKCGSCPYAFPIEGVEVYDRKTLPRKEVDDVLGG--GWDNVDQTAVQ 68

Query: 61  CPNHDNCGGNKAYFFQLQIRSADEPMTTFYKCVTCGHKWREN 102
           CPN+D C G +AYFFQLQIRSADEPMTTFYKCV+CG++WREN
Sbjct: 69  CPNYDQCAGERAYFFQLQIRSADEPMTTFYKCVSCGNRWREN 110

>KLLA0B13860g 1215461..1215943 some similarities with sp|P32529
           Saccharomyces cerevisiae YJR063w RPA12 DNA-directed RNA
           polymerase I, 13. 7 KD subunit singleton, hypothetical
           start
          Length = 160

 Score = 48.9 bits (115), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 25/74 (33%), Positives = 40/74 (54%), Gaps = 8/74 (10%)

Query: 29  EVYDRKTLVRKEVDDVLGGEGAWDNVDQTGAQCPNHDNCGGNKAYFFQLQIRSADEPMTT 88
           ++  +K+LV+  +      +GA  N      +CP    C  +K ++  LQ+RSADE  T 
Sbjct: 94  KIRSKKSLVKTSIAKNELKDGAIIN-----EKCPK---CANDKMHYHTLQLRSADEGATV 145

Query: 89  FYKCVTCGHKWREN 102
           FY C  CG+++R N
Sbjct: 146 FYTCTACGYRFRTN 159

>YGL043W (DST1) [1934] chr7 (417485..418414) Transcription
           elongation factor S-II, a DNA strand transfer protein
           catalyzing homologous DNA strand exchange [930 bp, 309
           aa]
          Length = 309

 Score = 48.9 bits (115), Expect = 6e-08,   Method: Composition-based stats.
 Identities = 18/34 (52%), Positives = 24/34 (70%)

Query: 67  CGGNKAYFFQLQIRSADEPMTTFYKCVTCGHKWR 100
           C   K  ++QLQ RSADEP+TTF  C  CG++W+
Sbjct: 274 CKEKKVSYYQLQTRSADEPLTTFCTCEACGNRWK 307

>Scas_621.15
          Length = 307

 Score = 48.5 bits (114), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 18/34 (52%), Positives = 24/34 (70%)

Query: 67  CGGNKAYFFQLQIRSADEPMTTFYKCVTCGHKWR 100
           C   K  ++QLQ RSADEP+TTF  C  CG++W+
Sbjct: 272 CKEKKVSYYQLQTRSADEPLTTFCTCEACGNRWK 305

>Kwal_27.9972
          Length = 125

 Score = 47.0 bits (110), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 19/43 (44%), Positives = 29/43 (67%), Gaps = 3/43 (6%)

Query: 60  QCPNHDNCGGNKAYFFQLQIRSADEPMTTFYKCVTCGHKWREN 102
           +CP    CG ++ ++  LQ+RSADE  T FY C +CG+++R N
Sbjct: 85  KCPQ---CGNDEMHYHTLQLRSADEGATVFYTCTSCGYRFRTN 124

>Sklu_2213.5 YGL043W, Contig c2213 7532-8395
          Length = 287

 Score = 48.1 bits (113), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 18/34 (52%), Positives = 24/34 (70%)

Query: 67  CGGNKAYFFQLQIRSADEPMTTFYKCVTCGHKWR 100
           C   K  ++QLQ RSADEP+TTF  C  CG++W+
Sbjct: 252 CKEKKVSYYQLQTRSADEPLTTFCTCEVCGNRWK 285

>Scas_673.30*
          Length = 148

 Score = 47.4 bits (111), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 20/43 (46%), Positives = 28/43 (65%), Gaps = 3/43 (6%)

Query: 60  QCPNHDNCGGNKAYFFQLQIRSADEPMTTFYKCVTCGHKWREN 102
           +CP    CG ++ ++  LQ+RSADE  T FY C  CG+K+R N
Sbjct: 108 KCPQ---CGNDEMHYHTLQLRSADEGATVFYTCTKCGYKFRTN 147

>CAGL0D06160g complement(580707..581627) highly similar to sp|P07273
           Saccharomyces cerevisiae YGL043w DST1 TFIIS, start by
           similarity
          Length = 306

 Score = 48.1 bits (113), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 18/34 (52%), Positives = 24/34 (70%)

Query: 67  CGGNKAYFFQLQIRSADEPMTTFYKCVTCGHKWR 100
           C   K  ++QLQ RSADEP+TTF  C  CG++W+
Sbjct: 271 CKEKKVSYYQLQTRSADEPLTTFCTCEACGNRWK 304

>KLLA0F09361g complement(864425..865303) similar to sp|P07273
           Saccharomyces cerevisiae YGL043w DST1 TFIIS
           (transcription elongation factor) singleton, start by
           similarity
          Length = 292

 Score = 48.1 bits (113), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 18/34 (52%), Positives = 24/34 (70%)

Query: 67  CGGNKAYFFQLQIRSADEPMTTFYKCVTCGHKWR 100
           C   K  ++QLQ RSADEP+TTF  C  CG++W+
Sbjct: 257 CKQRKVSYYQLQTRSADEPLTTFCTCENCGNRWK 290

>Kwal_26.7521
          Length = 301

 Score = 48.1 bits (113), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 18/34 (52%), Positives = 24/34 (70%)

Query: 67  CGGNKAYFFQLQIRSADEPMTTFYKCVTCGHKWR 100
           C   K  ++QLQ RSADEP+TTF  C  CG++W+
Sbjct: 266 CKEKKVSYYQLQTRSADEPLTTFCTCEVCGNRWK 299

>AGR011W [4321] [Homologous to ScYGL043W (DST1) - SH]
           complement(737606..738520) [915 bp, 304 aa]
          Length = 304

 Score = 47.8 bits (112), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 32/90 (35%), Positives = 43/90 (47%), Gaps = 10/90 (11%)

Query: 12  YKLNCPSCPYEFPIEGIEVYDRKTLVRKEVDDVLGGEGAWDNVDQTGA-QCPNHDNCGGN 70
           Y +NC   P E   E +    RK L      ++   +GA      T   QC     C   
Sbjct: 222 YLVNCD--PKELAPEHL----RKKLEEIAKQNLFNAQGATLERSVTDRFQC---GKCKEK 272

Query: 71  KAYFFQLQIRSADEPMTTFYKCVTCGHKWR 100
           K  ++QLQ RSADEP+TTF  C  CG++W+
Sbjct: 273 KVSYYQLQTRSADEPLTTFCTCEACGNRWK 302

>Sklu_2119.4 YJR063W, Contig c2119 5697-6074 reverse complement
          Length = 125

 Score = 45.8 bits (107), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 24/73 (32%), Positives = 39/73 (53%), Gaps = 8/73 (10%)

Query: 30  VYDRKTLVRKEVDDVLGGEGAWDNVDQTGAQCPNHDNCGGNKAYFFQLQIRSADEPMTTF 89
           +  +K++V+  +      EGA         +CP    CG ++  +  LQ+RSADE  T F
Sbjct: 60  LRSKKSVVKTSLKKDELDEGAT-----IKEKCPQ---CGNDEMRYHTLQLRSADEGATVF 111

Query: 90  YKCVTCGHKWREN 102
           Y C +CG+++R N
Sbjct: 112 YTCTSCGYRFRTN 124

>YJR063W (RPA12) [2957] chr10 (555109..555486) RNA polymerase I
           subunit A12.2 [378 bp, 125 aa]
          Length = 125

 Score = 45.8 bits (107), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 20/43 (46%), Positives = 27/43 (62%), Gaps = 3/43 (6%)

Query: 60  QCPNHDNCGGNKAYFFQLQIRSADEPMTTFYKCVTCGHKWREN 102
           +CP    CG  +  +  LQ+RSADE  T FY C +CG+K+R N
Sbjct: 85  KCPQ---CGNEEMNYHTLQLRSADEGATVFYTCTSCGYKFRTN 124

>AFR417W [3609] [Homologous to ScYJR063W (RPA12) - SH]
           complement(1184595..1184972) [378 bp, 125 aa]
          Length = 125

 Score = 45.4 bits (106), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 19/43 (44%), Positives = 28/43 (65%), Gaps = 3/43 (6%)

Query: 60  QCPNHDNCGGNKAYFFQLQIRSADEPMTTFYKCVTCGHKWREN 102
           +CP    CG ++  +  LQ+RSADE  T FY C +CG+++R N
Sbjct: 85  KCPQ---CGHDEMQYHTLQLRSADEGATVFYTCTSCGYRFRTN 124

>CAGL0F00561g complement(58585..58971) highly similar to sp|P32529
           Saccharomyces cerevisiae YJR063w RPA12 DNA-directed RNA
           polymerase I, start by similarity
          Length = 128

 Score = 44.3 bits (103), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 24/67 (35%), Positives = 34/67 (50%), Gaps = 3/67 (4%)

Query: 36  LVRKEVDDVLGGEGAWDNVDQTGAQCPNHDNCGGNKAYFFQLQIRSADEPMTTFYKCVTC 95
           L R  V   L  +   D+      +CP    CG ++  +  LQ+RSADE  T FY C+ C
Sbjct: 64  LKRSVVKTHLKRDELKDDGATIKEKCPK---CGHDEMRYQTLQLRSADEGATVFYTCIKC 120

Query: 96  GHKWREN 102
            +K+R N
Sbjct: 121 NYKYRTN 127

>KLLA0D03234g 270311..270679 highly similar to sp|P27999
           Saccharomyces cerevisiae YGL070c RPB9 DNA-directed RNA
           polymerase II, 14. 2 KD subunit singleton, start by
           similarity
          Length = 122

 Score = 39.7 bits (91), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 29/102 (28%), Positives = 45/102 (44%), Gaps = 8/102 (7%)

Query: 2   LLIATNDAGIYKL--NCPSCPY--EFPIEGIEVYDRKTLVRKEVDDVLGGEGAWDNVDQT 57
           +L    D   +KL   C +CPY  E     +  ++ KT +  E   V+   G+   + ++
Sbjct: 13  MLYPREDKETHKLLFECRTCPYVEEAGTPLVYRHELKTNI-GETAGVVQDIGSDPTLPRS 71

Query: 58  GAQCPNHDNCGGNKAYFFQLQIRSADEPMTTFYKCVTCGHKW 99
             +CP    C   +  FFQ Q R  D  M  FY C+ C H +
Sbjct: 72  DKECPK---CHSRENVFFQSQQRRKDTSMVLFYVCLHCSHIF 110

>YGL070C (RPB9) [1910] chr7 complement(374460..374828) RNA
           polymerase II, non-essential subunit, involved in
           transcription start site selection [369 bp, 122 aa]
          Length = 122

 Score = 35.0 bits (79), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 17/60 (28%), Positives = 28/60 (46%), Gaps = 3/60 (5%)

Query: 40  EVDDVLGGEGAWDNVDQTGAQCPNHDNCGGNKAYFFQLQIRSADEPMTTFYKCVTCGHKW 99
           E   V+   G+   + ++  +CP    C   +  FFQ Q R  D  M  F+ C++C H +
Sbjct: 54  ETAGVVQDIGSDPTLPRSDRECPK---CHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIF 110

>Kwal_56.24054
          Length = 122

 Score = 35.0 bits (79), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/87 (25%), Positives = 37/87 (42%), Gaps = 4/87 (4%)

Query: 14  LNCPSCPYEFPIEGIEVYDRKTLVR-KEVDDVLGGEGAWDNVDQTGAQCPNHDNCGGNKA 72
             C +C Y        VY  + +    E   V+   G+   + ++  +CP    C  ++ 
Sbjct: 27  FECRTCTYAEEAGTPMVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPK---CHSHEN 83

Query: 73  YFFQLQIRSADEPMTTFYKCVTCGHKW 99
            FFQ Q R +D  M  F+ C+ C H +
Sbjct: 84  VFFQSQQRRSDTSMVLFFVCLGCSHIF 110

>Sklu_1830.3 YGL070C, Contig c1830 5480-5812 reverse complement
          Length = 110

 Score = 35.0 bits (79), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 17/60 (28%), Positives = 28/60 (46%), Gaps = 3/60 (5%)

Query: 40 EVDDVLGGEGAWDNVDQTGAQCPNHDNCGGNKAYFFQLQIRSADEPMTTFYKCVTCGHKW 99
          E   V+   G+   + ++  +CP    C  ++  FFQ Q R  D  M  F+ C+ C H +
Sbjct: 42 ETAGVVQDIGSDPTLPRSDRECPK---CHSHENVFFQSQQRRKDTSMVLFFVCLACSHIF 98

>AFL088W [3105] [Homologous to ScYGL070C (RPB9) - SH]
           complement(276175..276543) [369 bp, 122 aa]
          Length = 122

 Score = 34.7 bits (78), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 17/55 (30%), Positives = 25/55 (45%), Gaps = 6/55 (10%)

Query: 45  LGGEGAWDNVDQTGAQCPNHDNCGGNKAYFFQLQIRSADEPMTTFYKCVTCGHKW 99
           +G +      D+   +C +HDN       FFQ Q R  D  M  F+ C+ C H +
Sbjct: 62  IGSDPTLPRSDRECPRCHSHDN------VFFQSQQRRRDTSMVLFFVCLGCSHIF 110

>CAGL0H03509g complement(326276..326644) highly similar to sp|P27999
           Saccharomyces cerevisiae YGL070c RPB9, start by
           similarity
          Length = 122

 Score = 34.7 bits (78), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 17/60 (28%), Positives = 27/60 (45%), Gaps = 3/60 (5%)

Query: 40  EVDDVLGGEGAWDNVDQTGAQCPNHDNCGGNKAYFFQLQIRSADEPMTTFYKCVTCGHKW 99
           E   V+   G+   + ++  +CP    C   +  FFQ Q R  D  M  F+ C+ C H +
Sbjct: 54  ETAGVVQDIGSDPTLPRSDRECPK---CHSRENVFFQSQQRRKDTSMVLFFVCLACSHIF 110

>Scas_720.22*
          Length = 122

 Score = 33.9 bits (76), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 22/87 (25%), Positives = 34/87 (39%), Gaps = 4/87 (4%)

Query: 14  LNCPSCPYEFPIEGIEVYDRKTLVR-KEVDDVLGGEGAWDNVDQTGAQCPNHDNCGGNKA 72
             C +C Y        VY  + +    E   V+   G+   + ++  +CP    C     
Sbjct: 27  FECRTCSYVEEAGAPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPR---CHARDN 83

Query: 73  YFFQLQIRSADEPMTTFYKCVTCGHKW 99
            FFQ Q R  D  M  F+ C+ C H +
Sbjct: 84  VFFQSQQRRKDTSMVLFFVCLQCSHIF 110

>Scas_238.1
          Length = 631

 Score = 28.9 bits (63), Expect = 0.62,   Method: Composition-based stats.
 Identities = 18/53 (33%), Positives = 29/53 (54%), Gaps = 6/53 (11%)

Query: 9   AGIYKLNCPSCPYEFPIEGIEVYDRKTLVRKEVDDVLG-GEGAWDNVDQTGAQ 60
           A +Y  N P+    F + G EV   + L ++ +D+V+   EG WD +D+T  Q
Sbjct: 466 ASVYSKNNPN--LLFTMCGFEV---RILPKQRMDEVISTDEGVWDLIDETSKQ 513

>AER381C [2882] [Homologous to ScYNL102W (POL1) - SH]
            (1352212..1356519) [4308 bp, 1435 aa]
          Length = 1435

 Score = 27.7 bits (60), Expect = 1.7,   Method: Composition-based stats.
 Identities = 10/21 (47%), Positives = 13/21 (61%)

Query: 8    DAGIYKLNCPSCPYEFPIEGI 28
            DA   ++ CPSC  +FP  GI
Sbjct: 1246 DATAMRVTCPSCQAKFPFGGI 1266

>CAGL0L08888g 967838..971419 similar to tr|Q12200 Saccharomyces
           cerevisiae YPL006w, hypothetical start
          Length = 1193

 Score = 27.3 bits (59), Expect = 2.4,   Method: Composition-based stats.
 Identities = 18/55 (32%), Positives = 23/55 (41%), Gaps = 8/55 (14%)

Query: 55  DQTGAQCPNHDNCGGNKAYFFQLQIRSAD----EPM----TTFYKCVTCGHKWRE 101
           D+ GAQC  + NCG    +  QL     D     PM    T      TCG +W +
Sbjct: 30  DKGGAQCTIYGNCGKKSIFGSQLPCPVDDLDFSPPMIDEETRELLVSTCGKEWED 84

>CAGL0G06666g complement(635311..639675) highly similar to sp|P13382
            Saccharomyces cerevisiae YNL102w CDC17, start by
            similarity
          Length = 1454

 Score = 26.6 bits (57), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 11/21 (52%), Positives = 13/21 (61%)

Query: 8    DAGIYKLNCPSCPYEFPIEGI 28
            D+    LNCP+C  EFP  GI
Sbjct: 1265 DSSNLILNCPNCKKEFPYGGI 1285

>Kwal_26.8405
          Length = 1458

 Score = 26.6 bits (57), Expect = 4.2,   Method: Composition-based stats.
 Identities = 9/21 (42%), Positives = 12/21 (57%)

Query: 8    DAGIYKLNCPSCPYEFPIEGI 28
            +A +  L CP C  +FP  GI
Sbjct: 1268 NAAVLTLECPECQQKFPFGGI 1288

>Scas_698.7
          Length = 1030

 Score = 26.6 bits (57), Expect = 4.5,   Method: Composition-based stats.
 Identities = 13/29 (44%), Positives = 15/29 (51%), Gaps = 11/29 (37%)

Query: 42  DDVLGGEGAWDNVDQTGAQCPNHDNCGGN 70
           D++L GE AWD        CP   NCG N
Sbjct: 819 DEMLSGENAWD--------CP---NCGSN 836

>Scas_666.7
          Length = 1454

 Score = 26.6 bits (57), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 9/21 (42%), Positives = 14/21 (66%)

Query: 8    DAGIYKLNCPSCPYEFPIEGI 28
            +  + +L+CP+C  EFP  GI
Sbjct: 1266 EVALLELSCPNCNIEFPFGGI 1286

>Sklu_2014.3 YGR194C, Contig c2014 3590-5485 reverse complement
          Length = 631

 Score = 25.8 bits (55), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 13/44 (29%), Positives = 22/44 (50%), Gaps = 2/44 (4%)

Query: 27  GIEVYDRKTLVRKEVDDVLGGEGAWDNVDQT--GAQCPNHDNCG 68
           G+  Y   +L R+ V D+L  + +WD  ++    +   NHD  G
Sbjct: 389 GMICYCNGSLARENVRDLLSADHSWDPFNKALLDSSVDNHDEIG 432

>KLLA0C03564g complement(323354..327553) some similarities with
            sp|P25357 Saccharomyces cerevisiae YCR033w singleton,
            hypothetical start
          Length = 1399

 Score = 25.8 bits (55), Expect = 8.6,   Method: Composition-based stats.
 Identities = 18/79 (22%), Positives = 32/79 (40%), Gaps = 3/79 (3%)

Query: 20   PYEFPIEGIEVYDRKTLVRKEVDDVLGGEGAWDNVDQTGAQCPNHDNCGGNKAYFFQLQI 79
            PYE  +  +     K+++ + V +    +  +DN   T +     D      + + Q  +
Sbjct: 930  PYEDIVPMLADMTSKSVINESVKNADHADIGFDN---TESHLKPEDEVSSKHSLYDQSNV 986

Query: 80   RSADEPMTTFYKCVTCGHK 98
             SAD+PM    K     HK
Sbjct: 987  NSADQPMKKKLKQTEAVHK 1005

>KLLA0C09735g 841867..844221 similar to sgd|S0005782 Saccharomyces
           cerevisiae YOR256c, start by similarity
          Length = 784

 Score = 25.8 bits (55), Expect = 8.6,   Method: Composition-based stats.
 Identities = 13/48 (27%), Positives = 22/48 (45%), Gaps = 13/48 (27%)

Query: 42  DDVLGGEGAWDNVDQTGAQCPNHDNCGGNKAYFFQLQIRSADEPMTTF 89
           +++ G EGAW+ V  T               Y +++ +R  DEP+  F
Sbjct: 592 EEIKGTEGAWEQVADT-------------LIYTYEMLLRLIDEPLLPF 626

>YPL146C (YPL146C) [5301] chr16 complement(276161..277528) Nuclear
           and nucleolar protein associated with the nuclear pore
           complex [1368 bp, 455 aa]
          Length = 455

 Score = 25.4 bits (54), Expect = 9.4,   Method: Composition-based stats.
 Identities = 15/52 (28%), Positives = 23/52 (44%), Gaps = 2/52 (3%)

Query: 21  YEFPIEGIEVYDRKTLVRKEVDDVLGGEGAWDNVDQTG--AQCPNHDNCGGN 70
           +   +EG E+   K + RK++  VL  +   D V      A   +H N  GN
Sbjct: 61  FHVDVEGDEILKNKLIKRKQIKKVLKSKEILDAVKTNSKIAALNHHKNSSGN 112

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.320    0.139    0.461 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 3,651,123
Number of extensions: 138482
Number of successful extensions: 255
Number of sequences better than 10.0: 39
Number of HSP's gapped: 251
Number of HSP's successfully gapped: 39
Length of query: 102
Length of database: 16,596,109
Length adjustment: 73
Effective length of query: 29
Effective length of database: 14,068,995
Effective search space: 408000855
Effective search space used: 408000855
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 54 (25.4 bits)