Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Sklu_2357.834134117200.0
Kwal_27.1093534433214540.0
YDR044W (HEM13)32832714070.0
KLLA0F18546g37533413810.0
Scas_569.333332913700.0
CAGL0K12100g32732713310.0
AGR030C32432012141e-168
Sklu_2020.347976645.1
CAGL0K07546g32373636.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Sklu_2357.8
         (341 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Sklu_2357.8 YDR044W, Contig c2357 11533-12558                         667   0.0  
Kwal_27.10935                                                         564   0.0  
YDR044W (HEM13) [897] chr4 (546638..547624) Coproporphyrinogen I...   546   0.0  
KLLA0F18546g 1706744..1707871 gi|26185795|emb|CAD58624.1 Kluyver...   536   0.0  
Scas_569.3                                                            532   0.0  
CAGL0K12100g 1183383..1184366 highly similar to sp|P11353 Saccha...   517   0.0  
AGR030C [4340] [Homologous to ScYDR044W (HEM13) - SH] (768609..7...   472   e-168
Sklu_2020.3 YCR045C, Contig c2020 5388-6827 reverse complement         29   5.1  
CAGL0K07546g 744372..745343 similar to sp|P36069 Saccharomyces c...    29   6.1  

>Sklu_2357.8 YDR044W, Contig c2357 11533-12558
          Length = 341

 Score =  667 bits (1720), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 321/341 (94%), Positives = 321/341 (94%)

Query: 1   MXXXXXTIENHSTAMPAPQDPKHLPIRQQMEQLILRKQKEITKGLETLDTVKFRADSWTR 60
           M     TIENHSTAMPAPQDPKHLPIRQQMEQLILRKQKEITKGLETLDTVKFRADSWTR
Sbjct: 1   MSSSSSTIENHSTAMPAPQDPKHLPIRQQMEQLILRKQKEITKGLETLDTVKFRADSWTR 60

Query: 61  GNDGGGGTSMVLQNGTTFEKGGVNTSVVYGQLSPKAISAMRQDHKNLHLPVDPQTGEPNA 120
           GNDGGGGTSMVLQNGTTFEKGGVNTSVVYGQLSPKAISAMRQDHKNLHLPVDPQTGEPNA
Sbjct: 61  GNDGGGGTSMVLQNGTTFEKGGVNTSVVYGQLSPKAISAMRQDHKNLHLPVDPQTGEPNA 120

Query: 121 DGVNFFACGLSMVIHPHNPHAPTTHLNYRYFETWNPDGSPQAWWFGGGADLTPSYLYEED 180
           DGVNFFACGLSMVIHPHNPHAPTTHLNYRYFETWNPDGSPQAWWFGGGADLTPSYLYEED
Sbjct: 121 DGVNFFACGLSMVIHPHNPHAPTTHLNYRYFETWNPDGSPQAWWFGGGADLTPSYLYEED 180

Query: 181 AILFHKLHKEALDKHDTDLYPRFKKWCDEYFFINHRGETXXXXXXXXXXXXXXXPQEILK 240
           AILFHKLHKEALDKHDTDLYPRFKKWCDEYFFINHRGET               PQEILK
Sbjct: 181 AILFHKLHKEALDKHDTDLYPRFKKWCDEYFFINHRGETRGIGGIFFDDLDDRDPQEILK 240

Query: 241 LVEDCFDAFLPSYLTIVARRKDMPYTEEEKQWQSLRRGRYVEFNLVLDRGTQFGLRTPGS 300
           LVEDCFDAFLPSYLTIVARRKDMPYTEEEKQWQSLRRGRYVEFNLVLDRGTQFGLRTPGS
Sbjct: 241 LVEDCFDAFLPSYLTIVARRKDMPYTEEEKQWQSLRRGRYVEFNLVLDRGTQFGLRTPGS 300

Query: 301 RVESILMSLPVTASWLYDHHPDAGSREDQLLEVLKHPKEWV 341
           RVESILMSLPVTASWLYDHHPDAGSREDQLLEVLKHPKEWV
Sbjct: 301 RVESILMSLPVTASWLYDHHPDAGSREDQLLEVLKHPKEWV 341

>Kwal_27.10935
          Length = 344

 Score =  564 bits (1454), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 266/332 (80%), Positives = 285/332 (85%)

Query: 10  NHSTAMPAPQDPKHLPIRQQMEQLILRKQKEITKGLETLDTVKFRADSWTRGNDGGGGTS 69
            H   MPAP DP  +PIRQQME+LI RKQ+EIT+GLETLDTVKFR DSWTRGNDGGGGTS
Sbjct: 13  THPAKMPAPVDPTRMPIRQQMEELIRRKQREITQGLETLDTVKFRPDSWTRGNDGGGGTS 72

Query: 70  MVLQNGTTFEKGGVNTSVVYGQLSPKAISAMRQDHKNLHLPVDPQTGEPNADGVNFFACG 129
           MVLQNGTTFEKGGVN SVVYGQLSP AISAM+ DHKNL LP DP+TG PNADGV FFACG
Sbjct: 73  MVLQNGTTFEKGGVNVSVVYGQLSPAAISAMKHDHKNLKLPTDPETGLPNADGVKFFACG 132

Query: 130 LSMVIHPHNPHAPTTHLNYRYFETWNPDGSPQAWWFGGGADLTPSYLYEEDAILFHKLHK 189
           LSMVIHP NPHAPTTHLNYRYFETWNPDG+PQ WWFGGGADLTPSYLYEEDA LFH+ HK
Sbjct: 133 LSMVIHPSNPHAPTTHLNYRYFETWNPDGTPQTWWFGGGADLTPSYLYEEDARLFHQEHK 192

Query: 190 EALDKHDTDLYPRFKKWCDEYFFINHRGETXXXXXXXXXXXXXXXPQEILKLVEDCFDAF 249
           +ALDKHDT LYPR+KKWCDEYFFI HR ET               PQEIL L+EDCFDAF
Sbjct: 193 KALDKHDTSLYPRYKKWCDEYFFIKHRNETRGIGGIFFDDKDDRDPQEILSLIEDCFDAF 252

Query: 250 LPSYLTIVARRKDMPYTEEEKQWQSLRRGRYVEFNLVLDRGTQFGLRTPGSRVESILMSL 309
           LPSYL I+ARRKDMP+TEEEKQWQ +RRGRYVEFNLVLDRGTQFGLRTPGSR ESILMSL
Sbjct: 253 LPSYLPIIARRKDMPFTEEEKQWQLIRRGRYVEFNLVLDRGTQFGLRTPGSRTESILMSL 312

Query: 310 PVTASWLYDHHPDAGSREDQLLEVLKHPKEWV 341
           PVTA W YDHHP+ GSRE++LL+VL+ P EWV
Sbjct: 313 PVTACWFYDHHPEPGSREEKLLKVLESPVEWV 344

>YDR044W (HEM13) [897] chr4 (546638..547624) Coproporphyrinogen III
           oxidase, catalyzes the oxidative decarboxylation of
           coproporphyrinogen III to proto-porhyrinogen IX, the
           sixth step in heme biosynthetic pathway, repressed by
           oxygen [987 bp, 328 aa]
          Length = 328

 Score =  546 bits (1407), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 257/327 (78%), Positives = 281/327 (85%)

Query: 15  MPAPQDPKHLPIRQQMEQLILRKQKEITKGLETLDTVKFRADSWTRGNDGGGGTSMVLQN 74
           MPAPQDP++LPIRQQME LI RKQ EIT+GLE++DTVKF AD+WTRGNDGGGGTSMV+Q+
Sbjct: 1   MPAPQDPRNLPIRQQMEALIRRKQAEITQGLESIDTVKFHADTWTRGNDGGGGTSMVIQD 60

Query: 75  GTTFEKGGVNTSVVYGQLSPKAISAMRQDHKNLHLPVDPQTGEPNADGVNFFACGLSMVI 134
           GTTFEKGGVN SVVYGQLSP A+SAM+ DHKNL LP DP+TG P  DGV FFACGLSMVI
Sbjct: 61  GTTFEKGGVNVSVVYGQLSPAAVSAMKADHKNLRLPEDPKTGLPVTDGVKFFACGLSMVI 120

Query: 135 HPHNPHAPTTHLNYRYFETWNPDGSPQAWWFGGGADLTPSYLYEEDAILFHKLHKEALDK 194
           HP NPHAPTTHLNYRYFETWN DG+PQ WWFGGGADLTPSYLYEED  LFH+LHK+ALDK
Sbjct: 121 HPVNPHAPTTHLNYRYFETWNQDGTPQTWWFGGGADLTPSYLYEEDGQLFHQLHKDALDK 180

Query: 195 HDTDLYPRFKKWCDEYFFINHRGETXXXXXXXXXXXXXXXPQEILKLVEDCFDAFLPSYL 254
           HDT LYPRFKKWCDEYF+I HR ET               PQEILK+VEDCFDAFLPSYL
Sbjct: 181 HDTALYPRFKKWCDEYFYITHRKETRGIGGIFFDDYDERDPQEILKMVEDCFDAFLPSYL 240

Query: 255 TIVARRKDMPYTEEEKQWQSLRRGRYVEFNLVLDRGTQFGLRTPGSRVESILMSLPVTAS 314
           TIV RRKDMPYT+EE+QWQ++RRGRYVEFNL+ DRGTQFGLRTPGSRVESILMSLP  AS
Sbjct: 241 TIVKRRKDMPYTKEEQQWQAIRRGRYVEFNLIYDRGTQFGLRTPGSRVESILMSLPEHAS 300

Query: 315 WLYDHHPDAGSREDQLLEVLKHPKEWV 341
           WLY+HHP  GSRE +LLEV   P+EWV
Sbjct: 301 WLYNHHPAPGSREAKLLEVTTKPREWV 327

>KLLA0F18546g 1706744..1707871 gi|26185795|emb|CAD58624.1
           Kluyveromyces lactis putative coproporphyrinogen
           oxidase, start by similarity
          Length = 375

 Score =  536 bits (1381), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 251/334 (75%), Positives = 279/334 (83%)

Query: 8   IENHSTAMPAPQDPKHLPIRQQMEQLILRKQKEITKGLETLDTVKFRADSWTRGNDGGGG 67
           +  HS           +PIR++ME L+ RKQ+EITKGLETLDTVKF+ADSW RGN+GGGG
Sbjct: 42  LNTHSKYYHCAMTDSQVPIRERMEALVRRKQQEITKGLETLDTVKFQADSWDRGNNGGGG 101

Query: 68  TSMVLQNGTTFEKGGVNTSVVYGQLSPKAISAMRQDHKNLHLPVDPQTGEPNADGVNFFA 127
            SMVLQNGTTFEKGGVN SVV+G LSP AI AM+ DHKNLHLP+DP TGEP+A GV FFA
Sbjct: 102 VSMVLQNGTTFEKGGVNVSVVHGNLSPPAIKAMKADHKNLHLPIDPATGEPDATGVKFFA 161

Query: 128 CGLSMVIHPHNPHAPTTHLNYRYFETWNPDGSPQAWWFGGGADLTPSYLYEEDAILFHKL 187
           CGLSMVIHP NPHAPTTHLNYRYFETWN DG+PQAWWFGGGADLTPSYLYEEDA LFH+L
Sbjct: 162 CGLSMVIHPINPHAPTTHLNYRYFETWNADGTPQAWWFGGGADLTPSYLYEEDAKLFHQL 221

Query: 188 HKEALDKHDTDLYPRFKKWCDEYFFINHRGETXXXXXXXXXXXXXXXPQEILKLVEDCFD 247
           HK+ALDK D  LYP++KKWCDEYF+I HR ET               P EIL++VE+CFD
Sbjct: 222 HKDALDKTDVALYPKYKKWCDEYFYIKHREETRGIGGIFFDDVDDRDPNEILQMVENCFD 281

Query: 248 AFLPSYLTIVARRKDMPYTEEEKQWQSLRRGRYVEFNLVLDRGTQFGLRTPGSRVESILM 307
           AFLPSYL I+ RRKDMPYTEEE+QWQ +RRGRYVEFNLVLDRGTQFGLRTPGSRVESILM
Sbjct: 282 AFLPSYLEIIKRRKDMPYTEEERQWQQIRRGRYVEFNLVLDRGTQFGLRTPGSRVESILM 341

Query: 308 SLPVTASWLYDHHPDAGSREDQLLEVLKHPKEWV 341
           SLPVTASWLYDHHP+  SRED+LL+VLK+P EWV
Sbjct: 342 SLPVTASWLYDHHPEVDSREDKLLQVLKNPVEWV 375

>Scas_569.3
          Length = 333

 Score =  532 bits (1370), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 250/329 (75%), Positives = 274/329 (83%)

Query: 13  TAMPAPQDPKHLPIRQQMEQLILRKQKEITKGLETLDTVKFRADSWTRGNDGGGGTSMVL 72
           + MPAPQD  HLPIRQQME LI RKQ EITKGLE+LDTVKF ADSWTRGNDGGGGTSMV+
Sbjct: 5   SIMPAPQDKTHLPIRQQMEALIRRKQAEITKGLESLDTVKFHADSWTRGNDGGGGTSMVI 64

Query: 73  QNGTTFEKGGVNTSVVYGQLSPKAISAMRQDHKNLHLPVDPQTGEPNADGVNFFACGLSM 132
            NG+TFEKGGVN SVVYG L+P A+ AM+ DHKNL LP DP+TG P  DGV FFACGLSM
Sbjct: 65  ANGSTFEKGGVNVSVVYGNLTPTAVLAMKDDHKNLKLPKDPKTGLPVPDGVKFFACGLSM 124

Query: 133 VIHPHNPHAPTTHLNYRYFETWNPDGSPQAWWFGGGADLTPSYLYEEDAILFHKLHKEAL 192
           VIHP NPHAPTTHLNYRYFETWNPDG+PQ+WWFGGGADLTP YLYEEDA  FH+LHK+AL
Sbjct: 125 VIHPKNPHAPTTHLNYRYFETWNPDGTPQSWWFGGGADLTPFYLYEEDAKHFHELHKKAL 184

Query: 193 DKHDTDLYPRFKKWCDEYFFINHRGETXXXXXXXXXXXXXXXPQEILKLVEDCFDAFLPS 252
           DKHD  LYP++KKWCDEYF+I HR ET               PQEILK+ EDCFDAFLPS
Sbjct: 185 DKHDKTLYPKYKKWCDEYFYIAHRKETRGIGGIFFDDFDDRDPQEILKICEDCFDAFLPS 244

Query: 253 YLTIVARRKDMPYTEEEKQWQSLRRGRYVEFNLVLDRGTQFGLRTPGSRVESILMSLPVT 312
           YL I+ +RKDMPYTEEEKQWQ +RRGRYVEFNL+ DRGTQFGLRTPGSRVESILMSLP  
Sbjct: 245 YLPIIEKRKDMPYTEEEKQWQLIRRGRYVEFNLIYDRGTQFGLRTPGSRVESILMSLPEH 304

Query: 313 ASWLYDHHPDAGSREDQLLEVLKHPKEWV 341
           ASWLY+HHP  GSRE +LLEV  +P+EW 
Sbjct: 305 ASWLYNHHPAPGSREAKLLEVTTNPREWA 333

>CAGL0K12100g 1183383..1184366 highly similar to sp|P11353
           Saccharomyces cerevisiae YDR044w HEM13
           coproporphyrinogen III oxidase, start by similarity
          Length = 327

 Score =  517 bits (1331), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 243/327 (74%), Positives = 274/327 (83%), Gaps = 1/327 (0%)

Query: 15  MPAPQDPKHLPIRQQMEQLILRKQKEITKGLETLDTVKFRADSWTRGNDGGGGTSMVLQN 74
           M APQDPKHLPIRQQME LI RKQKEIT+GLE++DTVKF AD+W RGNDGGGGTSMV+QN
Sbjct: 1   MTAPQDPKHLPIRQQMEALIRRKQKEITEGLESIDTVKFTADTWERGNDGGGGTSMVIQN 60

Query: 75  GTTFEKGGVNTSVVYGQLSPKAISAMRQDHKNLHLPVDPQTGEPNADGVNFFACGLSMVI 134
           G+TFEKGGVN SVVYG+L+P A+ AM+Q+HK+L LP +   G PN++GV FFACGLSMVI
Sbjct: 61  GSTFEKGGVNVSVVYGELTPGAVLAMKQEHKDLKLP-ESANGLPNSEGVKFFACGLSMVI 119

Query: 135 HPHNPHAPTTHLNYRYFETWNPDGSPQAWWFGGGADLTPSYLYEEDAILFHKLHKEALDK 194
           HP NP APTTHLNYRYFETWNPDG+PQ WWFGGGADLTP YL+EEDA  FHKLHK ALDK
Sbjct: 120 HPVNPLAPTTHLNYRYFETWNPDGTPQTWWFGGGADLTPFYLFEEDAEHFHKLHKAALDK 179

Query: 195 HDTDLYPRFKKWCDEYFFINHRGETXXXXXXXXXXXXXXXPQEILKLVEDCFDAFLPSYL 254
           HDT LYPRFKKWCDEYF+I HRGET               PQEILK+ EDCFDAFLPSYL
Sbjct: 180 HDTALYPRFKKWCDEYFYIAHRGETRGIGGIFFDDYNEKDPQEILKICEDCFDAFLPSYL 239

Query: 255 TIVARRKDMPYTEEEKQWQSLRRGRYVEFNLVLDRGTQFGLRTPGSRVESILMSLPVTAS 314
           TI+ RRKD+PY E++K WQ +RRGRY EFNL+ DRGTQFGLRTPGSRVESILMSLP+ AS
Sbjct: 240 TIMKRRKDLPYNEKQKNWQLIRRGRYAEFNLIYDRGTQFGLRTPGSRVESILMSLPLHAS 299

Query: 315 WLYDHHPDAGSREDQLLEVLKHPKEWV 341
           W+Y+HHP+ GS E +LLEV   P+EWV
Sbjct: 300 WVYNHHPEPGSEEAKLLEVTTKPREWV 326

>AGR030C [4340] [Homologous to ScYDR044W (HEM13) - SH]
           (768609..769583) [975 bp, 324 aa]
          Length = 324

 Score =  472 bits (1214), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 221/320 (69%), Positives = 256/320 (80%), Gaps = 3/320 (0%)

Query: 23  HLP-IRQQMEQLILRKQKEITKGLETLDTVKFRADSWTRGNDGGGGTSMVLQNGTTFEKG 81
           H P +R++ME+L+ RKQ+EIT   E +DTVKF+ADSW R  +GGGGTS VLQ+GTTFEK 
Sbjct: 5   HTPHMRERMEELVRRKQREITAAFEAIDTVKFKADSWER-KEGGGGTSCVLQHGTTFEKA 63

Query: 82  GVNTSVVYGQLSPKAISAMRQDHKNLHLPVDPQTGEPNADGVNFFACGLSMVIHPHNPHA 141
           GVN SVV+G+LSP A+SAMR +HKNLHLP DP TG+P A GV FFACG+S+V+HP NPHA
Sbjct: 64  GVNVSVVHGELSPAAVSAMRAEHKNLHLPTDPVTGQPAA-GVRFFACGISLVMHPVNPHA 122

Query: 142 PTTHLNYRYFETWNPDGSPQAWWFGGGADLTPSYLYEEDAILFHKLHKEALDKHDTDLYP 201
           PT HLNYRYFETW+  G PQ WWFGGG+DLTPSYLYEEDA LFH  HK ALD+ D  LYP
Sbjct: 123 PTVHLNYRYFETWDAAGKPQTWWFGGGSDLTPSYLYEEDARLFHAAHKAALDRTDPALYP 182

Query: 202 RFKKWCDEYFFINHRGETXXXXXXXXXXXXXXXPQEILKLVEDCFDAFLPSYLTIVARRK 261
           RFKKWCDEYF+I HRGE+               P+ +L++ EDC DAF+P+Y TI+ RRK
Sbjct: 183 RFKKWCDEYFWIKHRGESRGIGGIFYDDADDREPETLLRMAEDCLDAFVPAYKTIMLRRK 242

Query: 262 DMPYTEEEKQWQSLRRGRYVEFNLVLDRGTQFGLRTPGSRVESILMSLPVTASWLYDHHP 321
           DMPYT  E +WQ +RRGRYVEFNLVLDRGTQFGLRTPGSRVESILMSLPVTA W YDHHP
Sbjct: 243 DMPYTAAEHEWQQIRRGRYVEFNLVLDRGTQFGLRTPGSRVESILMSLPVTARWEYDHHP 302

Query: 322 DAGSREDQLLEVLKHPKEWV 341
             G+RE  LLEVL+HP+EWV
Sbjct: 303 AEGTREAALLEVLRHPREWV 322

>Sklu_2020.3 YCR045C, Contig c2020 5388-6827 reverse complement
          Length = 479

 Score = 29.3 bits (64), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 22/76 (28%), Positives = 34/76 (44%), Gaps = 19/76 (25%)

Query: 251 PSYLTIVARRKDMPYTEEEKQWQSLRRGRYVEFNLVLDRGTQFGLRTPGSRVESILMSLP 310
           P +L  ++RR  +PY+EE+        G Y EFN   DR      +  G  V + ++   
Sbjct: 115 PRHLARLSRRGPLPYSEED--------GWYQEFNYYYDR------KHRGDSVNAYIID-- 158

Query: 311 VTASWLYDHHPDAGSR 326
              + +Y  H D G R
Sbjct: 159 ---TGIYKQHKDLGGR 171

>CAGL0K07546g 744372..745343 similar to sp|P36069 Saccharomyces
           cerevisiae YKL128c suppressor of TPS2 mutant,
           hypothetical start
          Length = 323

 Score = 28.9 bits (63), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 23/73 (31%), Positives = 35/73 (47%), Gaps = 13/73 (17%)

Query: 265 YTEEEKQWQSLRRGRYVEFNLVLDRGTQFGLRTPGSRVESILMSLPVTASWLYDHHPDAG 324
           Y+E ++ WQ      ++E N  +DR T+ GLR   S V +    + +TA     HH    
Sbjct: 233 YSERDQLWQP----NHLETNDEIDRRTKIGLREMFSSVNTTDKVISLTA-----HHDVIE 283

Query: 325 SREDQLLEVLKHP 337
           S    +L  +KHP
Sbjct: 284 S----ILRNIKHP 292

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.318    0.136    0.432 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 11,782,859
Number of extensions: 512746
Number of successful extensions: 1131
Number of sequences better than 10.0: 9
Number of HSP's gapped: 1142
Number of HSP's successfully gapped: 9
Length of query: 341
Length of database: 16,596,109
Length adjustment: 102
Effective length of query: 239
Effective length of database: 13,065,073
Effective search space: 3122552447
Effective search space used: 3122552447
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 62 (28.5 bits)