Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Sklu_2357.71571577411e-102
Kwal_27.10925264643328e-39
YDR043C (NRG1)231613123e-36
AGR031W1401342993e-35
Scas_718.44266623076e-35
CAGL0K12078g463613081e-33
KLLA0F18524g357683012e-33
YBR066C (NRG2)220572837e-32
Scas_569.2293612792e-30
CAGL0L07480g314612766e-30
Kwal_14.2278463641735e-15
Sklu_2351.6548551692e-14
AFR471C389551673e-14
KLLA0E10989g474551631e-13
YER028C394621594e-13
Kwal_47.19045266591558e-13
Scas_712.42*290591541e-12
CAGL0K09372g396571551e-12
YGL209W (MIG2)382631551e-12
YGL035C (MIG1)504581533e-12
Scas_687.33288621513e-12
CAGL0A01628g424551524e-12
CAGL0C02519g318611505e-12
AGL207W277661489e-12
Scas_575.3455631462e-11
Kwal_27.10467302581443e-11
CAGL0M01870g315561443e-11
KLLA0B00605g239581416e-11
CAGL0L11880g980501411e-10
YER169W (RPH1)796501383e-10
YDR096W (GIS1)894501374e-10
Scas_681.19864551365e-10
Kwal_56.23453828551358e-10
KLLA0C17710g821501349e-10
AGR117C799551349e-10
Kwal_47.166211178681331e-09
CAGL0H04213g1321621322e-09
KLLA0F13046g1379561322e-09
YML081W1251571313e-09
Sklu_2181.1410601285e-09
KLLA0B04477g1332571287e-09
Kwal_47.17888786531251e-08
Sklu_2443.22213571231e-08
AGR172W1057561251e-08
Scas_703.231341571242e-08
Scas_709.32822611242e-08
Kwal_47.17241403601232e-08
Scas_602.9547561223e-08
AER159C1191571233e-08
KLLA0F23782g782531233e-08
YOR113W (AZF1)914551224e-08
CAGL0E04884g1489561224e-08
KLLA0B07909g922631224e-08
Scas_697.35839551215e-08
KLLA0F11682g374571206e-08
CAGL0M00594g1020571216e-08
CAGL0M06831g645591206e-08
Scas_718.36d330611207e-08
Kwal_26.8351698671207e-08
ACR264W769531207e-08
ACL057W520601208e-08
Scas_721.921152591199e-08
YKL062W (MSN4)630611191e-07
YDR216W (ADR1)1323561191e-07
YJR127C (ZMS1)1380571191e-07
KLLA0F26961g694611172e-07
ABR089C571611172e-07
YNL027W (CRZ1)678621162e-07
Kwal_26.8011190541142e-07
AFR580C838581162e-07
KLLA0C17072g474601153e-07
Scas_683.25879591153e-07
KLLA0E08679g596631144e-07
Sklu_2398.2288651144e-07
CAGL0K02145g317561135e-07
CAGL0F05995g597551136e-07
Scas_649.28730611127e-07
Scas_717.18354581118e-07
KLLA0F01463g781601129e-07
YMR037C (MSN2)704601111e-06
CAGL0L06072g300601101e-06
Kwal_47.16577881671102e-06
KLLA0A04609g423641092e-06
Kwal_14.2543711561092e-06
CAGL0M13189g541541092e-06
CAGL0G08107g625541083e-06
Kwal_27.11460531611073e-06
Scas_717.17525511073e-06
Kwal_14.2206254531064e-06
YPL230W391441064e-06
CAGL0K04631g1013611074e-06
Scas_719.681350651074e-06
Scas_656.1*102531005e-06
ADL198W547641065e-06
YJL056C (ZAP1)880581056e-06
Scas_695.2571601049e-06
Scas_720.33316661021e-05
YGR067C794591031e-05
CAGL0L03916g642531031e-05
Scas_707.31289611012e-05
Sklu_2436.9517711012e-05
Sklu_2389.2767561012e-05
Scas_711.56832551012e-05
CAGL0H07557g476461012e-05
KLLA0F20636g285521002e-05
AFL136W409441003e-05
YER130C443561003e-05
Scas_707.4633864985e-05
Scas_717.17d35057985e-05
AEL077W33654985e-05
Scas_712.232762976e-05
CAGL0E06116g61353976e-05
YMR182C (RGM1)21155967e-05
Scas_710.950558978e-05
ADL042W28152968e-05
AEL278W47643968e-05
Scas_627.6120780961e-04
CAGL0J05060g71358951e-04
YPR186C (PZF1)42943942e-04
Scas_693.3163555942e-04
Kwal_47.1833753669942e-04
ADL051W17351922e-04
YPR013C31753932e-04
YPR015C24758922e-04
KLLA0B03454g47243923e-04
YDR253C (MET32)19154913e-04
AEL174W66156923e-04
CAGL0I02816g29163914e-04
Kwal_23.540042943905e-04
ADR308C27855896e-04
Sklu_2244.327153897e-04
CAGL0G10021g39446880.001
CAGL0E04312g68871880.001
ADL040W33051870.001
KLLA0F10109g62371870.002
CAGL0E01331g68962870.002
AFR461C54469870.002
Kwal_34.1594627962860.002
Sklu_1527.120558850.002
KLLA0C16005g33147860.002
YPL038W (MET31)17752840.002
YMR070W (MOT3)49062860.002
CAGL0J01595g34460850.002
Scas_660.1236766850.003
KLLA0E18645g43159850.003
CAGL0L05786g34856850.003
AFR531W27462840.003
YLR131C (ACE2)77055840.004
KLLA0A10373g20665830.004
YHR006W (STP2)54168840.004
Scas_378.120851830.004
AGL246W22758830.004
Scas_568.519954820.005
Kwal_26.802150752830.005
Sklu_2289.129157820.006
Sklu_2359.572269830.006
CAGL0L00583g38841820.007
YDR463W (STP1)51968820.007
CAGL0K03003g64749810.008
AGL197W84444810.009
Scas_641.2453265810.010
CAGL0M04323g70350800.011
Scas_602.426652790.013
Kwal_56.2392574553800.015
ADL050W14660770.015
CAGL0K02343g116267790.016
Scas_717.60d16750770.017
Kwal_27.1182419967770.018
Scas_631.743343780.019
Scas_602.4d25651780.019
YDR146C (SWI5)70955790.020
KLLA0D16456g85477780.024
AGL071C39649770.026
CAGL0B02651g18955750.041
CAGL0K06413g35970750.049
KLLA0F07073g55827750.056
Scas_713.5262048750.062
AGR186C28752740.071
KLLA0D11902g28954730.077
Kwal_26.930030458720.10
YPR022C113356730.10
Kwal_27.1016728568720.13
Sklu_2154.319065700.17
CAGL0H04873g45127690.29
CAGL0L12562g22350680.32
YDL048C (STP4)49065680.38
CAGL0I02838g65540680.41
YGL254W (FZF1)29948670.54
Scas_670.243561670.58
KLLA0E13519g23062660.58
Scas_721.5619956660.63
AFR588W31931660.64
Sklu_2206.235831660.67
Sklu_2126.544849660.87
CAGL0K04257g54745651.2
Scas_604.458542641.6
CAGL0E03762g58449631.7
AGL205C615131622.9
Scas_683.3047863613.4
Sklu_2030.342640613.5
Kwal_34.1606899943604.5
Kwal_33.1561299943604.5
Scas_636.14d27550595.6
Scas_627.17d27549595.8
CAGL0K04697g51563596.9
YLR375W34331588.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Sklu_2357.7
         (157 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Sklu_2357.7 YDR043C, Contig c2357 9816-10289 reverse complement       290   e-102
Kwal_27.10925                                                         132   8e-39
YDR043C (NRG1) [896] chr4 complement(542670..543365) Transcripti...   124   3e-36
AGR031W [4341] [Homologous to ScYDR043C (NRG1) - SH; ScYBR066C (...   119   3e-35
Scas_718.44                                                           122   6e-35
CAGL0K12078g complement(1168989..1170380) weakly similar to sp|Q...   123   1e-33
KLLA0F18524g complement(1701498..1702571) some similarities with...   120   2e-33
YBR066C (NRG2) [256] chr2 complement(369998..370660) Suppressor ...   113   7e-32
Scas_569.2                                                            112   2e-30
CAGL0L07480g complement(822240..823184) some similarities with s...   110   6e-30
Kwal_14.2278                                                           71   5e-15
Sklu_2351.6 YGL035C, Contig c2351 12964-14610 reverse complement       70   2e-14
AFR471C [3663] [Homologous to ScYGL035C (MIG1) - SH; ScYGL209W (...    69   3e-14
KLLA0E10989g 966805..968229 gi|1709030|sp|P50898|MIG1_KLULA Kluy...    67   1e-13
YER028C (MIG3) [1453] chr5 complement(210691..211875) Protein th...    66   4e-13
Kwal_47.19045                                                          64   8e-13
Scas_712.42*                                                           64   1e-12
CAGL0K09372g complement(924818..926008) similar to sp|P53035 Sac...    64   1e-12
YGL209W (MIG2) [1787] chr7 (95860..97008) Zinc-finger protein in...    64   1e-12
YGL035C (MIG1) [1940] chr7 complement(431551..433065) Zinc-finge...    64   3e-12
Scas_687.33                                                            63   3e-12
CAGL0A01628g 156635..157909 similar to sp|P27705 Saccharomyces c...    63   4e-12
CAGL0C02519g 253051..254007 weakly similar to sp|P39943 Saccharo...    62   5e-12
AGL207W [4105] [Homologous to NOHBY] complement(310750..311583) ...    62   9e-12
Scas_575.3                                                             61   2e-11
Kwal_27.10467                                                          60   3e-11
CAGL0M01870g complement(219813..220760) some similarities with t...    60   3e-11
KLLA0B00605g complement(46736..47455) some similarities with sp|...    59   6e-11
CAGL0L11880g 1272624..1275566 some similarities with sp|P39956 S...    59   1e-10
YER169W (RPH1) [1597] chr5 (523364..525754) DNA damage-responsiv...    58   3e-10
YDR096W (GIS1) [946] chr4 (637133..639817) DNA damage-responsive...    57   4e-10
Scas_681.19                                                            57   5e-10
Kwal_56.23453                                                          57   8e-10
KLLA0C17710g 1569331..1571796 similar to sp|P39956 Saccharomyces...    56   9e-10
AGR117C [4428] [Homologous to ScYER169W (RPH1) - SH; ScYDR096W (...    56   9e-10
Kwal_47.16621                                                          56   1e-09
CAGL0H04213g 398544..402509 similar to sp|Q04545 Saccharomyces c...    55   2e-09
KLLA0F13046g 1201353..1205492 some similarities with sp|P07248 S...    55   2e-09
YML081W (YML081W) [3888] chr13 (104777..108532) Protein with sim...    55   3e-09
Sklu_2181.1 YER130C, Contig c2181 4015-5247                            54   5e-09
KLLA0B04477g 400019..404017 similar to sp|Q04545 Saccharomyces c...    54   7e-09
Kwal_47.17888                                                          53   1e-08
Sklu_2443.22 , Contig c2443 45390-46027                                52   1e-08
AGR172W [4483] [Homologous to ScYDR216W (ADR1) - SH] complement(...    53   1e-08
Scas_703.23                                                            52   2e-08
Scas_709.32                                                            52   2e-08
Kwal_47.17241                                                          52   2e-08
Scas_602.9                                                             52   3e-08
AER159C [2662] [Homologous to ScYML081W - SH; ScYJR127C (ZMS1) -...    52   3e-08
KLLA0F23782g 2219920..2222268 some similarities with sp|P41696 S...    52   3e-08
YOR113W (AZF1) [4916] chr15 (534075..536819) Glucose-dependent t...    52   4e-08
CAGL0E04884g complement(469295..473764) weakly similar to sp|P07...    52   4e-08
KLLA0B07909g 697885..700653 some similarities with sp|P53243 Sac...    52   4e-08
Scas_697.35                                                            51   5e-08
KLLA0F11682g complement(1068992..1070116) some similarities with...    51   6e-08
CAGL0M00594g 70659..73721 similar to sp|P46974 Saccharomyces cer...    51   6e-08
CAGL0M06831g 695162..697099 weakly similar to sp|P53968 Saccharo...    51   6e-08
Scas_718.36d                                                           51   7e-08
Kwal_26.8351                                                           51   7e-08
ACR264W [1311] [Homologous to ScYOR113W (AZF1) - SH] complement(...    51   7e-08
ACL057W [992] [Homologous to ScYER130C - SH] complement(264934.....    51   8e-08
Scas_721.92                                                            50   9e-08
YKL062W (MSN4) [3197] chr11 (322873..324765) Zinc-finger transcr...    50   1e-07
YDR216W (ADR1) [1053] chr4 (895027..898998) Zinc-finger transcri...    50   1e-07
YJR127C (ZMS1) [3019] chr10 complement(658832..662974) Protein w...    50   1e-07
KLLA0F26961g 2486804..2488888 some similarities with sp|P33748 S...    50   2e-07
ABR089C [680] [Homologous to ScYKL062W (MSN4) - SH; ScYMR037C (M...    50   2e-07
YNL027W (CRZ1) [4559] chr14 (579578..581614) Calcineurin-depende...    49   2e-07
Kwal_26.8011                                                           49   2e-07
AFR580C [3772] [Homologous to ScYGR067C - SH] (1478059..1480575)...    49   2e-07
KLLA0C17072g 1494101..1495525 weakly similar to sp|P39959 Saccha...    49   3e-07
Scas_683.25                                                            49   3e-07
KLLA0E08679g 777005..778795 some similarities with sp|P53968 Sac...    49   4e-07
Sklu_2398.2 , Contig c2398 2210-3076 reverse complement                49   4e-07
CAGL0K02145g 190055..191008 some similarities with sp|P39959 Sac...    48   5e-07
CAGL0F05995g complement(598819..600612) some similarities with s...    48   6e-07
Scas_649.28                                                            48   7e-07
Scas_717.18                                                            47   8e-07
KLLA0F01463g 140343..142688 some similarities with sp|P47043 Sac...    48   9e-07
YMR037C (MSN2) [4001] chr13 complement(344402..346516) Zinc-fing...    47   1e-06
CAGL0L06072g complement(679924..680826) some similarities with s...    47   1e-06
Kwal_47.16577                                                          47   2e-06
KLLA0A04609g complement(411494..412765) some similarities with s...    47   2e-06
Kwal_14.2543                                                           47   2e-06
CAGL0M13189g complement(1294293..1295918) weakly similar to sp|P...    47   2e-06
CAGL0G08107g 768772..770649 weakly similar to tr|Q03833 Saccharo...    46   3e-06
Kwal_27.11460                                                          46   3e-06
Scas_717.17                                                            46   3e-06
Kwal_14.2206                                                           45   4e-06
YPL230W (YPL230W) [5219] chr16 (115312..116487) Putative transcr...    45   4e-06
CAGL0K04631g complement(440721..443762) some similarities with s...    46   4e-06
Scas_719.68                                                            46   4e-06
Scas_656.1*                                                            43   5e-06
ADL198W [1543] [Homologous to ScYNL027W (CRZ1) - SH] complement(...    45   5e-06
YJL056C (ZAP1) [2855] chr10 complement(330347..332989) Zinc-resp...    45   6e-06
Scas_695.2                                                             45   9e-06
Scas_720.33                                                            44   1e-05
YGR067C (YGR067C) [2029] chr7 complement(622404..624788) Protein...    44   1e-05
CAGL0L03916g complement(448955..450883) weakly similar to sp|P41...    44   1e-05
Scas_707.31                                                            44   2e-05
Sklu_2436.9 YDR463W, Contig c2436 18516-20069                          44   2e-05
Sklu_2389.2 YJL056C, Contig c2389 3525-5828                            44   2e-05
Scas_711.56                                                            44   2e-05
CAGL0H07557g 738086..739516 some similarities with sp|P32805 Sac...    44   2e-05
KLLA0F20636g complement(1914452..1915309) some similarities with...    43   2e-05
AFL136W [3059] [Homologous to ScYPL230W - SH; ScYMR182C (RGM1) -...    43   3e-05
YER130C (YER130C) [1560] chr5 complement(421111..422442) Protein...    43   3e-05
Scas_707.46                                                            42   5e-05
Scas_717.17d                                                           42   5e-05
AEL077W [2429] [Homologous to NOHBY] complement(483028..484038) ...    42   5e-05
Scas_712.2                                                             42   6e-05
CAGL0E06116g complement(604708..606549) some similarities with t...    42   6e-05
YMR182C (RGM1) [4137] chr13 complement(624531..625166) Transcrip...    42   7e-05
Scas_710.9                                                             42   8e-05
ADL042W [1699] [Homologous to ScYPR015C - SH] complement(615818....    42   8e-05
AEL278W [2227] [Homologous to ScYPR186C (PZF1) - SH] complement(...    42   8e-05
Scas_627.6                                                             42   1e-04
CAGL0J05060g 478650..480791 similar to sp|P47043 Saccharomyces c...    41   1e-04
YPR186C (PZF1) [5600] chr16 complement(909727..911016) RNA polym...    41   2e-04
Scas_693.31                                                            41   2e-04
Kwal_47.18337                                                          41   2e-04
ADL051W [1690] [Homologous to NOHBY] complement(595496..596017) ...    40   2e-04
YPR013C (YPR013C) [5448] chr16 complement(584627..585580) Putati...    40   2e-04
YPR015C (YPR015C) [5449] chr16 complement(590278..591021) Protei...    40   2e-04
KLLA0B03454g complement(314015..315433) some similarities with s...    40   3e-04
YDR253C (MET32) [1086] chr4 complement(963982..964557) Zinc-fing...    40   3e-04
AEL174W [2332] [Homologous to ScYJL056C (ZAP1) - SH] complement(...    40   3e-04
CAGL0I02816g complement(247817..248692) similar to sp|P41696 Sac...    40   4e-04
Kwal_23.5400                                                           39   5e-04
ADR308C [2049] [Homologous to NOHBY] (1241869..1242705) [837 bp,...    39   6e-04
Sklu_2244.3 , Contig c2244 4100-4915 reverse complement                39   7e-04
CAGL0G10021g complement(959154..960338) similar to sp|P39933 Sac...    39   0.001
CAGL0E04312g 412563..414629 some similarities with sp|Q00947 Sac...    39   0.001
ADL040W [1701] [Homologous to ScYPR013C - SH] complement(618855....    38   0.001
KLLA0F10109g complement(939195..941066) weakly similar to sp|Q00...    38   0.002
CAGL0E01331g 124362..126431 weakly similar to sp|P08153 Saccharo...    38   0.002
AFR461C [3653] [Homologous to ScYDR463W (STP1) - SH] (1269565..1...    38   0.002
Kwal_34.15946                                                          38   0.002
Sklu_1527.1 YPL038W, Contig c1527 389-1006                             37   0.002
KLLA0C16005g 1397274..1398269 some similarities with sgd|S000615...    38   0.002
YPL038W (MET31) [5401] chr16 (480530..481063) Zinc-finger protei...    37   0.002
YMR070W (MOT3) [4029] chr13 (409153..410625) Transcription facto...    38   0.002
CAGL0J01595g 151584..152618 some similarities with tr|Q12531 Sac...    37   0.002
Scas_660.12                                                            37   0.003
KLLA0E18645g complement(1648263..1649558) some similarities with...    37   0.003
CAGL0L05786g complement(636176..637222) some similarities with t...    37   0.003
AFR531W [3723] [Homologous to ScAFR531W] complement(1389487..139...    37   0.003
YLR131C (ACE2) [3541] chr12 complement(404511..406823) Metalloth...    37   0.004
KLLA0A10373g complement(907244..907864) some similarities with c...    37   0.004
YHR006W (STP2) [2292] chr8 (117808..119433) Transcription factor...    37   0.004
Scas_378.1                                                             37   0.004
AGL246W [4066] [Homologous to ScYDR253C (MET32) - SH; ScYPL038W ...    37   0.004
Scas_568.5                                                             36   0.005
Kwal_26.8021                                                           37   0.005
Sklu_2289.1 YGL254W, Contig c2289 150-1025 reverse complement          36   0.006
Sklu_2359.5 YPR022C, Contig c2359 10655-12818                          37   0.006
CAGL0L00583g 69547..70713 similar to tr|Q12132 Saccharomyces cer...    36   0.007
YDR463W (STP1) [1281] chr4 (1386804..1388363) Transcription fact...    36   0.007
CAGL0K03003g 276756..278699 weakly similar to sp|P54785 Saccharo...    36   0.008
AGL197W [4115] [Homologous to ScYDR146C (SWI5) - SH; ScYLR131C (...    36   0.009
Scas_641.24                                                            36   0.010
CAGL0M04323g complement(474158..476269) similar to sp|P21192 Sac...    35   0.011
Scas_602.4                                                             35   0.013
Kwal_56.23925                                                          35   0.015
ADL050W [1691] [Homologous to NOHBY] complement(597229..597669) ...    34   0.015
CAGL0K02343g 208645..212133 similar to tr|Q12139 Saccharomyces c...    35   0.016
Scas_717.60d                                                           34   0.017
Kwal_27.11824                                                          34   0.018
Scas_631.7                                                             35   0.019
Scas_602.4d                                                            35   0.019
YDR146C (SWI5) [991] chr4 complement(748607..750736) Transcripti...    35   0.020
KLLA0D16456g complement(1387846..1390410) weakly similar to sp|P...    35   0.024
AGL071C [4240] [Homologous to ScYMR070W (MOT3) - SH] (574723..57...    34   0.026
CAGL0B02651g complement(253495..254064) weakly similar to sp|Q12...    33   0.041
CAGL0K06413g 627811..628890 some similarities with sp|Q00947 Sac...    33   0.049
KLLA0F07073g 675221..676897 some similarities with sgd|S0004367 ...    33   0.056
Scas_713.52                                                            33   0.062
AGR186C [4497] [Homologous to NOHBY] (1099513..1100376) [864 bp,...    33   0.071
KLLA0D11902g 1015273..1016142 some similarities with sp|Q12041 S...    33   0.077
Kwal_26.9300                                                           32   0.10 
YPR022C (YPR022C) [5456] chr16 complement(603906..607307) Predic...    33   0.10 
Kwal_27.10167                                                          32   0.13 
Sklu_2154.3 , Contig c2154 4677-5249 reverse complement                32   0.17 
CAGL0H04873g complement(465069..466424) some similarities with t...    31   0.29 
CAGL0L12562g complement(1350878..1351549) similar to sp|Q12041 S...    31   0.32 
YDL048C (STP4) [816] chr4 complement(366739..368211) Protein wit...    31   0.38 
CAGL0I02838g complement(248704..250671) similar to sp|P41696 Sac...    31   0.41 
YGL254W (FZF1) [1746] chr7 (22304..23203) Transcription factor i...    30   0.54 
Scas_670.2                                                             30   0.58 
KLLA0E13519g complement(1190615..1191307) some similarities with...    30   0.58 
Scas_721.56                                                            30   0.63 
AFR588W [3780] [Homologous to ScYLR375W (STP3) - SH; ScYDL048C (...    30   0.64 
Sklu_2206.2 YLR375W, Contig c2206 7136-8212                            30   0.67 
Sklu_2126.5 YHL027W, Contig c2126 7763-9109                            30   0.87 
CAGL0K04257g complement(391287..392930) some similarities with s...    30   1.2  
Scas_604.4                                                             29   1.6  
CAGL0E03762g complement(351003..352757) weakly similar to sp|P33...    29   1.7  
AGL205C [4107] [Homologous to ScYDR052C (DBF4) - SH] (314646..31...    28   2.9  
Scas_683.30                                                            28   3.4  
Sklu_2030.3 YGR044C, Contig c2030 2836-4116                            28   3.5  
Kwal_34.16068                                                          28   4.5  
Kwal_33.15612                                                          28   4.5  
Scas_636.14d                                                           27   5.6  
Scas_627.17d                                                           27   5.8  
CAGL0K04697g 458366..459913 some similarities with tr|Q07351 Sac...    27   6.9  
YLR375W (YLR375W) [3755] chr12 (871696..872727) Protein with str...    27   8.0  

>Sklu_2357.7 YDR043C, Contig c2357 9816-10289 reverse complement
          Length = 157

 Score =  290 bits (741), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 141/157 (89%), Positives = 141/157 (89%)

Query: 1   MDHHPTQLPGISSIMCDTKKHQTMLPPLVYSGANQNIEAQLKKILDRTAFTTAALPPKPE 60
           MDHHPTQLPGISSIMCDTKKHQTMLPPLVYSGANQNIEAQLKKILDRTAFTTAALPPKPE
Sbjct: 1   MDHHPTQLPGISSIMCDTKKHQTMLPPLVYSGANQNIEAQLKKILDRTAFTTAALPPKPE 60

Query: 61  IRPAVTVCAHQXXXXXXXXXXXXXXXXATANVPIEQRRRYVCKICSRGFTTSGHLARHNR 120
           IRPAVTVCAHQ                ATANVPIEQRRRYVCKICSRGFTTSGHLARHNR
Sbjct: 61  IRPAVTVCAHQLPLSKPKKVSKKVSKPATANVPIEQRRRYVCKICSRGFTTSGHLARHNR 120

Query: 121 IHTGEKNHVCPFEGCGQRFSRHDNCVQHYRTHLKTNY 157
           IHTGEKNHVCPFEGCGQRFSRHDNCVQHYRTHLKTNY
Sbjct: 121 IHTGEKNHVCPFEGCGQRFSRHDNCVQHYRTHLKTNY 157

>Kwal_27.10925
          Length = 264

 Score =  132 bits (332), Expect = 8e-39,   Method: Compositional matrix adjust.
 Identities = 57/64 (89%), Positives = 61/64 (95%)

Query: 93  PIEQRRRYVCKICSRGFTTSGHLARHNRIHTGEKNHVCPFEGCGQRFSRHDNCVQHYRTH 152
           P+EQRRRYVCKIC +GFTTSGHLARHNRIHTGEKNHVCP EGCGQRFSRHDNCVQHY+TH
Sbjct: 194 PVEQRRRYVCKICVKGFTTSGHLARHNRIHTGEKNHVCPHEGCGQRFSRHDNCVQHYKTH 253

Query: 153 LKTN 156
           L+ N
Sbjct: 254 LRRN 257

>YDR043C (NRG1) [896] chr4 complement(542670..543365)
           Transcriptional repressor involved in glucose repression
           of STA1 and MUC1, suppressor of snf mutations, has two
           tandem C2H2-type zinc fingers [696 bp, 231 aa]
          Length = 231

 Score =  124 bits (312), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 52/61 (85%), Positives = 59/61 (96%)

Query: 94  IEQRRRYVCKICSRGFTTSGHLARHNRIHTGEKNHVCPFEGCGQRFSRHDNCVQHYRTHL 153
           +EQRR+Y+CKIC+RGFTTSGHLARHNRIHTGEKNH CP++GC QRFSRHDNC+QHYRTHL
Sbjct: 168 LEQRRKYICKICARGFTTSGHLARHNRIHTGEKNHCCPYKGCTQRFSRHDNCLQHYRTHL 227

Query: 154 K 154
           K
Sbjct: 228 K 228

>AGR031W [4341] [Homologous to ScYDR043C (NRG1) - SH; ScYBR066C
           (NRG2) - SH] complement(769926..770348) [423 bp, 140 aa]
          Length = 140

 Score =  119 bits (299), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 68/134 (50%), Positives = 83/134 (61%), Gaps = 28/134 (20%)

Query: 22  QTMLPPLVYS-GANQNIEAQLKKILDRTAFTTAALPPKPEIRPAVTVCAHQXXXXXXXXX 80
           + +LPPL  S  + + +E  LK+ LDR AF  AA P +                      
Sbjct: 28  RVLLPPLASSHQSMRRLETYLKQALDRGAFGCAAAPARKR-------------------- 67

Query: 81  XXXXXXXATANVPIEQRRRYVCKICSRGFTTSGHLARHNRIHTGEKNHVCPFEGCGQRFS 140
                  A A VP+E+RR+++C+ C +GFTTSGHLARHNRIHTGEKNH C F GCGQRFS
Sbjct: 68  -------APAPVPVEKRRKHLCQTCGKGFTTSGHLARHNRIHTGEKNHACHFPGCGQRFS 120

Query: 141 RHDNCVQHYRTHLK 154
           RHDNC+QHYRTHLK
Sbjct: 121 RHDNCLQHYRTHLK 134

>Scas_718.44
          Length = 266

 Score =  122 bits (307), Expect = 6e-35,   Method: Compositional matrix adjust.
 Identities = 51/62 (82%), Positives = 57/62 (91%)

Query: 95  EQRRRYVCKICSRGFTTSGHLARHNRIHTGEKNHVCPFEGCGQRFSRHDNCVQHYRTHLK 154
           + RR++VCKICS GFTTSGHL+RHNRIHTGEKNH CPFEGC Q+FSRHDNC+QHYRTHLK
Sbjct: 205 QNRRKHVCKICSTGFTTSGHLSRHNRIHTGEKNHSCPFEGCNQKFSRHDNCLQHYRTHLK 264

Query: 155 TN 156
            N
Sbjct: 265 KN 266

>CAGL0K12078g complement(1168989..1170380) weakly similar to
           sp|Q03125 Saccharomyces cerevisiae YDR043c NRG1,
           hypothetical start
          Length = 463

 Score =  123 bits (308), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 50/61 (81%), Positives = 58/61 (95%)

Query: 94  IEQRRRYVCKICSRGFTTSGHLARHNRIHTGEKNHVCPFEGCGQRFSRHDNCVQHYRTHL 153
           IE RR+Y+CK+C +GFTTSGHLARHNRIHTGEK HVCP+EGCGQRF+RHDNC+QHY+THL
Sbjct: 396 IELRRKYLCKVCGKGFTTSGHLARHNRIHTGEKRHVCPYEGCGQRFNRHDNCLQHYKTHL 455

Query: 154 K 154
           K
Sbjct: 456 K 456

>KLLA0F18524g complement(1701498..1702571) some similarities with
           sp|Q03125 Saccharomyces cerevisiae YDR043c NRG1
           transcriptional repressor for glucose repression of STA1
           gene expression, hypothetical start
          Length = 357

 Score =  120 bits (301), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 51/68 (75%), Positives = 58/68 (85%)

Query: 89  TANVPIEQRRRYVCKICSRGFTTSGHLARHNRIHTGEKNHVCPFEGCGQRFSRHDNCVQH 148
           T ++P+ +RR+Y+CKICSRGFTTSGHLARHNRIHTGEK H C F GC QRFSRHDN +QH
Sbjct: 273 TKDLPLAERRKYICKICSRGFTTSGHLARHNRIHTGEKRHQCQFPGCNQRFSRHDNYIQH 332

Query: 149 YRTHLKTN 156
           YRTH K N
Sbjct: 333 YRTHFKNN 340

>YBR066C (NRG2) [256] chr2 complement(369998..370660) Suppressor of
           snf mutations, predicted transcription factor with two
           tandem C2H2-type zinc fingers, involved in glucose
           repression of MUC1 transcription [663 bp, 220 aa]
          Length = 220

 Score =  113 bits (283), Expect = 7e-32,   Method: Compositional matrix adjust.
 Identities = 49/57 (85%), Positives = 52/57 (91%)

Query: 96  QRRRYVCKICSRGFTTSGHLARHNRIHTGEKNHVCPFEGCGQRFSRHDNCVQHYRTH 152
           QR R+ CKICS GFTTSGHL+RHNRIHTGEKNH+CP EGCGQRFSRHDNC QHYRTH
Sbjct: 149 QRTRHFCKICSTGFTTSGHLSRHNRIHTGEKNHICPHEGCGQRFSRHDNCNQHYRTH 205

>Scas_569.2
          Length = 293

 Score =  112 bits (279), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 46/61 (75%), Positives = 54/61 (88%)

Query: 94  IEQRRRYVCKICSRGFTTSGHLARHNRIHTGEKNHVCPFEGCGQRFSRHDNCVQHYRTHL 153
           +E+RR+Y+CK+CS+GFTTSGHLARHNRIHTGEK H C + GC  +FSRHDNCVQHYRTH 
Sbjct: 222 LEKRRKYICKVCSKGFTTSGHLARHNRIHTGEKKHHCSYPGCYLKFSRHDNCVQHYRTHF 281

Query: 154 K 154
           K
Sbjct: 282 K 282

>CAGL0L07480g complement(822240..823184) some similarities with
           sp|P38082 Saccharomyces cerevisiae YBR066c NRG2 or
           sp|Q03125 Saccharomyces cerevisiae YDR043c NRG1,
           hypothetical start
          Length = 314

 Score =  110 bits (276), Expect = 6e-30,   Method: Compositional matrix adjust.
 Identities = 46/61 (75%), Positives = 54/61 (88%)

Query: 94  IEQRRRYVCKICSRGFTTSGHLARHNRIHTGEKNHVCPFEGCGQRFSRHDNCVQHYRTHL 153
           IEQRR+++C+IC  GFTTSGHL+RH +IHTGEK+HVCP EGC Q FSRHDNC+QHYRTH 
Sbjct: 246 IEQRRKHICQICLTGFTTSGHLSRHAKIHTGEKSHVCPHEGCNQSFSRHDNCLQHYRTHS 305

Query: 154 K 154
           K
Sbjct: 306 K 306

>Kwal_14.2278
          Length = 463

 Score = 71.2 bits (173), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 33/64 (51%), Positives = 38/64 (59%)

Query: 89  TANVPIEQRRRYVCKICSRGFTTSGHLARHNRIHTGEKNHVCPFEGCGQRFSRHDNCVQH 148
           +AN+  E  R Y+C ICSR F    H  RH R HTGEK H C F GC +RFSR D   +H
Sbjct: 12  SANLGQESPRPYICPICSRAFHRLEHQTRHIRTHTGEKPHACDFAGCTKRFSRSDELTRH 71

Query: 149 YRTH 152
            R H
Sbjct: 72  KRIH 75

>Sklu_2351.6 YGL035C, Contig c2351 12964-14610 reverse complement
          Length = 548

 Score = 69.7 bits (169), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 32/55 (58%), Positives = 34/55 (61%)

Query: 98  RRYVCKICSRGFTTSGHLARHNRIHTGEKNHVCPFEGCGQRFSRHDNCVQHYRTH 152
           R YVC ICSR F    H  RH R HTGEK H C F GCG+RFSR D   +H R H
Sbjct: 32  RPYVCPICSRAFHRLEHQTRHIRTHTGEKPHACEFPGCGKRFSRSDELTRHTRIH 86

>AFR471C [3663] [Homologous to ScYGL035C (MIG1) - SH; ScYGL209W
           (MIG2) - NSH] (1287076..1288245) [1170 bp, 389 aa]
          Length = 389

 Score = 68.9 bits (167), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 31/55 (56%), Positives = 34/55 (61%)

Query: 98  RRYVCKICSRGFTTSGHLARHNRIHTGEKNHVCPFEGCGQRFSRHDNCVQHYRTH 152
           R YVC IC+R F    H  RH R HTGEK H C F GCG+RFSR D   +H R H
Sbjct: 20  RPYVCPICARAFHRLEHQTRHIRTHTGEKPHACDFAGCGKRFSRQDELTRHRRIH 74

>KLLA0E10989g 966805..968229 gi|1709030|sp|P50898|MIG1_KLULA
           Kluyveromyces lactis Regulatory protein MIG1, start by
           similarity
          Length = 474

 Score = 67.4 bits (163), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 30/55 (54%), Positives = 33/55 (60%)

Query: 98  RRYVCKICSRGFTTSGHLARHNRIHTGEKNHVCPFEGCGQRFSRHDNCVQHYRTH 152
           R YVC IC RGF    H  RH R HTGE+ H C F GC +RFSR D   +H R H
Sbjct: 24  RPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIH 78

>YER028C (MIG3) [1453] chr5 complement(210691..211875) Protein that
           contains two tandem C2H2-type zinc finger domains, has
           strong similarity to Mig2p, a Tup1p-dependent and
           glucose-dependent transcriptional repressor [1185 bp,
           394 aa]
          Length = 394

 Score = 65.9 bits (159), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 31/62 (50%), Positives = 37/62 (59%)

Query: 93  PIEQRRRYVCKICSRGFTTSGHLARHNRIHTGEKNHVCPFEGCGQRFSRHDNCVQHYRTH 152
           P   +R + C+ICSRGF    H  RH R HTGEK H C  +GC + FSR D   +H RTH
Sbjct: 10  PDNDQRPFRCEICSRGFHRLEHKKRHGRTHTGEKPHKCTVQGCPKSFSRSDELKRHLRTH 69

Query: 153 LK 154
            K
Sbjct: 70  TK 71

>Kwal_47.19045
          Length = 266

 Score = 64.3 bits (155), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 29/59 (49%), Positives = 36/59 (61%)

Query: 98  RRYVCKICSRGFTTSGHLARHNRIHTGEKNHVCPFEGCGQRFSRHDNCVQHYRTHLKTN 156
           R + C +C +GF    H  RH R HTGEK H C F GC +RFSR D   +H RTH+ T+
Sbjct: 12  RPFKCDMCGKGFHRLEHKRRHIRTHTGEKPHSCNFPGCVKRFSRSDELKRHVRTHMSTS 70

>Scas_712.42*
          Length = 290

 Score = 63.9 bits (154), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 30/59 (50%), Positives = 36/59 (61%)

Query: 98  RRYVCKICSRGFTTSGHLARHNRIHTGEKNHVCPFEGCGQRFSRHDNCVQHYRTHLKTN 156
           R + C+ C+RGF    H  RH R HTGEK H C F GCG+ FSR D   +H RTH  T+
Sbjct: 16  RPFRCETCARGFHRLEHKKRHMRTHTGEKPHHCAFPGCGKGFSRSDELKRHLRTHTSTS 74

>CAGL0K09372g complement(924818..926008) similar to sp|P53035
           Saccharomyces cerevisiae YGL209w MIG2 C2H2 zinc-finger
           protein, start by similarity
          Length = 396

 Score = 64.3 bits (155), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 30/57 (52%), Positives = 35/57 (61%)

Query: 96  QRRRYVCKICSRGFTTSGHLARHNRIHTGEKNHVCPFEGCGQRFSRHDNCVQHYRTH 152
           + R + C+ CSRGF    H  RH R HTGEK H C F GCG+ FSR D   +H RTH
Sbjct: 13  KERPFKCEHCSRGFHRLEHKKRHMRTHTGEKPHGCSFPGCGKSFSRSDELKRHNRTH 69

 Score = 28.9 bits (63), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 11/20 (55%), Positives = 13/20 (65%)

Query: 105 CSRGFTTSGHLARHNRIHTG 124
           C + F+ S  L RHNR HTG
Sbjct: 52  CGKSFSRSDELKRHNRTHTG 71

>YGL209W (MIG2) [1787] chr7 (95860..97008) Zinc-finger protein
           involved in glucose repression of SUC2, contains two
           tandem zinc-fingers [1149 bp, 382 aa]
          Length = 382

 Score = 64.3 bits (155), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 36/63 (57%), Gaps = 1/63 (1%)

Query: 91  NVPIEQRRR-YVCKICSRGFTTSGHLARHNRIHTGEKNHVCPFEGCGQRFSRHDNCVQHY 149
           N P++   R + C  C RGF    H  RH R HTGEK H C F GCG+ FSR D   +H 
Sbjct: 7   NFPVDNENRPFRCDTCHRGFHRLEHKKRHLRTHTGEKPHHCAFPGCGKSFSRSDELKRHM 66

Query: 150 RTH 152
           RTH
Sbjct: 67  RTH 69

 Score = 26.9 bits (58), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 10/21 (47%), Positives = 13/21 (61%)

Query: 105 CSRGFTTSGHLARHNRIHTGE 125
           C + F+ S  L RH R HTG+
Sbjct: 52  CGKSFSRSDELKRHMRTHTGQ 72

>YGL035C (MIG1) [1940] chr7 complement(431551..433065) Zinc-finger
           transcriptional repressor involved in
           glucose-repression, has two tandem C2H2-type zinc
           fingers, has similarity to mammalian Sp1, Krox/Egr, and
           Wilms tumor proteins [1515 bp, 504 aa]
          Length = 504

 Score = 63.5 bits (153), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 30/58 (51%), Positives = 33/58 (56%)

Query: 95  EQRRRYVCKICSRGFTTSGHLARHNRIHTGEKNHVCPFEGCGQRFSRHDNCVQHYRTH 152
           E  R + C IC R F    H  RH RIHTGEK H C F GC +RFSR D   +H R H
Sbjct: 33  EAPRPHACPICHRAFHRLEHQTRHMRIHTGEKPHACDFPGCVKRFSRSDELTRHRRIH 90

>Scas_687.33
          Length = 288

 Score = 62.8 bits (151), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 31/62 (50%), Positives = 35/62 (56%)

Query: 92  VPIEQRRRYVCKICSRGFTTSGHLARHNRIHTGEKNHVCPFEGCGQRFSRHDNCVQHYRT 151
            P   +R + C ICSRGF    H  RH R HTGEK H C F  CG+ FSR D   +H R 
Sbjct: 9   APDNFQRPFRCPICSRGFHRLEHKKRHVRTHTGEKPHPCTFAHCGKSFSRGDELKRHIRI 68

Query: 152 HL 153
           HL
Sbjct: 69  HL 70

>CAGL0A01628g 156635..157909 similar to sp|P27705 Saccharomyces
           cerevisiae YGL035c MIG1 transcriptional repressor,
           hypothetical start
          Length = 424

 Score = 63.2 bits (152), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 29/55 (52%), Positives = 32/55 (58%)

Query: 98  RRYVCKICSRGFTTSGHLARHNRIHTGEKNHVCPFEGCGQRFSRHDNCVQHYRTH 152
           R +VC IC R F    H  RH R HTGEK H C F GC +RFSR D   +H R H
Sbjct: 41  RPHVCPICGRAFHRLEHQTRHMRTHTGEKPHACDFPGCVKRFSRSDELTRHRRIH 95

>CAGL0C02519g 253051..254007 weakly similar to sp|P39943
           Saccharomyces cerevisiae YER028c, hypothetical start
          Length = 318

 Score = 62.4 bits (150), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 36/61 (59%)

Query: 93  PIEQRRRYVCKICSRGFTTSGHLARHNRIHTGEKNHVCPFEGCGQRFSRHDNCVQHYRTH 152
           P   +R + C+ICSRGF    H  RH R HTGEK H C F  C + FSR D   +H RTH
Sbjct: 13  PDNFKRPFRCEICSRGFHRLEHKKRHFRTHTGEKPHKCKFPSCPKSFSRADELKRHSRTH 72

Query: 153 L 153
           +
Sbjct: 73  M 73

>AGL207W [4105] [Homologous to NOHBY] complement(310750..311583)
           [834 bp, 277 aa]
          Length = 277

 Score = 61.6 bits (148), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 24/66 (36%), Positives = 41/66 (62%), Gaps = 2/66 (3%)

Query: 93  PIEQR--RRYVCKICSRGFTTSGHLARHNRIHTGEKNHVCPFEGCGQRFSRHDNCVQHYR 150
           P++ +  +RYVC  C +GF  +  L  H  IHTG++   CPF+ CG+ F+   N ++H++
Sbjct: 174 PVQNKAPQRYVCTECGKGFARASSLRTHRNIHTGDRPFTCPFKNCGKSFNARSNMLRHHK 233

Query: 151 THLKTN 156
            H +T+
Sbjct: 234 LHFRTD 239

>Scas_575.3
          Length = 455

 Score = 60.8 bits (146), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 30/63 (47%), Positives = 35/63 (55%)

Query: 90  ANVPIEQRRRYVCKICSRGFTTSGHLARHNRIHTGEKNHVCPFEGCGQRFSRHDNCVQHY 149
           AN   +  R +VC IC R F    H  RH R HTGEK H C F GC ++FSR D   +H 
Sbjct: 58  ANKDGDAPRPHVCPICQRAFHRLEHQTRHMRTHTGEKPHECDFPGCVKKFSRSDELTRHK 117

Query: 150 RTH 152
           R H
Sbjct: 118 RIH 120

>Kwal_27.10467
          Length = 302

 Score = 60.1 bits (144), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 34/58 (58%)

Query: 99  RYVCKICSRGFTTSGHLARHNRIHTGEKNHVCPFEGCGQRFSRHDNCVQHYRTHLKTN 156
           RY C  C + F     LA HN  HTG+K + CPF+ C ++F+   N  +HY+ H KT+
Sbjct: 197 RYTCTKCGKVFNRPSSLATHNNTHTGDKPYCCPFDNCDKQFNARSNMTRHYKLHFKTD 254

>CAGL0M01870g complement(219813..220760) some similarities with
           tr|Q12145 Saccharomyces cerevisiae YPR013c or tr|Q12531
           Saccharomyces cerevisiae YPR015c, hypothetical start
          Length = 315

 Score = 60.1 bits (144), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 35/56 (62%)

Query: 99  RYVCKICSRGFTTSGHLARHNRIHTGEKNHVCPFEGCGQRFSRHDNCVQHYRTHLK 154
           +++CK+C + F     L+ H  IHTGEK + CPF+ C + F+   N ++HY+ H K
Sbjct: 172 KFICKVCLKKFKRPSSLSTHMNIHTGEKPYPCPFDNCTKSFNAKSNMLRHYKLHFK 227

>KLLA0B00605g complement(46736..47455) some similarities with
           sp|P39943 Saccharomyces cerevisiae YER028c, hypothetical
           start
          Length = 239

 Score = 58.9 bits (141), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 27/58 (46%), Positives = 34/58 (58%)

Query: 98  RRYVCKICSRGFTTSGHLARHNRIHTGEKNHVCPFEGCGQRFSRHDNCVQHYRTHLKT 155
           R Y+C+IC   F    H  RH R HTGEK   C   GC +RFSR+D   +H +TH K+
Sbjct: 10  RPYLCEICGNRFHRLEHKTRHIRTHTGEKPFACTVPGCPKRFSRNDELKRHIKTHFKS 67

>CAGL0L11880g 1272624..1275566 some similarities with sp|P39956
           Saccharomyces cerevisiae YER169w, hypothetical start
          Length = 980

 Score = 58.9 bits (141), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 25/50 (50%), Positives = 34/50 (68%), Gaps = 3/50 (6%)

Query: 100 YVCKICSRGFTTSGHLARHNR-IHTGEKNHVCPFEGCGQRFSRHDNCVQH 148
           YVC+ C R F++  HL RH + +H+GEK H CP   CG+RF R D+ +QH
Sbjct: 902 YVCQECKRQFSSGHHLTRHKKSVHSGEKPHSCP--KCGKRFKRRDHVLQH 949

>YER169W (RPH1) [1597] chr5 (523364..525754) DNA damage-responsive
           repressor of PHR1, contains two C2H2-type zinc finger
           domains [2391 bp, 796 aa]
          Length = 796

 Score = 57.8 bits (138), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 25/50 (50%), Positives = 34/50 (68%), Gaps = 3/50 (6%)

Query: 100 YVCKICSRGFTTSGHLARHNR-IHTGEKNHVCPFEGCGQRFSRHDNCVQH 148
           Y+CK C R F++  HL RH + +H+GEK H CP   CG+RF R D+ +QH
Sbjct: 709 YICKECQRKFSSGHHLTRHKKSVHSGEKPHSCP--KCGKRFKRRDHVLQH 756

>YDR096W (GIS1) [946] chr4 (637133..639817) DNA damage-responsive
           repressor of PHR1, has two tandem C2H2-type zinc finger
           domains [2685 bp, 894 aa]
          Length = 894

 Score = 57.4 bits (137), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 24/50 (48%), Positives = 35/50 (70%), Gaps = 3/50 (6%)

Query: 100 YVCKICSRGFTTSGHLARHNR-IHTGEKNHVCPFEGCGQRFSRHDNCVQH 148
           Y+C+ C+R F++  HL RH + +H+GEK H CP   CG+RF R D+ +QH
Sbjct: 828 YICRECNRQFSSGHHLTRHKKSVHSGEKPHSCP--RCGKRFKRRDHVLQH 875

>Scas_681.19
          Length = 864

 Score = 57.0 bits (136), Expect = 5e-10,   Method: Composition-based stats.
 Identities = 26/55 (47%), Positives = 35/55 (63%), Gaps = 3/55 (5%)

Query: 95  EQRRRYVCKICSRGFTTSGHLARHNR-IHTGEKNHVCPFEGCGQRFSRHDNCVQH 148
           E  + YVC  C R FT+  HL RH + +H+GEK H CP   CG++F R D+ +QH
Sbjct: 760 ETGKVYVCLECKRQFTSGHHLTRHKKSVHSGEKPHSCP--KCGKKFKRRDHVLQH 812

>Kwal_56.23453
          Length = 828

 Score = 56.6 bits (135), Expect = 8e-10,   Method: Composition-based stats.
 Identities = 24/55 (43%), Positives = 37/55 (67%), Gaps = 3/55 (5%)

Query: 95  EQRRRYVCKICSRGFTTSGHLARHNR-IHTGEKNHVCPFEGCGQRFSRHDNCVQH 148
           ++ + YVC+ C R F++  HL RH + +H+GEK H CP   CG++F R D+ +QH
Sbjct: 730 DKGKVYVCQECRRQFSSGHHLTRHKKSVHSGEKPHSCP--KCGKKFKRRDHVLQH 782

>KLLA0C17710g 1569331..1571796 similar to sp|P39956 Saccharomyces
           cerevisiae YER169w RPH1, start by similarity
          Length = 821

 Score = 56.2 bits (134), Expect = 9e-10,   Method: Composition-based stats.
 Identities = 24/50 (48%), Positives = 35/50 (70%), Gaps = 3/50 (6%)

Query: 100 YVCKICSRGFTTSGHLARHNR-IHTGEKNHVCPFEGCGQRFSRHDNCVQH 148
           YVC+ C+R F++  HL RH + +H+GEK H CP   CG++F R D+ +QH
Sbjct: 755 YVCQECARQFSSGHHLTRHKKSVHSGEKPHSCP--KCGKKFKRRDHVLQH 802

>AGR117C [4428] [Homologous to ScYER169W (RPH1) - SH; ScYDR096W
           (GIS1) - SH] (964417..966816) [2400 bp, 799 aa]
          Length = 799

 Score = 56.2 bits (134), Expect = 9e-10,   Method: Composition-based stats.
 Identities = 24/55 (43%), Positives = 37/55 (67%), Gaps = 3/55 (5%)

Query: 95  EQRRRYVCKICSRGFTTSGHLARHNR-IHTGEKNHVCPFEGCGQRFSRHDNCVQH 148
           ++ + YVC+ C R F++  HL RH + +H+GEK H CP   CG++F R D+ +QH
Sbjct: 727 DKGKAYVCQECQRQFSSGHHLTRHKKSVHSGEKPHSCP--KCGKKFKRRDHVLQH 779

>Kwal_47.16621
          Length = 1178

 Score = 55.8 bits (133), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 28/68 (41%), Positives = 38/68 (55%), Gaps = 9/68 (13%)

Query: 88  ATANVPIEQR-------RRYVCKICSRGFTTSGHLARHNRIHTGEKNHVCPFEGCGQRFS 140
           AT  +P + R       R ++C IC+RGF    HL RH R HT EK  +C F  CG+ F+
Sbjct: 59  ATMPIPKKSRTIKTDRPRPFLCSICTRGFARQEHLKRHQRAHTNEKPFLCAF--CGRCFA 116

Query: 141 RHDNCVQH 148
           R D  ++H
Sbjct: 117 RRDLVLRH 124

>CAGL0H04213g 398544..402509 similar to sp|Q04545 Saccharomyces
           cerevisiae YML081w, start by similarity
          Length = 1321

 Score = 55.5 bits (132), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 26/62 (41%), Positives = 38/62 (61%), Gaps = 3/62 (4%)

Query: 92  VPIEQRRRYVCKICSRGFTTSGHLARHNRIHTGEKNHVCPFEGCGQRFSRHDNCVQH-YR 150
           +  ++ R ++C IC+RGF    HL RH R HT EK  +C F  CG+ F+R D  ++H Y+
Sbjct: 25  IKTDKPRPHLCPICTRGFVRLEHLKRHQRAHTNEKPFLCVF--CGRCFARRDLVLRHQYK 82

Query: 151 TH 152
            H
Sbjct: 83  LH 84

>KLLA0F13046g 1201353..1205492 some similarities with sp|P07248
           Saccharomyces cerevisiae YDR216w ADR1 zinc-finger
           transcription factor, hypothetical start
          Length = 1379

 Score = 55.5 bits (132), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 25/56 (44%), Positives = 34/56 (60%), Gaps = 2/56 (3%)

Query: 93  PIEQRRRYVCKICSRGFTTSGHLARHNRIHTGEKNHVCPFEGCGQRFSRHDNCVQH 148
           P  + R +VCK+C+R F    HL RH R HT EK +VC    C +RF+R D  ++H
Sbjct: 118 PSGKPRLFVCKVCTRAFARQEHLTRHERSHTKEKPYVCGI--CERRFTRRDLLIRH 171

>YML081W (YML081W) [3888] chr13 (104777..108532) Protein with
           similarity to Zms1p and Adr1p, has two tandem C2H2-type
           zinc fingers [3756 bp, 1251 aa]
          Length = 1251

 Score = 55.1 bits (131), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 24/57 (42%), Positives = 35/57 (61%), Gaps = 2/57 (3%)

Query: 92  VPIEQRRRYVCKICSRGFTTSGHLARHNRIHTGEKNHVCPFEGCGQRFSRHDNCVQH 148
           +  ++ R ++C IC+RGF    HL RH R HT EK  +C F  CG+ F+R D  ++H
Sbjct: 53  IKTDKPRPFLCHICTRGFVRQEHLKRHQRAHTNEKPFLCVF--CGRCFARRDLVLRH 107

>Sklu_2181.1 YER130C, Contig c2181 4015-5247
          Length = 410

 Score = 53.9 bits (128), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 26/60 (43%), Positives = 37/60 (61%), Gaps = 3/60 (5%)

Query: 94  IEQRRRYVCKICSRGFTTSGHLARHNR-IHTGEKNHVCPFEGCGQRFSRHDNCVQHYRTH 152
           ++  +++ C+ C R F    HL RH R +H GEK + C  E CG++FSR DN  QH +TH
Sbjct: 348 LDASKQFGCEFCDRRFKRQEHLKRHVRSLHMGEKPYGC--EICGKKFSRSDNLNQHIKTH 405

 Score = 28.1 bits (61), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 10/26 (38%), Positives = 17/26 (65%)

Query: 100 YVCKICSRGFTTSGHLARHNRIHTGE 125
           Y C+IC + F+ S +L +H + H G+
Sbjct: 383 YGCEICGKKFSRSDNLNQHIKTHGGD 408

>KLLA0B04477g 400019..404017 similar to sp|Q04545 Saccharomyces
           cerevisiae YML081w, start by similarity
          Length = 1332

 Score = 53.9 bits (128), Expect = 7e-09,   Method: Composition-based stats.
 Identities = 24/57 (42%), Positives = 35/57 (61%), Gaps = 2/57 (3%)

Query: 92  VPIEQRRRYVCKICSRGFTTSGHLARHNRIHTGEKNHVCPFEGCGQRFSRHDNCVQH 148
           +  ++ R ++C IC+RGF    HL RH R HT EK  +C F  CG+ F+R D  ++H
Sbjct: 75  IKTDRPRPFLCPICTRGFARQEHLRRHERSHTNEKPFLCAF--CGRCFARRDLVLRH 129

>Kwal_47.17888
          Length = 786

 Score = 52.8 bits (125), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 25/53 (47%), Positives = 32/53 (60%), Gaps = 2/53 (3%)

Query: 100 YVCKICSRGFTTSGHLARHNRIHTGEKNHVCPFEGCGQRFSRHDNCVQHYRTH 152
           + C+ C + FT  G+L  H R+HTGEK + C  E CG+RFSR  N   H  TH
Sbjct: 531 FQCEYCGKRFTQGGNLRTHVRLHTGEKPYEC--EKCGRRFSRKGNLAAHRLTH 581

 Score = 39.3 bits (90), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 29/57 (50%), Gaps = 1/57 (1%)

Query: 100 YVCKICSRGFTTSGHLARHNRIHTGEKNHVCPFEGCGQRFSRHDNCVQHY-RTHLKT 155
           Y C+ C R F+  G+LA H   H   K   C  +GC + F++  N   H  R HL+T
Sbjct: 559 YECEKCGRRFSRKGNLAAHRLTHENLKPFHCKLDGCNKSFTQLGNMKAHQNRFHLQT 615

 Score = 38.9 bits (89), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 29/55 (52%), Gaps = 2/55 (3%)

Query: 98  RRYVCKICSRGFTTSGHLARHNRIHTGEKNHVCPFEGCGQRFSRHDNCVQHYRTH 152
           +++ C  C + FT S HL  H R H G K   C  E CG+RF++  N   H R H
Sbjct: 501 KQHECPYCHKCFTQSTHLEVHVRSHIGYKPFQC--EYCGKRFTQGGNLRTHVRLH 553

>Sklu_2443.22 , Contig c2443 45390-46027
          Length = 213

 Score = 52.0 bits (123), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 24/57 (42%), Positives = 35/57 (61%), Gaps = 2/57 (3%)

Query: 92  VPIEQRRRYVCKICSRGFTTSGHLARHNRIHTGEKNHVCPFEGCGQRFSRHDNCVQH 148
           +  ++ R ++C IC+RGF    HL RH R HT EK  +C F  CG+ F+R D  ++H
Sbjct: 40  IKTDKPRPFLCPICTRGFARQEHLKRHQRSHTNEKPFLCAF--CGRCFARRDLVLRH 94

>AGR172W [4483] [Homologous to ScYDR216W (ADR1) - SH]
           complement(1071491..1074664) [3174 bp, 1057 aa]
          Length = 1057

 Score = 52.8 bits (125), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 24/56 (42%), Positives = 32/56 (57%), Gaps = 2/56 (3%)

Query: 93  PIEQRRRYVCKICSRGFTTSGHLARHNRIHTGEKNHVCPFEGCGQRFSRHDNCVQH 148
           P  + R +VC  C+R F    HL RH R HT EK ++C    C +RFSR D  ++H
Sbjct: 42  PSGKPRLFVCHTCTRAFARQEHLIRHKRSHTNEKPYICGI--CDRRFSRRDLLLRH 95

>Scas_703.23
          Length = 1341

 Score = 52.4 bits (124), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 23/57 (40%), Positives = 34/57 (59%), Gaps = 2/57 (3%)

Query: 92  VPIEQRRRYVCKICSRGFTTSGHLARHNRIHTGEKNHVCPFEGCGQRFSRHDNCVQH 148
           +  ++ R ++C  C+RGF    HL RH R HT EK  +C F  CG+ F+R D  ++H
Sbjct: 64  IKTDKPRPFLCPTCTRGFVRQEHLKRHQRSHTNEKPFLCVF--CGRCFARRDLVLRH 118

>Scas_709.32
          Length = 822

 Score = 52.4 bits (124), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 24/61 (39%), Positives = 36/61 (59%), Gaps = 3/61 (4%)

Query: 95  EQRRRYVCKICSRGFTTSGHLARHNR-IHTGEKNHVCPFEGCGQRFSRHDNCVQHYRTHL 153
           ++ + + C+ C + F  S HL RH R +H+ E+   CP   C ++FSR DN  QH +TH 
Sbjct: 760 DENKTFKCETCGKAFRRSEHLKRHIRSVHSSERPFACP--TCDKKFSRSDNLAQHIKTHK 817

Query: 154 K 154
           K
Sbjct: 818 K 818

>Kwal_47.17241
          Length = 403

 Score = 52.0 bits (123), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 25/60 (41%), Positives = 34/60 (56%), Gaps = 3/60 (5%)

Query: 94  IEQRRRYVCKICSRGFTTSGHLARHNR-IHTGEKNHVCPFEGCGQRFSRHDNCVQHYRTH 152
           ++  +++ C  C R F    HL RH R +H GEK   C    CG++FSR DN  QH +TH
Sbjct: 340 LDASKQFACDFCDRRFKRQEHLKRHVRSLHMGEKPFDCHI--CGKKFSRSDNLNQHIKTH 397

>Scas_602.9
          Length = 547

 Score = 51.6 bits (122), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 24/56 (42%), Positives = 31/56 (55%), Gaps = 3/56 (5%)

Query: 98  RRYVCKICSRGFTTSGHLARHNR-IHTGEKNHVCPFEGCGQRFSRHDNCVQHYRTH 152
           +++ C  C R F    HL RH R +H GEK + C    C + FSR DN  QH +TH
Sbjct: 493 KQFACDYCERRFKRQEHLKRHVRSLHIGEKPYACHI--CNKNFSRSDNLTQHIKTH 546

>AER159C [2662] [Homologous to ScYML081W - SH; ScYJR127C (ZMS1) -
           SH] (935544..939119) [3576 bp, 1191 aa]
          Length = 1191

 Score = 52.0 bits (123), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 23/57 (40%), Positives = 35/57 (61%), Gaps = 2/57 (3%)

Query: 92  VPIEQRRRYVCKICSRGFTTSGHLARHNRIHTGEKNHVCPFEGCGQRFSRHDNCVQH 148
           +  ++ R ++C +C+RGF    HL RH R HT EK  +C F  CG+ F+R D  ++H
Sbjct: 72  IKTDKPRPFLCPVCTRGFARQEHLKRHQRSHTNEKPFLCAF--CGRCFARRDLVLRH 126

>KLLA0F23782g 2219920..2222268 some similarities with sp|P41696
           Saccharomyces cerevisiae YOR113w AZF1 asparagine-rich
           zinc finger protein, hypothetical start
          Length = 782

 Score = 52.0 bits (123), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 24/53 (45%), Positives = 32/53 (60%), Gaps = 2/53 (3%)

Query: 100 YVCKICSRGFTTSGHLARHNRIHTGEKNHVCPFEGCGQRFSRHDNCVQHYRTH 152
           + C+ C + FT  G+L  H R+HTGEK + C  E CG++FSR  N   H  TH
Sbjct: 551 FSCEFCGKRFTQGGNLRTHIRLHTGEKPYEC--ERCGRKFSRKGNLAAHKLTH 601

 Score = 42.0 bits (97), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 29/55 (52%), Gaps = 2/55 (3%)

Query: 98  RRYVCKICSRGFTTSGHLARHNRIHTGEKNHVCPFEGCGQRFSRHDNCVQHYRTH 152
           +++ C  C + FT S HL  H R H G K   C F  CG+RF++  N   H R H
Sbjct: 521 KQFQCPYCHKYFTQSTHLEVHVRSHIGYKPFSCEF--CGKRFTQGGNLRTHIRLH 573

 Score = 38.1 bits (87), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 28/57 (49%), Gaps = 1/57 (1%)

Query: 100 YVCKICSRGFTTSGHLARHNRIHTGEKNHVCPFEGCGQRFSRHDNCVQHY-RTHLKT 155
           Y C+ C R F+  G+LA H   H   K   C  + C + F++  N   H  R HL+T
Sbjct: 579 YECERCGRKFSRKGNLAAHKLTHDNLKPFECKLDDCNKNFTQLGNMKAHQNRFHLQT 635

>YOR113W (AZF1) [4916] chr15 (534075..536819) Glucose-dependent
           transcriptional activator with four tandem C2H2-type
           zinc fingers [2745 bp, 914 aa]
          Length = 914

 Score = 51.6 bits (122), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 24/55 (43%), Positives = 31/55 (56%), Gaps = 2/55 (3%)

Query: 100 YVCKICSRGFTTSGHLARHNRIHTGEKNHVCPFEGCGQRFSRHDNCVQHYRTHLK 154
           +VC  C + FT  G+L  H R+HTGEK + C    C ++FSR  N   H  TH K
Sbjct: 621 FVCDYCGKRFTQGGNLRTHERLHTGEKPYSCDI--CDKKFSRKGNLAAHLVTHQK 673

 Score = 40.4 bits (93), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 30/55 (54%), Gaps = 2/55 (3%)

Query: 98  RRYVCKICSRGFTTSGHLARHNRIHTGEKNHVCPFEGCGQRFSRHDNCVQHYRTH 152
           +++ C  C R F+ + HL  H R H G K  VC +  CG+RF++  N   H R H
Sbjct: 591 KKHECPYCHRLFSQATHLEVHVRSHIGYKPFVCDY--CGKRFTQGGNLRTHERLH 643

 Score = 38.1 bits (87), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 24/49 (48%)

Query: 100 YVCKICSRGFTTSGHLARHNRIHTGEKNHVCPFEGCGQRFSRHDNCVQH 148
           Y C IC + F+  G+LA H   H   K  VC  E C + F++  N   H
Sbjct: 649 YSCDICDKKFSRKGNLAAHLVTHQKLKPFVCKLENCNKTFTQLGNMKAH 697

>CAGL0E04884g complement(469295..473764) weakly similar to sp|P07248
           Saccharomyces cerevisiae YDR216w ADR1 zinc-finger
           transcription factor, hypothetical start
          Length = 1489

 Score = 51.6 bits (122), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 23/56 (41%), Positives = 32/56 (57%), Gaps = 2/56 (3%)

Query: 93  PIEQRRRYVCKICSRGFTTSGHLARHNRIHTGEKNHVCPFEGCGQRFSRHDNCVQH 148
           P  + R +VC+ C+R F    HL RH R HT EK + C    C +RF+R D  ++H
Sbjct: 23  PSGKPRLFVCQTCTRAFARQEHLTRHERSHTKEKPYCCGI--CDRRFTRRDLLLRH 76

>KLLA0B07909g 697885..700653 some similarities with sp|P53243
           Saccharomyces cerevisiae YGR067c singleton, hypothetical
           start
          Length = 922

 Score = 51.6 bits (122), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 24/63 (38%), Positives = 34/63 (53%), Gaps = 2/63 (3%)

Query: 94  IEQRRRYVCKICSRGFTTSGHLARHNRIHTGEKNHVCPFEGCGQRFSRHDNCVQHYRTHL 153
           +  +R+Y+C  C++ F+ S H ARH R HTG K   C    C   F R D   +H RT  
Sbjct: 2   VASQRKYICSFCAKPFSRSEHKARHERSHTGSKPFSCSI--CSHSFVRRDLLQRHIRTVH 59

Query: 154 KTN 156
           K++
Sbjct: 60  KSS 62

>Scas_697.35
          Length = 839

 Score = 51.2 bits (121), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 31/55 (56%), Gaps = 2/55 (3%)

Query: 100 YVCKICSRGFTTSGHLARHNRIHTGEKNHVCPFEGCGQRFSRHDNCVQHYRTHLK 154
           Y C  C + FT  G+L  H R+HTGEK + C  E C ++FSR  N   H  TH K
Sbjct: 543 YQCGYCGKRFTQGGNLRTHQRLHTGEKPYEC--ELCDKKFSRKGNLAAHLLTHQK 595

 Score = 39.7 bits (91), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 22/58 (37%), Positives = 30/58 (51%), Gaps = 2/58 (3%)

Query: 95  EQRRRYVCKICSRGFTTSGHLARHNRIHTGEKNHVCPFEGCGQRFSRHDNCVQHYRTH 152
           E  +++ C  C R F  S HL  H R H G K + C +  CG+RF++  N   H R H
Sbjct: 510 EGSKQHKCPYCHRLFAQSTHLEVHIRSHLGYKPYQCGY--CGKRFTQGGNLRTHQRLH 565

 Score = 38.9 bits (89), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 29/57 (50%), Gaps = 1/57 (1%)

Query: 100 YVCKICSRGFTTSGHLARHNRIHTGEKNHVCPFEGCGQRFSRHDNCVQHY-RTHLKT 155
           Y C++C + F+  G+LA H   H   K  +C  + C + F++  N   H  R HL T
Sbjct: 571 YECELCDKKFSRKGNLAAHLLTHQKVKPFICKLDNCNRSFTQLGNMKAHQNRFHLDT 627

 Score = 26.9 bits (58), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 13/41 (31%), Positives = 22/41 (53%), Gaps = 2/41 (4%)

Query: 113 GHLARHNRIHTGEKNHVCPFEGCGQRFSRHDNCVQHYRTHL 153
           G + +   +H G K H CP+  C + F++  +   H R+HL
Sbjct: 500 GGVEKPKTLHEGSKQHKCPY--CHRLFAQSTHLEVHIRSHL 538

>KLLA0F11682g complement(1068992..1070116) some similarities with
           sgd|S0006219 Saccharomyces cerevisiae YPR015c,
           hypothetical start
          Length = 374

 Score = 50.8 bits (120), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 33/57 (57%)

Query: 99  RYVCKICSRGFTTSGHLARHNRIHTGEKNHVCPFEGCGQRFSRHDNCVQHYRTHLKT 155
           +Y C  C + F     L+ H  IHTG+K + C +  C ++F+   N ++HY+ HLKT
Sbjct: 303 KYRCAECGKAFARPSSLSTHMNIHTGDKPYKCLYPNCYKQFNAKSNMLRHYKLHLKT 359

>CAGL0M00594g 70659..73721 similar to sp|P46974 Saccharomyces
           cerevisiae YJR127c ZMS1 or sp|Q04545 Saccharomyces
           cerevisiae YML081w, hypothetical start
          Length = 1020

 Score = 51.2 bits (121), Expect = 6e-08,   Method: Composition-based stats.
 Identities = 24/57 (42%), Positives = 33/57 (57%), Gaps = 2/57 (3%)

Query: 92  VPIEQRRRYVCKICSRGFTTSGHLARHNRIHTGEKNHVCPFEGCGQRFSRHDNCVQH 148
           V  ++ R ++C ICSRGF    HL RH   HT EK  +C    CG+ F+R D  ++H
Sbjct: 19  VKTDKPRPFLCPICSRGFVRQEHLKRHQNSHTHEKPFLCLI--CGKCFARKDLVLRH 73

>CAGL0M06831g 695162..697099 weakly similar to sp|P53968
           Saccharomyces cerevisiae YNL027w CRZ1, hypothetical
           start
          Length = 645

 Score = 50.8 bits (120), Expect = 6e-08,   Method: Composition-based stats.
 Identities = 22/59 (37%), Positives = 32/59 (54%), Gaps = 7/59 (11%)

Query: 100 YVCKICSRGFTTSGHLARHNRIHTGEKNHVC-------PFEGCGQRFSRHDNCVQHYRT 151
           Y C IC + F       RH  +HTG+K +VC        F GCG++F+R D   +H++T
Sbjct: 549 YQCSICGKAFARQHDKKRHEDLHTGKKRYVCGGKLKDGTFWGCGKKFARSDALGRHFKT 607

>Scas_718.36d
          Length = 330

 Score = 50.8 bits (120), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 17/61 (27%), Positives = 33/61 (54%)

Query: 94  IEQRRRYVCKICSRGFTTSGHLARHNRIHTGEKNHVCPFEGCGQRFSRHDNCVQHYRTHL 153
            +++  Y C +C +GF     L  H+ I +G + + CP+  C + F+   N ++HY+ H 
Sbjct: 233 FDEKLGYFCDVCGKGFRRPSSLRTHSNIRSGNRPYKCPYSNCTKSFNAKSNMLRHYKLHF 292

Query: 154 K 154
           +
Sbjct: 293 R 293

>Kwal_26.8351
          Length = 698

 Score = 50.8 bits (120), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 25/67 (37%), Positives = 41/67 (61%), Gaps = 4/67 (5%)

Query: 90  ANVPIEQRRR-YVCKICSRGFTTSGHLARHNR-IHTGEKNHVCPFEGCGQRFSRHDNCVQ 147
           ++ P+E+  + + C+ C++ F  S HL RH R +H+ E+   C +  C ++FSR DN  Q
Sbjct: 630 SSSPVEEEEKPFKCQECTKAFRRSEHLKRHIRSVHSSERPFHCSY--CDKKFSRSDNLSQ 687

Query: 148 HYRTHLK 154
           H +TH K
Sbjct: 688 HLKTHKK 694

>ACR264W [1311] [Homologous to ScYOR113W (AZF1) - SH]
           complement(835313..837622) [2310 bp, 769 aa]
          Length = 769

 Score = 50.8 bits (120), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 32/53 (60%), Gaps = 2/53 (3%)

Query: 100 YVCKICSRGFTTSGHLARHNRIHTGEKNHVCPFEGCGQRFSRHDNCVQHYRTH 152
           + C+ C + FT  G+L  H R+HTGE+ + C  + CG+RFSR  N   H  TH
Sbjct: 515 FQCEYCGKRFTQGGNLRTHVRLHTGERPYEC--DKCGKRFSRKGNLAAHMLTH 565

 Score = 38.5 bits (88), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 29/55 (52%), Gaps = 2/55 (3%)

Query: 98  RRYVCKICSRGFTTSGHLARHNRIHTGEKNHVCPFEGCGQRFSRHDNCVQHYRTH 152
           +++ C  C + FT S HL  H R H G K   C +  CG+RF++  N   H R H
Sbjct: 485 KQHKCPYCHKCFTQSTHLEVHVRSHIGYKPFQCEY--CGKRFTQGGNLRTHVRLH 537

 Score = 35.8 bits (81), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 28/59 (47%), Gaps = 1/59 (1%)

Query: 98  RRYVCKICSRGFTTSGHLARHNRIHTGEKNHVCPFEGCGQRFSRHDNCVQHY-RTHLKT 155
           R Y C  C + F+  G+LA H   H   K   C  + C + F++  N   H  R HL+T
Sbjct: 541 RPYECDKCGKRFSRKGNLAAHMLTHENYKPFQCKLDDCNKSFTQLGNMKAHQNRFHLQT 599

>ACL057W [992] [Homologous to ScYER130C - SH]
           complement(264934..266496) [1563 bp, 520 aa]
          Length = 520

 Score = 50.8 bits (120), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 25/60 (41%), Positives = 35/60 (58%), Gaps = 3/60 (5%)

Query: 94  IEQRRRYVCKICSRGFTTSGHLARHNR-IHTGEKNHVCPFEGCGQRFSRHDNCVQHYRTH 152
           ++  + + C+ C R F    HL RH R +H GEK + C    CG++FSR DN  QH +TH
Sbjct: 454 LDATKPFGCEYCERRFKRQEHLKRHIRSLHMGEKPYGCDI--CGKKFSRSDNLNQHIKTH 511

>Scas_721.92
          Length = 1152

 Score = 50.4 bits (119), Expect = 9e-08,   Method: Composition-based stats.
 Identities = 23/59 (38%), Positives = 32/59 (54%), Gaps = 2/59 (3%)

Query: 90  ANVPIEQRRRYVCKICSRGFTTSGHLARHNRIHTGEKNHVCPFEGCGQRFSRHDNCVQH 148
              P  + R +VC +CSR F    HL RH R HT EK + C    C ++F+R D  ++H
Sbjct: 68  GTTPSGKPRLFVCDVCSRAFARQEHLDRHARSHTNEKPYQCGI--CTKKFTRRDLLLRH 124

>YKL062W (MSN4) [3197] chr11 (322873..324765) Zinc-finger
           transcriptional activator for genes regulated through
           Snf1p, has strong similarity to Msn2p, has two tandem
           C2H2-type zinc fingers [1893 bp, 630 aa]
          Length = 630

 Score = 50.4 bits (119), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 25/61 (40%), Positives = 36/61 (59%), Gaps = 3/61 (4%)

Query: 95  EQRRRYVCKICSRGFTTSGHLARHNR-IHTGEKNHVCPFEGCGQRFSRHDNCVQHYRTHL 153
           ++ + + CK C + F  S HL RH R +H+ E+   C F  C ++FSR DN  QH +TH 
Sbjct: 568 DKNKPFKCKDCEKAFRRSEHLKRHIRSVHSTERPFACMF--CEKKFSRSDNLSQHLKTHK 625

Query: 154 K 154
           K
Sbjct: 626 K 626

>YDR216W (ADR1) [1053] chr4 (895027..898998) Zinc-finger
           transcription factor involved in regulation of ADH2 and
           peroxisomal genes [3972 bp, 1323 aa]
          Length = 1323

 Score = 50.4 bits (119), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 22/56 (39%), Positives = 32/56 (57%), Gaps = 2/56 (3%)

Query: 93  PIEQRRRYVCKICSRGFTTSGHLARHNRIHTGEKNHVCPFEGCGQRFSRHDNCVQH 148
           P  + R +VC++C+R F    HL RH R HT EK + C    C + F+R D  ++H
Sbjct: 97  PSGKLRSFVCEVCTRAFARQEHLKRHYRSHTNEKPYPCGL--CNRCFTRRDLLIRH 150

>YJR127C (ZMS1) [3019] chr10 complement(658832..662974) Protein with
           similarity to Adr1p and Yml081p, has two tandem zinc
           finger domains [4143 bp, 1380 aa]
          Length = 1380

 Score = 50.4 bits (119), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 22/57 (38%), Positives = 34/57 (59%), Gaps = 2/57 (3%)

Query: 92  VPIEQRRRYVCKICSRGFTTSGHLARHNRIHTGEKNHVCPFEGCGQRFSRHDNCVQH 148
           +  ++ R ++C  C+RGF    HL RH   HT EK ++C F  CG+ F+R D  ++H
Sbjct: 143 IKTDKPRPFLCPTCTRGFVRQEHLKRHQHSHTREKPYLCIF--CGRCFARRDLVLRH 197

>KLLA0F26961g 2486804..2488888 some similarities with sp|P33748
           Saccharomyces cerevisiae YMR037c MSN2 stress responsive
           regulatory protein, hypothetical start
          Length = 694

 Score = 49.7 bits (117), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 25/61 (40%), Positives = 36/61 (59%), Gaps = 3/61 (4%)

Query: 95  EQRRRYVCKICSRGFTTSGHLARHNR-IHTGEKNHVCPFEGCGQRFSRHDNCVQHYRTHL 153
           E+ + + C  C++ F  S HL RH R +H+ E+   C F  C ++FSR DN  QH +TH 
Sbjct: 616 EEEKPFKCDQCNKTFRRSEHLKRHVRSVHSTERPFHCQF--CDKKFSRSDNLSQHLKTHK 673

Query: 154 K 154
           K
Sbjct: 674 K 674

>ABR089C [680] [Homologous to ScYKL062W (MSN4) - SH; ScYMR037C
           (MSN2) - SH] (548266..549981) [1716 bp, 571 aa]
          Length = 571

 Score = 49.7 bits (117), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 23/61 (37%), Positives = 37/61 (60%), Gaps = 3/61 (4%)

Query: 95  EQRRRYVCKICSRGFTTSGHLARHNR-IHTGEKNHVCPFEGCGQRFSRHDNCVQHYRTHL 153
           E+ + + C+ C++ F  S HL RH R +H+ ++   C +  C ++FSR DN  QH +TH 
Sbjct: 499 EEEKPFKCQECTKAFRRSEHLKRHIRSVHSSDRPFPCTY--CDKKFSRSDNLSQHLKTHR 556

Query: 154 K 154
           K
Sbjct: 557 K 557

>YNL027W (CRZ1) [4559] chr14 (579578..581614) Calcineurin-dependent
           transcription factor, regulates gene expression
           downstream of calcineurin in response to multiple
           environmental signals, has two C2H2-type zinc finger
           domains [2037 bp, 678 aa]
          Length = 678

 Score = 49.3 bits (116), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 22/62 (35%), Positives = 35/62 (56%), Gaps = 9/62 (14%)

Query: 98  RRYVCKICSRGFTTSGHLARHNRIHTGEKNHVC--------PFEGCGQRFSRHDNCVQHY 149
           R ++C IC + F       RH  +HTG+K +VC        P+ GCG++F+R D   +H+
Sbjct: 595 RPFICSICGKAFARQHDRKRHEDLHTGKKRYVCGGKLKDGKPW-GCGKKFARSDALGRHF 653

Query: 150 RT 151
           +T
Sbjct: 654 KT 655

 Score = 38.9 bits (89), Expect = 7e-04,   Method: Composition-based stats.
 Identities = 17/53 (32%), Positives = 27/53 (50%), Gaps = 2/53 (3%)

Query: 100 YVCKICSRGFTTSGHLARHNRIHTGEKNHVCPFEGCGQRFSRHDNCVQHYRTH 152
           + C +C + FT   +L  H R HT E+  +C    CG+ F+R  +  +H   H
Sbjct: 569 FACDVCGKKFTRPYNLKSHLRTHTNERPFICSI--CGKAFARQHDRKRHEDLH 619

>Kwal_26.8011
          Length = 190

 Score = 48.5 bits (114), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 30/54 (55%)

Query: 99  RYVCKICSRGFTTSGHLARHNRIHTGEKNHVCPFEGCGQRFSRHDNCVQHYRTH 152
           +Y C++C + F+ S  L  H   HTG +   CPF  C + F+   N V+H +TH
Sbjct: 127 KYQCQLCLKIFSRSSALQAHLLTHTGSRPFRCPFASCSKTFNVKSNMVRHLKTH 180

>AFR580C [3772] [Homologous to ScYGR067C - SH] (1478059..1480575)
           [2517 bp, 838 aa]
          Length = 838

 Score = 49.3 bits (116), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 22/58 (37%), Positives = 30/58 (51%), Gaps = 2/58 (3%)

Query: 94  IEQRRRYVCKICSRGFTTSGHLARHNRIHTGEKNHVCPFEGCGQRFSRHDNCVQHYRT 151
           +  +R+Y+C  C++ F+ S H  RH R HTG K   C    C   F R D   +H RT
Sbjct: 2   VASQRKYICSFCAQAFSRSEHKTRHERSHTGVKPFSCKV--CNHSFVRRDLLQRHIRT 57

 Score = 27.7 bits (60), Expect = 5.5,   Method: Composition-based stats.
 Identities = 10/28 (35%), Positives = 18/28 (64%), Gaps = 2/28 (7%)

Query: 125 EKNHVCPFEGCGQRFSRHDNCVQHYRTH 152
           ++ ++C F  C Q FSR ++  +H R+H
Sbjct: 5   QRKYICSF--CAQAFSRSEHKTRHERSH 30

>KLLA0C17072g 1494101..1495525 weakly similar to sp|P39959
           Saccharomyces cerevisiae YER130c, hypothetical start
          Length = 474

 Score = 48.9 bits (115), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 24/60 (40%), Positives = 34/60 (56%), Gaps = 3/60 (5%)

Query: 94  IEQRRRYVCKICSRGFTTSGHLARHNR-IHTGEKNHVCPFEGCGQRFSRHDNCVQHYRTH 152
           ++  + + C+ C R F    HL RH R +H  EK + C    CG++FSR DN  QH +TH
Sbjct: 412 LDASKPFGCEYCDRRFKRQEHLKRHIRSLHICEKPYGCHL--CGKKFSRSDNLSQHLKTH 469

 Score = 27.7 bits (60), Expect = 4.4,   Method: Composition-based stats.
 Identities = 10/26 (38%), Positives = 17/26 (65%)

Query: 100 YVCKICSRGFTTSGHLARHNRIHTGE 125
           Y C +C + F+ S +L++H + HT E
Sbjct: 447 YGCHLCGKKFSRSDNLSQHLKTHTHE 472

>Scas_683.25
          Length = 879

 Score = 48.9 bits (115), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 21/59 (35%), Positives = 33/59 (55%), Gaps = 2/59 (3%)

Query: 93  PIEQRRRYVCKICSRGFTTSGHLARHNRIHTGEKNHVCPFEGCGQRFSRHDNCVQHYRT 151
           P   ++R++C  C++GF+ + H  RH R HTG K + C    C   F R D  ++H +T
Sbjct: 8   PTTFQKRFICSFCAKGFSRAEHKIRHERSHTGLKPYKCKV--CTHCFVRSDLALRHIKT 64

>KLLA0E08679g 777005..778795 some similarities with sp|P53968
           Saccharomyces cerevisiae YNL027w CRZ1 calcineurin
           responsive zinc-finger, hypothetical start
          Length = 596

 Score = 48.5 bits (114), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 22/63 (34%), Positives = 34/63 (53%), Gaps = 7/63 (11%)

Query: 98  RRYVCKICSRGFTTSGHLARHNRIHTGEKNHVC-------PFEGCGQRFSRHDNCVQHYR 150
           R YVC +C + F       RH  +HTG++ +VC          GCG++F+R D   +H++
Sbjct: 495 RPYVCSVCGKAFARMHDKNRHEDLHTGKRRYVCGGILKNGNSWGCGKKFARSDALGRHFK 554

Query: 151 THL 153
           T L
Sbjct: 555 TEL 557

 Score = 40.4 bits (93), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 20/53 (37%), Positives = 28/53 (52%), Gaps = 2/53 (3%)

Query: 100 YVCKICSRGFTTSGHLARHNRIHTGEKNHVCPFEGCGQRFSRHDNCVQHYRTH 152
           Y C IC + FT   +L  H R HT E+ +VC    CG+ F+R  +  +H   H
Sbjct: 469 YACDICDKKFTRPYNLKSHLRSHTDERPYVCSV--CGKAFARMHDKNRHEDLH 519

>Sklu_2398.2 , Contig c2398 2210-3076 reverse complement
          Length = 288

 Score = 48.5 bits (114), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 20/65 (30%), Positives = 33/65 (50%)

Query: 90  ANVPIEQRRRYVCKICSRGFTTSGHLARHNRIHTGEKNHVCPFEGCGQRFSRHDNCVQHY 149
           +  P   + +++C  C + F     L  H+ IH G   + C + GC +RF+   N ++HY
Sbjct: 208 SEAPARPKLQHLCPECGKSFRRPSALKTHSIIHVGRSPYACTWNGCSKRFNVKGNLLRHY 267

Query: 150 RTHLK 154
           R H K
Sbjct: 268 RIHTK 272

 Score = 32.0 bits (71), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 25/51 (49%), Gaps = 8/51 (15%)

Query: 97  RRRYVCKI--CSRGFTTSGHLARHNRIHTGEKNHVCPFEGCGQRFSRHDNC 145
           R  Y C    CS+ F   G+L RH RIHT +K      E  G +  R ++C
Sbjct: 243 RSPYACTWNGCSKRFNVKGNLLRHYRIHTKKK------EASGVKTRRRNSC 287

>CAGL0K02145g 190055..191008 some similarities with sp|P39959
           Saccharomyces cerevisiae YER130c, hypothetical start
          Length = 317

 Score = 48.1 bits (113), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 24/56 (42%), Positives = 33/56 (58%), Gaps = 3/56 (5%)

Query: 98  RRYVCKICSRGFTTSGHLARHNR-IHTGEKNHVCPFEGCGQRFSRHDNCVQHYRTH 152
           +++ C+ C R F    HL RH R +H GEK + C    C ++FSR DN  QH +TH
Sbjct: 262 KQFGCEFCDRRFKRQEHLKRHIRSLHMGEKPYECHI--CNKKFSRSDNLNQHIKTH 315

>CAGL0F05995g complement(598819..600612) some similarities with
           sp|P33748 Saccharomyces cerevisiae YMR037c MSN2,
           hypothetical start
          Length = 597

 Score = 48.1 bits (113), Expect = 6e-07,   Method: Composition-based stats.
 Identities = 23/55 (41%), Positives = 33/55 (60%), Gaps = 3/55 (5%)

Query: 102 CKICSRGFTTSGHLARHNR-IHTGEKNHVCPFEGCGQRFSRHDNCVQHYRTHLKT 155
           C +CS+ F  S HL RH R +H+ ++   C    C ++FSR DN  QH +TH K+
Sbjct: 537 CHLCSKAFKRSEHLKRHVRSVHSTDRPFSCHL--CEKKFSRSDNLSQHIKTHKKS 589

>Scas_649.28
          Length = 730

 Score = 47.8 bits (112), Expect = 7e-07,   Method: Composition-based stats.
 Identities = 24/61 (39%), Positives = 35/61 (57%), Gaps = 3/61 (4%)

Query: 95  EQRRRYVCKICSRGFTTSGHLARHNR-IHTGEKNHVCPFEGCGQRFSRHDNCVQHYRTHL 153
           ++ + + C  C + F  S HL RH R +H+ E+   C F  C ++FSR DN  QH +TH 
Sbjct: 668 DKNKPFKCSECIKAFRRSEHLKRHIRSVHSSERPFACMF--CEKKFSRSDNLSQHLKTHK 725

Query: 154 K 154
           K
Sbjct: 726 K 726

>Scas_717.18
          Length = 354

 Score = 47.4 bits (111), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 23/58 (39%), Positives = 31/58 (53%)

Query: 98  RRYVCKICSRGFTTSGHLARHNRIHTGEKNHVCPFEGCGQRFSRHDNCVQHYRTHLKT 155
           R + C IC +  T S  L  H  IHTGEK + C +  C    S   N  +HY++HLK+
Sbjct: 294 RIHKCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRHYKSHLKS 351

>KLLA0F01463g 140343..142688 some similarities with sp|P47043
           Saccharomyces cerevisiae YJL056c ZAP1 metalloregulatory
           protein involved in zinc-responsive transcriptional
           regulation, hypothetical start
          Length = 781

 Score = 47.8 bits (112), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 24/60 (40%), Positives = 33/60 (55%), Gaps = 2/60 (3%)

Query: 97  RRRYVCKICSRGFTTSGHLARHNRIHTGEKNHVCPFEGCGQRFSRHDNCVQHYRTHLKTN 156
            R + C +C + ++TS  L  H R HTGEK   CP   C +RF+   N  +H RTH + N
Sbjct: 717 ERPFKCHLCPKSYSTSSSLRIHIRTHTGEKPLSCPI--CNKRFNESSNLAKHIRTHKREN 774

 Score = 29.3 bits (64), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 16/65 (24%), Positives = 33/65 (50%), Gaps = 5/65 (7%)

Query: 95  EQRRRYVCKI--CSRGFTTSGHLARHNR---IHTGEKNHVCPFEGCGQRFSRHDNCVQHY 149
           E+ +  +CK   C++ F ++  L  H     + +G  ++ C +EGC + F +    ++H 
Sbjct: 624 EEPQSCICKWAGCNKEFDSAKSLNEHIENFHVPSGLSSYKCEWEGCNKVFVQKQKLIRHL 683

Query: 150 RTHLK 154
           + H K
Sbjct: 684 KVHSK 688

 Score = 28.5 bits (62), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 26/55 (47%), Gaps = 4/55 (7%)

Query: 100 YVCKI--CSRGFTTSGHLARHNRIHTGEKNHVCPFEGCGQRFSRHDNCVQHYRTH 152
           Y C+   C++ F     L RH ++H+  K   C    CG+ F+  D   QH R H
Sbjct: 662 YKCEWEGCNKVFVQKQKLIRHLKVHSKYKPFRCA--ECGKCFNTQDILTQHLRVH 714

>YMR037C (MSN2) [4001] chr13 complement(344402..346516) Zinc-finger
           transcriptional activator for genes involved in the
           multistress response, has two tandem C2H2-type zinc
           fingers [2115 bp, 704 aa]
          Length = 704

 Score = 47.4 bits (111), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 24/60 (40%), Positives = 34/60 (56%), Gaps = 3/60 (5%)

Query: 96  QRRRYVCKICSRGFTTSGHLARHNR-IHTGEKNHVCPFEGCGQRFSRHDNCVQHYRTHLK 154
           + + + C IC + F  S HL RH R +H+ E+   C    C ++FSR DN  QH +TH K
Sbjct: 643 EEKPFHCHICPKSFKRSEHLKRHVRSVHSNERPFACHI--CDKKFSRSDNLSQHIKTHKK 700

>CAGL0L06072g complement(679924..680826) some similarities with
           sp|P39959 Saccharomyces cerevisiae YER130c or sp|P33749
           Saccharomyces cerevisiae YKL062w MSN4 transcriptional
           activator, hypothetical start
          Length = 300

 Score = 47.0 bits (110), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 33/60 (55%), Gaps = 3/60 (5%)

Query: 94  IEQRRRYVCKICSRGFTTSGHLARH-NRIHTGEKNHVCPFEGCGQRFSRHDNCVQHYRTH 152
            +  + + C +C R F    HL RH + +H GE+ + C  + C + FSR DN  QH RTH
Sbjct: 212 FDDAKIFKCDMCERRFKRQEHLKRHVSSLHMGERPYSC--DICLKSFSRSDNLNQHKRTH 269

>Kwal_47.16577
          Length = 881

 Score = 47.0 bits (110), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 24/67 (35%), Positives = 38/67 (56%), Gaps = 7/67 (10%)

Query: 94  IEQRRR----YVCKI--CSRGFTTSGHLARHNRIHTGEKNHVCPFEGCGQRFSRHDNCVQ 147
           +++R+R    + C    CS+ F+ S HL RH   H+ EK + C +  CG+ FSR D   +
Sbjct: 3   VKKRKRGSGPFFCPFPGCSKSFSRSDHLGRHKANHSSEK-YKCEWPACGREFSRLDVKKK 61

Query: 148 HYRTHLK 154
           H+  HL+
Sbjct: 62  HFGRHLR 68

 Score = 32.0 bits (71), Expect = 0.19,   Method: Composition-based stats.
 Identities = 12/28 (42%), Positives = 15/28 (53%)

Query: 130 CPFEGCGQRFSRHDNCVQHYRTHLKTNY 157
           CPF GC + FSR D+  +H   H    Y
Sbjct: 15  CPFPGCSKSFSRSDHLGRHKANHSSEKY 42

>KLLA0A04609g complement(411494..412765) some similarities with
           sgd|S0006217 Saccharomyces cerevisiae YPR013c,
           hypothetical start
          Length = 423

 Score = 46.6 bits (109), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 23/64 (35%), Positives = 41/64 (64%), Gaps = 5/64 (7%)

Query: 90  ANVPIEQRRRYVC-KICSRGFTTSGHLARHNRIHTGEKNHVCPFEGCGQRFSRHDNCVQH 148
           +++P+++ + ++C +ICSR  T   HL+    IHTG+K + CP   C +RF+   N ++H
Sbjct: 334 SSLPLKKNQCHICGRICSRPSTLQTHLS----IHTGDKPYKCPKRNCHKRFNVKSNMLRH 389

Query: 149 YRTH 152
           Y+ H
Sbjct: 390 YKRH 393

>Kwal_14.2543
          Length = 711

 Score = 46.6 bits (109), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 25/56 (44%), Positives = 30/56 (53%), Gaps = 2/56 (3%)

Query: 97  RRRYVCKICSRGFTTSGHLARHNRIHTGEKNHVCPFEGCGQRFSRHDNCVQHYRTH 152
            + Y C  C +GF TS  L  H R HTGEK   C    CG+RF+   N  +H RTH
Sbjct: 631 EKPYKCSHCGKGFATSSSLRIHIRTHTGEKPLECKV--CGKRFNESSNLSKHMRTH 684

 Score = 32.3 bits (72), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 27/51 (52%), Gaps = 2/51 (3%)

Query: 102 CKICSRGFTTSGHLARHNRIHTGEKNHVCPFEGCGQRFSRHDNCVQHYRTH 152
           C  C + F+T   L +H R H+GEK + C    CG+ F+   +   H RTH
Sbjct: 608 CVHCLKTFSTQDILQQHMRTHSGEKPYKCSH--CGKGFATSSSLRIHIRTH 656

 Score = 30.4 bits (67), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 23/58 (39%), Positives = 26/58 (44%), Gaps = 4/58 (6%)

Query: 97  RRRYVCKI--CSRGFTTSGHLARHNRIHTGEKNHVCPFEGCGQRFSRHDNCVQHYRTH 152
           +  YVC    C R  T    L RH R+HT  K   C    C + FS  D   QH RTH
Sbjct: 573 KSSYVCGWENCGRVITQRQKLLRHLRVHTRYK--PCKCVHCLKTFSTQDILQQHMRTH 628

 Score = 29.3 bits (64), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 17/69 (24%), Positives = 36/69 (52%), Gaps = 6/69 (8%)

Query: 92  VPIE-QRRRYVCKI--CSRGFTTSGHLARH---NRIHTGEKNHVCPFEGCGQRFSRHDNC 145
           +P E   ++++C+   C + F++   L  H     I  G+ ++VC +E CG+  ++    
Sbjct: 534 IPNETDNQKHICRWDACMQEFSSCEELNTHIEKEHIPRGKSSYVCGWENCGRVITQRQKL 593

Query: 146 VQHYRTHLK 154
           ++H R H +
Sbjct: 594 LRHLRVHTR 602

>CAGL0M13189g complement(1294293..1295918) weakly similar to
           sp|P33749 Saccharomyces cerevisiae YKL062w MSN4
           transcriptional activator, hypothetical start
          Length = 541

 Score = 46.6 bits (109), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 23/54 (42%), Positives = 31/54 (57%), Gaps = 3/54 (5%)

Query: 100 YVCKICSRGFTTSGHLARHNR-IHTGEKNHVCPFEGCGQRFSRHDNCVQHYRTH 152
           + C  C + F  S HL RH R +H+ E+   C F  C ++FSR DN  QH +TH
Sbjct: 484 FQCADCDKAFRRSEHLKRHVRSVHSTERPFPCMF--CEKKFSRSDNLSQHLKTH 535

>CAGL0G08107g 768772..770649 weakly similar to tr|Q03833
           Saccharomyces cerevisiae YDR096w GIS1 DNA
           damage-responsive repressor of PHR1, hypothetical start
          Length = 625

 Score = 46.2 bits (108), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 21/54 (38%), Positives = 31/54 (57%), Gaps = 3/54 (5%)

Query: 98  RRYVCKICSRGFTTSGHLARH-NRIHTGEKNHVCPFEGCGQRFSRHDNCVQHYR 150
           + + C+IC   F +S HL RH N +H+ EK + CP   C + F R D+  QH +
Sbjct: 560 KYFYCEICDHNFPSSYHLIRHRNSVHSAEKPYNCPI--CSKGFKRKDHVSQHLK 611

>Kwal_27.11460
          Length = 531

 Score = 45.8 bits (107), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 20/61 (32%), Positives = 32/61 (52%), Gaps = 7/61 (11%)

Query: 98  RRYVCKICSRGFTTSGHLARHNRIHTGEKNHVCPFE-------GCGQRFSRHDNCVQHYR 150
           R + C IC + F       RH  +HTG+K + C  +       GCG++F+R D   +H++
Sbjct: 439 RPFSCAICGKAFARQHDRKRHEDLHTGQKRYTCHGKLKDGTEWGCGKKFARSDALGRHFK 498

Query: 151 T 151
           T
Sbjct: 499 T 499

 Score = 38.5 bits (88), Expect = 0.001,   Method: Composition-based stats.
 Identities = 18/53 (33%), Positives = 27/53 (50%), Gaps = 2/53 (3%)

Query: 100 YVCKICSRGFTTSGHLARHNRIHTGEKNHVCPFEGCGQRFSRHDNCVQHYRTH 152
           Y C++C + FT   +L  H R HT E+   C    CG+ F+R  +  +H   H
Sbjct: 413 YACELCDKKFTRPYNLKSHLRTHTDERPFSCAI--CGKAFARQHDRKRHEDLH 463

>Scas_717.17
          Length = 525

 Score = 45.8 bits (107), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 29/51 (56%), Gaps = 2/51 (3%)

Query: 100 YVCKICSRGFTTSGHLARHNRIHTGEKNHVCPFEGCGQRFSRHDNCVQHYR 150
           Y+C ICS+ F     L RH   H+ E+++ CP+  C  R  R DN +QH +
Sbjct: 388 YICHICSKNFKRRSWLKRHLLSHSSERHYFCPW--CLSRHKRRDNLLQHMK 436

>Kwal_14.2206
          Length = 254

 Score = 45.4 bits (106), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 30/53 (56%)

Query: 102 CKICSRGFTTSGHLARHNRIHTGEKNHVCPFEGCGQRFSRHDNCVQHYRTHLK 154
           C+IC + F+    L+ H  IHTG + + C    CG+RF+   N ++H + H K
Sbjct: 196 CRICGKTFSRPSGLSTHALIHTGHQPYACDAPNCGKRFNVKSNLMRHRKIHAK 248

>YPL230W (YPL230W) [5219] chr16 (115312..116487) Putative
           transcription factor that contains two tandem C2H2-type
           zinc fingers [1176 bp, 391 aa]
          Length = 391

 Score = 45.4 bits (106), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 24/44 (54%), Positives = 27/44 (61%), Gaps = 2/44 (4%)

Query: 105 CSRGFTTSGHLARHNRIHTGEKNHVCPFEGCGQRFSRHDNCVQH 148
           C+  FT + HLARH R HTGEK   CP   C + FSR DN  QH
Sbjct: 49  CTMSFTRAEHLARHIRKHTGEKPFQCP--ACLKFFSRVDNLKQH 90

>CAGL0K04631g complement(440721..443762) some similarities with
           sp|P53243 Saccharomyces cerevisiae YGR067c, hypothetical
           start
          Length = 1013

 Score = 45.8 bits (107), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 23/61 (37%), Positives = 30/61 (49%), Gaps = 6/61 (9%)

Query: 93  PIEQRRRYVCKICSRGFTTSGHLARHNRIHTGEKNHVCPFEG--CGQRFSRHDNCVQHYR 150
           P  + +R+ C  C++ F+ S H  RH R H G K    PFE   C   F R D   +H R
Sbjct: 5   PTGKTKRHFCSFCNKAFSRSEHKTRHERSHAGVK----PFECQVCSHSFVRRDLLQRHIR 60

Query: 151 T 151
           T
Sbjct: 61  T 61

>Scas_719.68
          Length = 1350

 Score = 45.8 bits (107), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 26/65 (40%), Positives = 38/65 (58%), Gaps = 7/65 (10%)

Query: 92  VPIEQRRRYVCKICSRGFTTSGHLARHNRIHTGEKNHVCPFEGCGQRFSRHDNCVQHYRT 151
           +  ++ R ++C IC+R    + HL RH R HT EK  VC F  CG+ F+R D  V  Y+T
Sbjct: 33  IKTDKPRPFLCPICTR----TEHLKRHQRSHTREKPFVCVF--CGRCFARRD-LVLRYQT 85

Query: 152 HLKTN 156
            L ++
Sbjct: 86  KLHSS 90

>Scas_656.1*
          Length = 102

 Score = 43.1 bits (100), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 29/53 (54%)

Query: 102 CKICSRGFTTSGHLARHNRIHTGEKNHVCPFEGCGQRFSRHDNCVQHYRTHLK 154
           C IC +  T S  L  H  +HTG++   C +  CG+ F+   N  +HY+ HLK
Sbjct: 42  CPICGKIVTRSSSLQTHMLVHTGDRPFKCKWLNCGKTFNVKSNMNRHYKLHLK 94

>ADL198W [1543] [Homologous to ScYNL027W (CRZ1) - SH]
           complement(349070..350713) [1644 bp, 547 aa]
          Length = 547

 Score = 45.4 bits (106), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 19/64 (29%), Positives = 33/64 (51%), Gaps = 7/64 (10%)

Query: 96  QRRRYVCKICSRGFTTSGHLARHNRIHTGEKNHVCPFE-------GCGQRFSRHDNCVQH 148
             R + C +C + F       RH  +H+G+K +VC  +       GCG++F+R D   +H
Sbjct: 450 DERPFSCSVCGKAFARQHDRKRHEDLHSGKKRYVCGGKLKGGATWGCGKKFARSDALGRH 509

Query: 149 YRTH 152
           ++T 
Sbjct: 510 FKTE 513

 Score = 35.4 bits (80), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 26/53 (49%), Gaps = 2/53 (3%)

Query: 100 YVCKICSRGFTTSGHLARHNRIHTGEKNHVCPFEGCGQRFSRHDNCVQHYRTH 152
           Y C +C + FT   +L  H R HT E+   C    CG+ F+R  +  +H   H
Sbjct: 426 YSCNLCDKKFTRPYNLKSHLRTHTDERPFSCSV--CGKAFARQHDRKRHEDLH 476

>YJL056C (ZAP1) [2855] chr10 complement(330347..332989)
           Zinc-responsive transcriptional activator, regulates
           genes involved in zinc uptake, has eight C2H2-type zinc
           fingers [2643 bp, 880 aa]
          Length = 880

 Score = 45.1 bits (105), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 31/58 (53%), Gaps = 2/58 (3%)

Query: 97  RRRYVCKICSRGFTTSGHLARHNRIHTGEKNHVCPFEGCGQRFSRHDNCVQHYRTHLK 154
            + Y C IC++ F  S  L  H R HTGEK   C    CG+RF+   N  +H +TH K
Sbjct: 793 EKPYKCHICNKKFAISSSLKIHIRTHTGEKPLQCKI--CGKRFNESSNLSKHIKTHQK 848

 Score = 38.5 bits (88), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 29/53 (54%), Gaps = 2/53 (3%)

Query: 100 YVCKICSRGFTTSGHLARHNRIHTGEKNHVCPFEGCGQRFSRHDNCVQHYRTH 152
           Y CK C R F++   L +H R H+GEK + C    C ++F+   +   H RTH
Sbjct: 768 YKCKTCKRCFSSEETLVQHTRTHSGEKPYKCHI--CNKKFAISSSLKIHIRTH 818

 Score = 29.6 bits (65), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 28/58 (48%), Gaps = 4/58 (6%)

Query: 97  RRRYVCKI--CSRGFTTSGHLARHNRIHTGEKNHVCPFEGCGQRFSRHDNCVQHYRTH 152
           +  Y C    C R F     L RH ++H+  K + C  + C + FS  +  VQH RTH
Sbjct: 735 KSEYQCLWHDCHRTFPQRQKLIRHLKVHSKYKPYKC--KTCKRCFSSEETLVQHTRTH 790

 Score = 28.1 bits (61), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 16/67 (23%), Positives = 34/67 (50%), Gaps = 5/67 (7%)

Query: 93  PIEQRRRYVCKI--CSRGFTTSGHLARH-NRIHT--GEKNHVCPFEGCGQRFSRHDNCVQ 147
           PI+Q  + +C+   C++ F+++  L  H   +H   G+  + C +  C + F +    ++
Sbjct: 698 PIKQPEQVICQWDGCNKSFSSAQELNDHLEAVHLTRGKSEYQCLWHDCHRTFPQRQKLIR 757

Query: 148 HYRTHLK 154
           H + H K
Sbjct: 758 HLKVHSK 764

>Scas_695.2
          Length = 571

 Score = 44.7 bits (104), Expect = 9e-06,   Method: Composition-based stats.
 Identities = 21/60 (35%), Positives = 33/60 (55%), Gaps = 9/60 (15%)

Query: 100 YVCKICSRGFTTSGHLARHNRIHTGEKNHVC--------PFEGCGQRFSRHDNCVQHYRT 151
           +VC IC + F       RH  +HTG+K +VC        P+ GC ++F+R D   +H++T
Sbjct: 480 FVCNICGKAFARQHDRKRHEDLHTGKKRYVCGGVLKNGTPW-GCHKKFARSDALGRHFKT 538

 Score = 38.9 bits (89), Expect = 8e-04,   Method: Composition-based stats.
 Identities = 19/53 (35%), Positives = 27/53 (50%), Gaps = 2/53 (3%)

Query: 100 YVCKICSRGFTTSGHLARHNRIHTGEKNHVCPFEGCGQRFSRHDNCVQHYRTH 152
           Y C++C + FT   +L  H R HT E   VC    CG+ F+R  +  +H   H
Sbjct: 452 YACELCDKTFTRPYNLKSHLRTHTNEXPFVCNI--CGKAFARQHDRKRHEDLH 502

>Scas_720.33
          Length = 316

 Score = 43.9 bits (102), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 36/66 (54%), Gaps = 6/66 (9%)

Query: 95  EQRRRYVC---KICSRGFTTSGHLARHNRIHTGEKNHVCPFEGCGQRFSRHDNCVQHYRT 151
           ++R+ + C   K C   FT   HLARH R HTGEK   C    C + FSR DN  QH  T
Sbjct: 10  KERKTFACQGYKDCHMTFTREEHLARHIRKHTGEKPFQCYI--CFRFFSRMDNLKQHRDT 67

Query: 152 -HLKTN 156
            H K+N
Sbjct: 68  VHGKSN 73

>YGR067C (YGR067C) [2029] chr7 complement(622404..624788) Protein
           with two tandem zinc finger domains [2385 bp, 794 aa]
          Length = 794

 Score = 44.3 bits (103), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 21/59 (35%), Positives = 30/59 (50%), Gaps = 2/59 (3%)

Query: 97  RRRYVCKICSRGFTTSGHLARHNRIHTGEKNHVCPFEGCGQRFSRHDNCVQHYRTHLKT 155
           +++Y+C  C + F+ S H  RH R H G K   C  + C   F R D   +H RT  +T
Sbjct: 5   QKKYICSFCLKPFSRSEHKIRHERSHAGVKPFQC--QVCKHSFVRRDLLQRHIRTVHRT 61

>CAGL0L03916g complement(448955..450883) weakly similar to sp|P41696
           Saccharomyces cerevisiae YOR113w AZF1 asparagine-rich
           zinc finger protein, hypothetical start
          Length = 642

 Score = 44.3 bits (103), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 30/53 (56%), Gaps = 2/53 (3%)

Query: 100 YVCKICSRGFTTSGHLARHNRIHTGEKNHVCPFEGCGQRFSRHDNCVQHYRTH 152
           + C+ C + FT +G+L  H R+HTGE+   C  + C + F+R  N   H  TH
Sbjct: 508 FECEFCGKRFTQAGNLRTHRRLHTGERPFKC--DKCDKTFARRGNLTAHEFTH 558

 Score = 42.4 bits (98), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 22/53 (41%), Positives = 28/53 (52%), Gaps = 2/53 (3%)

Query: 100 YVCKICSRGFTTSGHLARHNRIHTGEKNHVCPFEGCGQRFSRHDNCVQHYRTH 152
           Y C  CS+ F+ S HL  H + H G K   C F  CG+RF++  N   H R H
Sbjct: 480 YQCAYCSKMFSQSTHLDVHIKAHMGYKPFECEF--CGKRFTQAGNLRTHRRLH 530

 Score = 35.8 bits (81), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 16/52 (30%), Positives = 24/52 (46%)

Query: 97  RRRYVCKICSRGFTTSGHLARHNRIHTGEKNHVCPFEGCGQRFSRHDNCVQH 148
            R + C  C + F   G+L  H   H   K ++C  + C +RFS+  N   H
Sbjct: 533 ERPFKCDKCDKTFARRGNLTAHEFTHESIKPYICRLDNCFKRFSQLGNMKSH 584

>Scas_707.31
          Length = 289

 Score = 43.5 bits (101), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 26/61 (42%), Positives = 33/61 (54%), Gaps = 7/61 (11%)

Query: 95  EQRRRYVCKICSRGFTTSGHLARHNR-IHTGEKNHVCPFE--GCGQRFSRHDNCVQHYRT 151
           +  ++Y C +C + F    HL RH R IH      V PFE   C +RFSR+DN  QH R 
Sbjct: 218 DDSKQYFCHLCKKRFKRHEHLKRHFRTIHL----RVRPFECSVCHKRFSRNDNLNQHVRI 273

Query: 152 H 152
           H
Sbjct: 274 H 274

>Sklu_2436.9 YDR463W, Contig c2436 18516-20069
          Length = 517

 Score = 43.5 bits (101), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 33/71 (46%), Gaps = 14/71 (19%)

Query: 95  EQRRRYVCKICSRGFTTSGHLARHNRIHTGEKNHVCPFEGCG----------QRFSRHDN 144
           EQR +YVC  C   F   G+L RH + H  EK + CPF                FSR D 
Sbjct: 157 EQRGKYVCHYCDAEFRIRGYLTRHIKKHAVEKAYHCPFFNSKLPPESRCHTTGGFSRRDT 216

Query: 145 CVQHYRTHLKT 155
               Y+THLK+
Sbjct: 217 ----YKTHLKS 223

>Sklu_2389.2 YJL056C, Contig c2389 3525-5828
          Length = 767

 Score = 43.5 bits (101), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 23/56 (41%), Positives = 30/56 (53%), Gaps = 2/56 (3%)

Query: 97  RRRYVCKICSRGFTTSGHLARHNRIHTGEKNHVCPFEGCGQRFSRHDNCVQHYRTH 152
            R + C  C++ F TS  L  H R HTGEK   C    CG+RF+   N  +H +TH
Sbjct: 683 ERPFKCTYCTKQFATSSSLRIHIRTHTGEKPLKCKI--CGKRFNESSNLSKHMKTH 736

 Score = 39.3 bits (90), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 21/48 (43%), Positives = 27/48 (56%), Gaps = 2/48 (4%)

Query: 105 CSRGFTTSGHLARHNRIHTGEKNHVCPFEGCGQRFSRHDNCVQHYRTH 152
           CS+ FT    L RH ++H+G K   CP   C ++FS  D   QH RTH
Sbjct: 635 CSKSFTQRQKLLRHLKVHSGYKPFKCPH--CTKKFSTEDILQQHIRTH 680

 Score = 32.3 bits (72), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 29/53 (54%), Gaps = 2/53 (3%)

Query: 100 YVCKICSRGFTTSGHLARHNRIHTGEKNHVCPFEGCGQRFSRHDNCVQHYRTH 152
           + C  C++ F+T   L +H R H+GE+   C +  C ++F+   +   H RTH
Sbjct: 658 FKCPHCTKKFSTEDILQQHIRTHSGERPFKCTY--CTKQFATSSSLRIHIRTH 708

>Scas_711.56
          Length = 832

 Score = 43.5 bits (101), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 23/55 (41%), Positives = 29/55 (52%), Gaps = 2/55 (3%)

Query: 100 YVCKICSRGFTTSGHLARHNRIHTGEKNHVCPFEGCGQRFSRHDNCVQHYRTHLK 154
           + C IC + F  S  L  H R HTGEK   C    CG+ F+   N  +H +THLK
Sbjct: 754 FKCDICGKRFAISSSLKIHIRTHTGEKPLHCKI--CGKAFNESSNLSKHMKTHLK 806

 Score = 39.7 bits (91), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 28/53 (52%), Gaps = 2/53 (3%)

Query: 100 YVCKICSRGFTTSGHLARHNRIHTGEKNHVCPFEGCGQRFSRHDNCVQHYRTH 152
           + C IC + F+    L +H R H+GEK   C    CG+RF+   +   H RTH
Sbjct: 726 FQCSICKKHFSNEETLKQHERTHSGEKPFKCDI--CGKRFAISSSLKIHIRTH 776

 Score = 33.5 bits (75), Expect = 0.059,   Method: Compositional matrix adjust.
 Identities = 20/61 (32%), Positives = 30/61 (49%), Gaps = 4/61 (6%)

Query: 94  IEQRRRYVCKI--CSRGFTTSGHLARHNRIHTGEKNHVCPFEGCGQRFSRHDNCVQHYRT 151
           ++ + +Y C    C + F+    L RH R+H+G K   C    C + FS  +   QH RT
Sbjct: 690 LKGQSQYECHWANCHKIFSQRQRLVRHMRVHSGYKPFQCSI--CKKHFSNEETLKQHERT 747

Query: 152 H 152
           H
Sbjct: 748 H 748

>CAGL0H07557g 738086..739516 some similarities with sp|P32805
           Saccharomyces cerevisiae YGL254w FZF1, hypothetical
           start
          Length = 476

 Score = 43.5 bits (101), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 21/46 (45%), Positives = 28/46 (60%), Gaps = 2/46 (4%)

Query: 98  RRYVCKI--CSRGFTTSGHLARHNRIHTGEKNHVCPFEGCGQRFSR 141
           R+YVC+I  C R F+    LA+H   HT E+ +VC    CG+RF R
Sbjct: 55  RKYVCQIDGCKREFSVPSLLAQHRNAHTDERPYVCDEPNCGKRFLR 100

>KLLA0F20636g complement(1914452..1915309) some similarities with
           sgd|S0006217 Saccharomyces cerevisiae YPR013c,
           hypothetical start
          Length = 285

 Score = 43.1 bits (100), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 29/52 (55%)

Query: 101 VCKICSRGFTTSGHLARHNRIHTGEKNHVCPFEGCGQRFSRHDNCVQHYRTH 152
           +C  C + FT    L  H  +H+G+K   C +EGC ++F+   N ++H + H
Sbjct: 233 ICAQCGKQFTRPSALRTHMLVHSGDKPFECTWEGCNKKFNVKSNLIRHLKLH 284

>AFL136W [3059] [Homologous to ScYPL230W - SH; ScYMR182C (RGM1) -
           SH] complement(178780..180009) [1230 bp, 409 aa]
          Length = 409

 Score = 43.1 bits (100), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 24/44 (54%), Positives = 26/44 (59%), Gaps = 2/44 (4%)

Query: 105 CSRGFTTSGHLARHNRIHTGEKNHVCPFEGCGQRFSRHDNCVQH 148
           C R FT + HLARH R  TGEK   C  E C + FSR DN  QH
Sbjct: 28  CDRSFTRAEHLARHIRKQTGEKPSQC--EVCNRFFSRIDNLKQH 69

>YER130C (YER130C) [1560] chr5 complement(421111..422442) Protein
           with two tandem zinc finger domains [1332 bp, 443 aa]
          Length = 443

 Score = 43.1 bits (100), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 23/56 (41%), Positives = 30/56 (53%), Gaps = 3/56 (5%)

Query: 98  RRYVCKICSRGFTTSGHLARHNR-IHTGEKNHVCPFEGCGQRFSRHDNCVQHYRTH 152
           +++ C+ C R F    HL RH R +H  EK   C    C + FSR DN  QH +TH
Sbjct: 387 KQFGCEFCDRRFKRQEHLKRHVRSLHMCEKPFTCHI--CNKNFSRSDNLNQHVKTH 440

>Scas_707.46
          Length = 338

 Score = 42.4 bits (98), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 19/64 (29%), Positives = 33/64 (51%)

Query: 91  NVPIEQRRRYVCKICSRGFTTSGHLARHNRIHTGEKNHVCPFEGCGQRFSRHDNCVQHYR 150
           N+ +  R R  C +C +  +    L  H  IHTG+    CP++ C + F+   N ++H +
Sbjct: 261 NLNLASRLRKQCPVCGKICSRPSTLKTHYLIHTGDTPFRCPWKSCNKSFNVKSNMLRHLK 320

Query: 151 THLK 154
           +H K
Sbjct: 321 SHQK 324

>Scas_717.17d
          Length = 350

 Score = 42.4 bits (98), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 29/57 (50%)

Query: 98  RRYVCKICSRGFTTSGHLARHNRIHTGEKNHVCPFEGCGQRFSRHDNCVQHYRTHLK 154
           + ++C +C +  T S  L  H  IHTG +   C +  C    S   N  +H+++HLK
Sbjct: 283 KLHICVVCGKSLTRSTSLRTHMLIHTGSRPFKCSWPNCKASSSVKSNITRHFKSHLK 339

>AEL077W [2429] [Homologous to NOHBY] complement(483028..484038)
           [1011 bp, 336 aa]
          Length = 336

 Score = 42.4 bits (98), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 28/54 (51%)

Query: 99  RYVCKICSRGFTTSGHLARHNRIHTGEKNHVCPFEGCGQRFSRHDNCVQHYRTH 152
           R  C +C +       L  H  IHTG +  +C + GC +RF+   N V+HYR H
Sbjct: 273 RNQCPVCGKVCHRPSSLRNHMYIHTGRRPFLCEWPGCEKRFNVKSNMVRHYRLH 326

>Scas_712.2
          Length = 327

 Score = 42.0 bits (97), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 33/62 (53%), Gaps = 2/62 (3%)

Query: 96  QRRRYVCKI--CSRGFTTSGHLARHNRIHTGEKNHVCPFEGCGQRFSRHDNCVQHYRTHL 153
           +++ Y C+   C R FT    L +H   HT E+ ++C  EGCG+RF R  +   H  TH 
Sbjct: 9   KKKVYKCQFEGCHREFTRPCLLQQHRYSHTNERPYICDVEGCGKRFMRPCHLKVHKWTHS 68

Query: 154 KT 155
           K 
Sbjct: 69  KV 70

>CAGL0E06116g complement(604708..606549) some similarities with
           tr|Q12132 Saccharomyces cerevisiae YPL230w USV1,
           hypothetical start
          Length = 613

 Score = 42.0 bits (97), Expect = 6e-05,   Method: Composition-based stats.
 Identities = 26/53 (49%), Positives = 29/53 (54%), Gaps = 3/53 (5%)

Query: 105 CSRGFTTSGHLARHNRIHTGEKNHVCPFEGCGQRFSRHDNCVQHYRT-HLKTN 156
           C   F+ + HLARH R HTGEK   C    C + FSR DN  QH  T H K N
Sbjct: 33  CEMSFSRAEHLARHIRRHTGEKPFKCDI--CLKYFSRIDNLKQHKDTVHAKDN 83

>YMR182C (RGM1) [4137] chr13 complement(624531..625166)
           Transcriptional repressor, has strong similarity to
           mammalian EGR (early growth response) factor, contains
           two tandem C2H2-type zinc fingers [636 bp, 211 aa]
          Length = 211

 Score = 41.6 bits (96), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 29/55 (52%), Gaps = 5/55 (9%)

Query: 97  RRRYVC---KICSRGFTTSGHLARHNRIHTGEKNHVCPFEGCGQRFSRHDNCVQH 148
           +R Y C     C+  F  + HLARH R HTGEK   C    C + FSR DN  QH
Sbjct: 16  KRNYRCVGYPDCNMSFNRTEHLARHIRKHTGEKPFQC--NICLKFFSRIDNLRQH 68

>Scas_710.9
          Length = 505

 Score = 42.0 bits (97), Expect = 8e-05,   Method: Composition-based stats.
 Identities = 19/58 (32%), Positives = 31/58 (53%)

Query: 96  QRRRYVCKICSRGFTTSGHLARHNRIHTGEKNHVCPFEGCGQRFSRHDNCVQHYRTHL 153
           ++R+  CK+C +  T +  L  H  IHTG +   C + GC + F+   N  +H + HL
Sbjct: 443 RKRKKQCKLCGKVVTRTSSLQTHMLIHTGVRPFSCTWPGCKKTFNVKSNMNRHLKLHL 500

>ADL042W [1699] [Homologous to ScYPR015C - SH]
           complement(615818..616663) [846 bp, 281 aa]
          Length = 281

 Score = 41.6 bits (96), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 27/52 (51%)

Query: 101 VCKICSRGFTTSGHLARHNRIHTGEKNHVCPFEGCGQRFSRHDNCVQHYRTH 152
           VC+IC + F     L  H  +H  +K + C   GC +RF+   N ++H R H
Sbjct: 226 VCEICGKDFKRPSALRTHMVVHNNDKPYNCEHRGCQKRFNVKSNMLRHMRKH 277

>AEL278W [2227] [Homologous to ScYPR186C (PZF1) - SH]
           complement(117043..118473) [1431 bp, 476 aa]
          Length = 476

 Score = 41.6 bits (96), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 19/43 (44%), Positives = 25/43 (58%), Gaps = 2/43 (4%)

Query: 100 YVCKICSRGFTTSGHLARHNRIHTGEKNHVCPFEGCGQRFSRH 142
           + C +C +G TT   L RH   HT  K+  CP EGCG+ F +H
Sbjct: 178 FSCTVCGKGVTTRQQLRRHEITHT--KSFKCPHEGCGEAFYKH 218

 Score = 27.3 bits (59), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 17/62 (27%), Positives = 28/62 (45%), Gaps = 1/62 (1%)

Query: 91  NVPIEQRRRY-VCKICSRGFTTSGHLARHNRIHTGEKNHVCPFEGCGQRFSRHDNCVQHY 149
            +P+++   Y + +  S G T S          T  K H C +EGC + F+R     +H 
Sbjct: 81  ELPVDEVTDYALSRTTSAGSTVSLSSVESTASSTRRKTHYCDYEGCYKAFTRPSLLTEHQ 140

Query: 150 RT 151
           +T
Sbjct: 141 QT 142

>Scas_627.6
          Length = 1207

 Score = 41.6 bits (96), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 24/80 (30%), Positives = 39/80 (48%), Gaps = 14/80 (17%)

Query: 90  ANVPIEQR------RRYVCK--ICSRGFTTSGHLARHNRIHTGEKNHVCPF------EGC 135
           A+ P+++        RY+C    C++ FT   HL+RH   H  ++  VCPF        C
Sbjct: 26  ASAPVQKSAKLAVTERYICPHPDCNKSFTRQEHLSRHKLNHWPKEIFVCPFIFPNTNITC 85

Query: 136 GQRFSRHDNCVQHYRTHLKT 155
            + F R D  ++H + H K+
Sbjct: 86  NKTFVRKDLLIRHQKRHTKS 105

>CAGL0J05060g 478650..480791 similar to sp|P47043 Saccharomyces
           cerevisiae YJL056c ZAP1 metalloregulatory protein,
           hypothetical start
          Length = 713

 Score = 41.2 bits (95), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 23/58 (39%), Positives = 30/58 (51%), Gaps = 2/58 (3%)

Query: 100 YVCKICSRGFTTSGHLARHNRIHTGEKNHVCPFEGCGQRFSRHDNCVQHYRTHLKTNY 157
           Y C IC + F  S  L  H R HTGEK   C    CG+ F+   N  +H +TH+K  +
Sbjct: 625 YECHICHKRFAISNSLKIHIRTHTGEKPLKCKV--CGRCFNESSNLSKHMKTHMKKYF 680

 Score = 37.4 bits (85), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 30/53 (56%), Gaps = 2/53 (3%)

Query: 100 YVCKICSRGFTTSGHLARHNRIHTGEKNHVCPFEGCGQRFSRHDNCVQHYRTH 152
           Y C  C + F+T   L +H R+H+GEK + C    C +RF+  ++   H RTH
Sbjct: 597 YQCPQCQKCFSTEDTLNQHKRVHSGEKPYECHI--CHKRFAISNSLKIHIRTH 647

 Score = 34.3 bits (77), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 31/61 (50%), Gaps = 5/61 (8%)

Query: 99  RYVCKI--CSRGFTTSGHLARH-NRIH--TGEKNHVCPFEGCGQRFSRHDNCVQHYRTHL 153
            + CK   C+  F ++G L  H   +H   G+  + C +EGC + FS+    V+H + H 
Sbjct: 533 EFCCKWAGCNERFKSAGDLNDHLEEMHLTKGKSQYTCEWEGCNKTFSQRQKLVRHLKVHS 592

Query: 154 K 154
           K
Sbjct: 593 K 593

 Score = 32.7 bits (73), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 30/58 (51%), Gaps = 4/58 (6%)

Query: 97  RRRYVCKI--CSRGFTTSGHLARHNRIHTGEKNHVCPFEGCGQRFSRHDNCVQHYRTH 152
           + +Y C+   C++ F+    L RH ++H+  K + CP   C + FS  D   QH R H
Sbjct: 564 KSQYTCEWEGCNKTFSQRQKLVRHLKVHSKYKPYQCP--QCQKCFSTEDTLNQHKRVH 619

>YPR186C (PZF1) [5600] chr16 complement(909727..911016) RNA
           polymerase III transcription initiation factor TFIIIA,
           has nine C2H2-type zinc fingers [1290 bp, 429 aa]
          Length = 429

 Score = 40.8 bits (94), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 19/43 (44%), Positives = 24/43 (55%), Gaps = 2/43 (4%)

Query: 100 YVCKICSRGFTTSGHLARHNRIHTGEKNHVCPFEGCGQRFSRH 142
           + C  C +G TT   L RH   HT  K+ +CP EGC  RF +H
Sbjct: 108 FQCSYCGKGVTTRQQLKRHEVTHT--KSFICPEEGCNLRFYKH 148

>Scas_693.31
          Length = 635

 Score = 40.8 bits (94), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 19/55 (34%), Positives = 31/55 (56%), Gaps = 6/55 (10%)

Query: 96  QRRRYVCKI--CSRGFTTSGHLARHNRIHTGEKNHVCPFEGCGQRFSRHDNCVQH 148
           + R Y C    C + F  +  L RH ++H+ EK++ CP   CG++F+R D  + H
Sbjct: 515 EDRPYACDFPNCDKAFVRNHDLVRHKKVHS-EKSYACP---CGKKFNREDALIVH 565

 Score = 33.1 bits (74), Expect = 0.087,   Method: Composition-based stats.
 Identities = 13/53 (24%), Positives = 26/53 (49%)

Query: 105 CSRGFTTSGHLARHNRIHTGEKNHVCPFEGCGQRFSRHDNCVQHYRTHLKTNY 157
           C + F    +   H + H  ++ + C F  C + F R+ + V+H + H + +Y
Sbjct: 496 CGKHFKRRYNTRSHIQTHLEDRPYACDFPNCDKAFVRNHDLVRHKKVHSEKSY 548

 Score = 28.1 bits (61), Expect = 3.7,   Method: Composition-based stats.
 Identities = 11/30 (36%), Positives = 16/30 (53%)

Query: 125 EKNHVCPFEGCGQRFSRHDNCVQHYRTHLK 154
           +K   C +  CG+ F R  N   H +THL+
Sbjct: 486 DKTFECLYPNCGKHFKRRYNTRSHIQTHLE 515

>Kwal_47.18337
          Length = 536

 Score = 40.8 bits (94), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 23/69 (33%), Positives = 33/69 (47%), Gaps = 14/69 (20%)

Query: 97  RRRYVCKICSRGFTTSGHLARHNRIHTGEKNHVCPFEGCGQ----------RFSRHDNCV 146
           ++R+VC  C+  F   G+L RH + H  EK + CPF                FSR D   
Sbjct: 154 QKRFVCHYCNAEFYIRGYLTRHIKKHAVEKAYYCPFFNADAPKDARCHTTGGFSRRDT-- 211

Query: 147 QHYRTHLKT 155
             Y+THL++
Sbjct: 212 --YKTHLRS 218

>ADL051W [1690] [Homologous to NOHBY] complement(595496..596017)
           [522 bp, 173 aa]
          Length = 173

 Score = 40.0 bits (92), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 25/51 (49%)

Query: 102 CKICSRGFTTSGHLARHNRIHTGEKNHVCPFEGCGQRFSRHDNCVQHYRTH 152
           C IC + FT    L  H  IHT  K + CP+  C + F+   N  +H R H
Sbjct: 118 CAICRKSFTRKTSLQTHMLIHTKAKPYRCPYRTCNKTFNVKSNLYRHERIH 168

>YPR013C (YPR013C) [5448] chr16 complement(584627..585580) Putative
           transcription factor with similarity to mouse REX1
           encoded transcription factor, has two tandem C2H2-type
           zinc fingers [954 bp, 317 aa]
          Length = 317

 Score = 40.4 bits (93), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 22/53 (41%), Positives = 30/53 (56%), Gaps = 5/53 (9%)

Query: 101 VC-KICSRGFTTSGHLARHNRIHTGEKNHVCPFEGCGQRFSRHDNCVQHYRTH 152
           VC KICSR  T    L  H  IHTG+    C +EGC + F+   N ++H ++H
Sbjct: 258 VCGKICSRPST----LKTHYLIHTGDTPFKCTWEGCTKSFNVKSNMLRHLKSH 306

>YPR015C (YPR015C) [5449] chr16 complement(590278..591021) Protein
           with similarity to human GT box-binding protein
           (SP:B44489), has two tandem C2H2-type zinc fingers [744
           bp, 247 aa]
          Length = 247

 Score = 40.0 bits (92), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 29/58 (50%)

Query: 97  RRRYVCKICSRGFTTSGHLARHNRIHTGEKNHVCPFEGCGQRFSRHDNCVQHYRTHLK 154
           + R  C IC +  +    L  H  IHTG+    C +E C + F+   N ++H RTH K
Sbjct: 182 KLRKQCPICGKVCSRPSTLRTHYLIHTGDTPFKCTWEHCNKSFNVKSNMLRHLRTHQK 239

>KLLA0B03454g complement(314015..315433) some similarities with
           sp|P39933 Saccharomyces cerevisiae YPR186c TFC2 TFIIIA
           (transcription initiation factor), hypothetical start
          Length = 472

 Score = 40.0 bits (92), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 18/43 (41%), Positives = 24/43 (55%), Gaps = 2/43 (4%)

Query: 100 YVCKICSRGFTTSGHLARHNRIHTGEKNHVCPFEGCGQRFSRH 142
           + C IC +G TT   L RH   HT  K+  C +EGC + F +H
Sbjct: 165 FTCSICGKGVTTRQQLKRHEITHT--KSFHCSYEGCNESFYKH 205

 Score = 30.8 bits (68), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 17/56 (30%), Positives = 24/56 (42%), Gaps = 2/56 (3%)

Query: 100 YVCKICSRGFTTSGHLARHNRIHTGEKNHVCPFEGCGQRFSRHDNCVQHYRTHLKT 155
           + C  C + F    HL RH   HT +K   C    CG+  +      +H  TH K+
Sbjct: 137 FKCDTCGKEFAKKSHLNRHMFSHTDDKPFTCSI--CGKGVTTRQQLKRHEITHTKS 190

>YDR253C (MET32) [1086] chr4 complement(963982..964557) Zinc-finger
           protein involved in transcriptional regulation of
           methionine metabolism, has two tandem C2H2-type zinc
           fingers [576 bp, 191 aa]
          Length = 191

 Score = 39.7 bits (91), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 29/54 (53%), Gaps = 2/54 (3%)

Query: 98  RRYVCKICSRGFTTSGHLARHNRIHTGEKNHVCPFEGCGQRFSRHDNCVQHYRT 151
           +R+ C  CS  F+ S  L RH + H     ++CP   CG+ F+R D   +HY T
Sbjct: 96  KRFKCAKCSLEFSRSSDLRRHEKTHFAILPNICP--QCGKGFARKDALKRHYDT 147

>AEL174W [2332] [Homologous to ScYJL056C (ZAP1) - SH]
           complement(310950..312935) [1986 bp, 661 aa]
          Length = 661

 Score = 40.0 bits (92), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 29/56 (51%), Gaps = 2/56 (3%)

Query: 97  RRRYVCKICSRGFTTSGHLARHNRIHTGEKNHVCPFEGCGQRFSRHDNCVQHYRTH 152
            R + C  C + F+TS  L  H R HTGEK   C    CG+RF+   N  +H + H
Sbjct: 569 ERPFHCHYCRKQFSTSSSLRVHIRTHTGEKPLSCTV--CGKRFNESSNLSKHMKIH 622

 Score = 31.6 bits (70), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 28/51 (54%), Gaps = 2/51 (3%)

Query: 102 CKICSRGFTTSGHLARHNRIHTGEKNHVCPFEGCGQRFSRHDNCVQHYRTH 152
           C  C + F+T   LA+H R H+GE+   C +  C ++FS   +   H RTH
Sbjct: 546 CPHCPKTFSTDDILAQHIRTHSGERPFHCHY--CRKQFSTSSSLRVHIRTH 594

>CAGL0I02816g complement(247817..248692) similar to sp|P41696
           Saccharomyces cerevisiae YOR113w AZF1 asparagine-rich
           zinc finger protein, hypothetical start
          Length = 291

 Score = 39.7 bits (91), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 30/63 (47%), Gaps = 1/63 (1%)

Query: 94  IEQRRRYVCKICSRGFTTSGHLARHNRIHTGEKNHVCPFEGCGQRFSRHDNCVQHY-RTH 152
           I   + Y C IC + F+  G+LA H   H   +  +C  + C + FS+  N   H  + H
Sbjct: 5   ITGEKPYECDICKKRFSRKGNLAAHKMTHGKIRPFICKLDNCNKSFSQLGNMKSHQNKFH 64

Query: 153 LKT 155
           L T
Sbjct: 65  LDT 67

>Kwal_23.5400
          Length = 429

 Score = 39.3 bits (90), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 18/43 (41%), Positives = 24/43 (55%), Gaps = 2/43 (4%)

Query: 100 YVCKICSRGFTTSGHLARHNRIHTGEKNHVCPFEGCGQRFSRH 142
           + C  C +G TT   L RH   HT  ++ VCP EGC + F +H
Sbjct: 109 FKCSYCGKGVTTKQQLRRHEITHT--RSFVCPHEGCEESFYKH 149

 Score = 31.6 bits (70), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 25/48 (52%), Gaps = 4/48 (8%)

Query: 100 YVCKICSRGFTTSGHLARHNRIHTGEKNHVCPFEGCG----QRFSRHD 143
           + C +C+R F+   HL RH   H+ +K   C + G G    Q+  RH+
Sbjct: 81  FQCTVCARQFSRKTHLERHMFSHSEDKPFKCSYCGKGVTTKQQLRRHE 128

>ADR308C [2049] [Homologous to NOHBY] (1241869..1242705) [837 bp,
           278 aa]
          Length = 278

 Score = 38.9 bits (89), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 27/55 (49%)

Query: 98  RRYVCKICSRGFTTSGHLARHNRIHTGEKNHVCPFEGCGQRFSRHDNCVQHYRTH 152
           ++ VCK+C R       L  H   HTG++   C   GC + F+   N ++H R H
Sbjct: 202 KKNVCKVCGRECRRPSTLKTHMLTHTGQRPFSCRHPGCSKSFNVRSNMLRHERLH 256

>Sklu_2244.3 , Contig c2244 4100-4915 reverse complement
          Length = 271

 Score = 38.9 bits (89), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 25/53 (47%)

Query: 100 YVCKICSRGFTTSGHLARHNRIHTGEKNHVCPFEGCGQRFSRHDNCVQHYRTH 152
           Y C  C + F     L  H  IH G     C +  C ++F+   N ++HYR+H
Sbjct: 216 YCCPKCKKEFKRPSGLRTHMVIHYGRNPFFCKWPNCSKKFNVKSNLLRHYRSH 268

>CAGL0G10021g complement(959154..960338) similar to sp|P39933
           Saccharomyces cerevisiae YPR186c TFC2, hypothetical
           start
          Length = 394

 Score = 38.5 bits (88), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 17/46 (36%), Positives = 22/46 (47%), Gaps = 2/46 (4%)

Query: 97  RRRYVCKICSRGFTTSGHLARHNRIHTGEKNHVCPFEGCGQRFSRH 142
            R + C  C +G  T   L RH   HT   N  C +EGC + F +H
Sbjct: 92  ERPFYCSFCGKGLITRQQLKRHEVTHTKSFN--CEYEGCNESFYKH 135

 Score = 34.7 bits (78), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 24/51 (47%), Gaps = 4/51 (7%)

Query: 97  RRRYVCKICSRGFTTSGHLARHNRIHTGEKNHVCPFEGCG----QRFSRHD 143
           R+ + C  C   FT   HL RH   HT E+   C F G G    Q+  RH+
Sbjct: 64  RKPWKCNQCESSFTKKIHLERHLYTHTDERPFYCSFCGKGLITRQQLKRHE 114

>CAGL0E04312g 412563..414629 some similarities with sp|Q00947
           Saccharomyces cerevisiae YDR463w STP1 or sp|P38704
           Saccharomyces cerevisiae YHR006w SPT2, hypothetical
           start
          Length = 688

 Score = 38.5 bits (88), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 32/71 (45%), Gaps = 16/71 (22%)

Query: 95  EQRRRYVCKICSRGFTTSGHLARHNRIHTGEKNHVCPFEGCGQR-----------FSRHD 143
           +  + +VC  C   F   G+L RH + H  EK + CPF   GQ            FSR D
Sbjct: 193 DDEKEFVCHYCDAKFRIRGYLTRHIKKHAIEKAYHCPFYN-GQEVPSKRCHNSGGFSRRD 251

Query: 144 NCVQHYRTHLK 154
                Y+TH+K
Sbjct: 252 T----YKTHMK 258

>ADL040W [1701] [Homologous to ScYPR013C - SH]
           complement(618855..619847) [993 bp, 330 aa]
          Length = 330

 Score = 38.1 bits (87), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 25/51 (49%)

Query: 102 CKICSRGFTTSGHLARHNRIHTGEKNHVCPFEGCGQRFSRHDNCVQHYRTH 152
           C +C R  T    L  H  IHTGE    C + GC +RF+   N  +H  +H
Sbjct: 260 CLVCGRRCTRPSTLKTHMLIHTGELPFQCSWPGCSKRFNVRSNMNRHVNSH 310

>KLLA0F10109g complement(939195..941066) weakly similar to sp|Q00947
           Saccharomyces cerevisiae YDR463w STP1 pre-tRNA splicing
           protein, transcription factor, start by similarity
          Length = 623

 Score = 38.1 bits (87), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 32/71 (45%), Gaps = 14/71 (19%)

Query: 95  EQRRRYVCKICSRGFTTSGHLARHNRIHTGEKNHVCPFEGCG----------QRFSRHDN 144
           E   ++VC  C   F   G+L RH + H  EK + CPF                FSR D+
Sbjct: 237 ETDMKFVCHYCDAEFKMRGYLTRHIKKHAIEKAYHCPFWDASLPSEKRCHSTGGFSRRDS 296

Query: 145 CVQHYRTHLKT 155
               Y+THL++
Sbjct: 297 ----YKTHLRS 303

>CAGL0E01331g 124362..126431 weakly similar to sp|P08153
           Saccharomyces cerevisiae YDR146c transcription factor,
           hypothetical start
          Length = 689

 Score = 38.1 bits (87), Expect = 0.002,   Method: Composition-based stats.
 Identities = 17/62 (27%), Positives = 33/62 (53%), Gaps = 2/62 (3%)

Query: 98  RRYVCKI--CSRGFTTSGHLARHNRIHTGEKNHVCPFEGCGQRFSRHDNCVQHYRTHLKT 155
           R Y C    C + F    ++  H + H  ++ + C ++GC + F R+ + V+H +TH + 
Sbjct: 554 RMYECLYPQCGKTFKRRYNIRSHIQTHLEDRPYRCDYDGCDKAFVRNHDLVRHKKTHQEK 613

Query: 156 NY 157
           +Y
Sbjct: 614 SY 615

>AFR461C [3653] [Homologous to ScYDR463W (STP1) - SH]
           (1269565..1271199) [1635 bp, 544 aa]
          Length = 544

 Score = 38.1 bits (87), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 23/69 (33%), Positives = 31/69 (44%), Gaps = 14/69 (20%)

Query: 97  RRRYVCKICSRGFTTSGHLARHNRIHTGEKNHVCPFEGC----------GQRFSRHDNCV 146
           + R+VC  C   F   G+L RH + H  EK + CPF                FSR D   
Sbjct: 149 KERFVCHYCDAEFRIRGYLTRHIKKHAVEKAYHCPFFNSHVPPETRCHTTGGFSRRDT-- 206

Query: 147 QHYRTHLKT 155
             Y+THL++
Sbjct: 207 --YKTHLRS 213

>Kwal_34.15946
          Length = 279

 Score = 37.7 bits (86), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 28/62 (45%), Gaps = 10/62 (16%)

Query: 100 YVCKICSRGFTTSGHLARHNRIHTGEKNHVCPFEGCGQR------FSRHDNCVQHYRTHL 153
           + C  C   F   G+L RH + H   K+  CPF     R      FSR D     Y+THL
Sbjct: 173 FQCAFCPSNFKVKGYLTRHMKKHLVTKDFRCPFWSVDCRCHASGEFSRKDT----YKTHL 228

Query: 154 KT 155
           K+
Sbjct: 229 KS 230

>Sklu_1527.1 YPL038W, Contig c1527 389-1006
          Length = 205

 Score = 37.4 bits (85), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 28/58 (48%), Gaps = 2/58 (3%)

Query: 94  IEQRRRYVCKICSRGFTTSGHLARHNRIHTGEKNHVCPFEGCGQRFSRHDNCVQHYRT 151
           + + ++Y C  C   F  S  L RH R H     ++C    CG+ F+R D   +HY T
Sbjct: 119 LNEDKKYQCDKCELVFRRSSDLRRHERAHLPILPNICSL--CGKGFARKDALKRHYDT 174

>KLLA0C16005g 1397274..1398269 some similarities with sgd|S0006151
           Saccharomyces cerevisiae YPL230w USV1, hypothetical
           start
          Length = 331

 Score = 37.7 bits (86), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/47 (46%), Positives = 25/47 (53%), Gaps = 2/47 (4%)

Query: 105 CSRGFTTSGHLARHNRIHTGEKNHVCPFEGCGQRFSRHDNCVQHYRT 151
           C   FT   HLARH R HTGE+   C    C + FSR DN  QH  +
Sbjct: 28  CRMEFTRQEHLARHIRKHTGEQPFQCHL--CLRFFSRLDNLKQHVES 72

>YPL038W (MET31) [5401] chr16 (480530..481063) Zinc-finger protein
           involved in transcriptional regulation of methionine
           metabolism, has two tandem C2H2-type zinc fingers [534
           bp, 177 aa]
          Length = 177

 Score = 37.0 bits (84), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 26/52 (50%), Gaps = 2/52 (3%)

Query: 100 YVCKICSRGFTTSGHLARHNRIHTGEKNHVCPFEGCGQRFSRHDNCVQHYRT 151
           Y C  C   F+ S  L RH ++H+    H+C    CG+ F+R D   +H  T
Sbjct: 95  YSCAKCQLKFSRSSDLRRHEKVHSLVLPHIC--SNCGKGFARKDALKRHSNT 144

>YMR070W (MOT3) [4029] chr13 (409153..410625) Transcription factor
           that represses a variety of genes, including ANB1, FUS1,
           and ergosterol biosynthetic genes ERG2, ERG6, and ERG9,
           and activates other genes, including CYC1, LEU2, and
           SUC2, contains two tandem C2H2-type zinc fingers [1473
           bp, 490 aa]
          Length = 490

 Score = 37.7 bits (86), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 34/62 (54%), Gaps = 7/62 (11%)

Query: 99  RYV--CKICSRGFTTSGHLARHNRIHTGEKNHVCPFEGCGQRFSRHDNCVQHYRTHLK-T 155
           +Y+  C+ C + F     L RH   H+ +++ +CP+  C  R  R DN +QH +  LK T
Sbjct: 343 KYIHQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPW--CLSRQKRKDNLLQHMK--LKHT 398

Query: 156 NY 157
           NY
Sbjct: 399 NY 400

>CAGL0J01595g 151584..152618 some similarities with tr|Q12531
           Saccharomyces cerevisiae YPR015c or tr|Q12145
           Saccharomyces cerevisiae YPR013c, hypothetical start
          Length = 344

 Score = 37.4 bits (85), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 17/60 (28%), Positives = 30/60 (50%)

Query: 97  RRRYVCKICSRGFTTSGHLARHNRIHTGEKNHVCPFEGCGQRFSRHDNCVQHYRTHLKTN 156
           R R  C +C +  +    L  H  IHTG+    C ++ C + F+   N ++H ++H K +
Sbjct: 281 RLRKQCPVCGKICSRPSTLKTHILIHTGDTPFKCTWKDCRKAFNVKSNLLRHLKSHEKNS 340

>Scas_660.12
          Length = 367

 Score = 37.4 bits (85), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 24/66 (36%), Positives = 28/66 (42%), Gaps = 14/66 (21%)

Query: 99  RYVCKICSRGFTTSGHLARHNRIHTGEKNHVCPFEGC----------GQRFSRHDNCVQH 148
            YVC  C   F   G+L RH + H  EK + CPF                FSR D     
Sbjct: 95  EYVCHYCQAKFRIKGYLTRHIKKHAVEKAYHCPFFSTESPPELRCHNSGGFSRRDT---- 150

Query: 149 YRTHLK 154
           Y+THLK
Sbjct: 151 YKTHLK 156

>KLLA0E18645g complement(1648263..1649558) some similarities with
           sp|P54785 Saccharomyces cerevisiae YMR070w HMS1
           high-copy suppressor of MOT1-SPT3 synthetic lethality
           singleton, hypothetical start
          Length = 431

 Score = 37.4 bits (85), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 26/59 (44%), Gaps = 2/59 (3%)

Query: 92  VPIEQRRRYVCKICSRGFTTSGHLARHNRIHTGEKNHVCPFEGCGQRFSRHDNCVQHYR 150
           VP E    Y C +C + F     L RH   H+  K   CP+  C     R DN +QH +
Sbjct: 298 VPHESHHSYQCHLCEKQFRRKSWLKRHLLSHSNVKKFHCPW--CSSTHKRKDNLLQHLK 354

>CAGL0L05786g complement(636176..637222) some similarities with
           tr|Q12145 Saccharomyces cerevisiae YPR013c or tr|Q12531
           Saccharomyces cerevisiae YPR015c, hypothetical start
          Length = 348

 Score = 37.4 bits (85), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 16/56 (28%), Positives = 28/56 (50%)

Query: 97  RRRYVCKICSRGFTTSGHLARHNRIHTGEKNHVCPFEGCGQRFSRHDNCVQHYRTH 152
           + R  C +C +  +    L  H  IHTG+    CP++ C + F+   N ++H + H
Sbjct: 282 KLRKQCPVCGKVCSRPSTLKTHYLIHTGDTPFKCPWKDCKKAFNVKSNMLRHLKCH 337

>AFR531W [3723] [Homologous to ScAFR531W]
           complement(1389487..1390311) [825 bp, 274 aa]
          Length = 274

 Score = 37.0 bits (84), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 29/62 (46%), Gaps = 10/62 (16%)

Query: 100 YVCKICSRGFTTSGHLARHNRIHTGEKNHVCPF--EGC----GQRFSRHDNCVQHYRTHL 153
           Y C  C   F   G+L RH + H   K+  CP+  E C       FSR D     +RTHL
Sbjct: 156 YRCSYCPSNFKVRGYLTRHLKKHMPYKDFRCPYWSEDCRCHSSGEFSRKDT----FRTHL 211

Query: 154 KT 155
           K+
Sbjct: 212 KS 213

>YLR131C (ACE2) [3541] chr12 complement(404511..406823)
           Metallothionein expression activator with similarity to
           Swi5p, has three tandem C2H2-type zinc fingers [2313 bp,
           770 aa]
          Length = 770

 Score = 37.0 bits (84), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 29/55 (52%), Gaps = 6/55 (10%)

Query: 96  QRRRYVCKI--CSRGFTTSGHLARHNRIHTGEKNHVCPFEGCGQRFSRHDNCVQH 148
           Q R Y C    C++ F  +  L RH   H  +K ++CP   CG+RF+R D  + H
Sbjct: 629 QDRPYSCDFPGCTKAFVRNHDLIRHKISHNAKK-YICP---CGKRFNREDALMVH 679

 Score = 29.6 bits (65), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 13/53 (24%), Positives = 27/53 (50%)

Query: 105 CSRGFTTSGHLARHNRIHTGEKNHVCPFEGCGQRFSRHDNCVQHYRTHLKTNY 157
           C++ F    ++  H + H  ++ + C F GC + F R+ + ++H  +H    Y
Sbjct: 610 CNKVFKRRYNIRSHIQTHLQDRPYSCDFPGCTKAFVRNHDLIRHKISHNAKKY 662

>KLLA0A10373g complement(907244..907864) some similarities with
           ca|CA1157|CaPZF1 Candida albicans TFIIIA (transcription
           initiation factor) (by homology), hypothetical start
          Length = 206

 Score = 36.6 bits (83), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 24/65 (36%), Positives = 34/65 (52%), Gaps = 3/65 (4%)

Query: 94  IEQR-RRYVCKI--CSRGFTTSGHLARHNRIHTGEKNHVCPFEGCGQRFSRHDNCVQHYR 150
           +E+R +RYVC I  C + ++    L +H R HT EK   CP  GC + F R  +   H  
Sbjct: 1   MEKRPKRYVCPIESCGKKYSRPCLLRQHVRSHTNEKPFHCPEPGCDKAFLRPSHLRVHML 60

Query: 151 THLKT 155
           +H K 
Sbjct: 61  SHSKV 65

 Score = 31.6 bits (70), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 13/40 (32%), Positives = 20/40 (50%), Gaps = 4/40 (10%)

Query: 100 YVCKICSRGFTTSGHLARHNRIHTGEKN----HVCPFEGC 135
           Y C +C +GF T     RH + HT  ++    + C + GC
Sbjct: 68  YNCSVCGKGFATKQQFQRHQQTHTQNQDDTSTYQCGYYGC 107

>YHR006W (STP2) [2292] chr8 (117808..119433) Transcription factor
           involved in regulating transcription of amino acid
           permease genes, functions redundantly with Stp1p, which
           is involved in tRNA splicing and branched-chain amino
           acid uptake [1626 bp, 541 aa]
          Length = 541

 Score = 37.0 bits (84), Expect = 0.004,   Method: Composition-based stats.
 Identities = 23/68 (33%), Positives = 30/68 (44%), Gaps = 14/68 (20%)

Query: 100 YVCKICSRGFTTSGHLARHNRIHTGEKNHVCPF--EGCGQR--------FSRHDNCVQHY 149
           Y+C  C   F   G+L RH + H   K + CPF      Q         FSR D     Y
Sbjct: 204 YICHYCDARFRIRGYLTRHIKKHAKRKAYHCPFFDNSISQELRCHTSGGFSRRDT----Y 259

Query: 150 RTHLKTNY 157
           +THLK+ +
Sbjct: 260 KTHLKSRH 267

>Scas_378.1
          Length = 208

 Score = 36.6 bits (83), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 26/51 (50%), Gaps = 2/51 (3%)

Query: 100 YVCKICSRGFTTSGHLARHNRIHTGEKNHVCPFEGCGQRFSRHDNCVQHYR 150
           Y C +C + F     L RH   H+ ++++ CP   C  +  R DN +QH +
Sbjct: 84  YQCHMCVKSFRRHSWLKRHLLAHSSQRHYSCP--KCVSKHKRKDNLLQHLK 132

>AGL246W [4066] [Homologous to ScYDR253C (MET32) - SH; ScYPL038W
           (MET31) - SH] complement(240857..241540) [684 bp, 227
           aa]
          Length = 227

 Score = 36.6 bits (83), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 29/58 (50%), Gaps = 2/58 (3%)

Query: 94  IEQRRRYVCKICSRGFTTSGHLARHNRIHTGEKNHVCPFEGCGQRFSRHDNCVQHYRT 151
           +   +R+ C  C   F  SG L RH ++H     ++C    CG+ F+R D   +H+ T
Sbjct: 141 VNDGKRFHCTKCELVFRRSGDLRRHEKVHLPILPNICSL--CGKGFARKDALKRHFGT 196

>Scas_568.5
          Length = 199

 Score = 36.2 bits (82), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 26/54 (48%), Gaps = 2/54 (3%)

Query: 98  RRYVCKICSRGFTTSGHLARHNRIHTGEKNHVCPFEGCGQRFSRHDNCVQHYRT 151
           +RY C  C   F  S  L RH + H     H+C    CG+ F+R D   +H+ T
Sbjct: 116 KRYPCSKCELIFLRSSDLRRHEKAHLLVLPHIC--SQCGKGFARKDALKRHFNT 167

>Kwal_26.8021
          Length = 507

 Score = 36.6 bits (83), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 24/52 (46%), Gaps = 2/52 (3%)

Query: 100 YVCKICSRGFTTSGHLARHNRIHTGEKNHVCPFEGCGQRFSRHDNCVQHYRT 151
           Y C +C + F       RH   H+  K + CP+  C  R  R DN  QH +T
Sbjct: 389 YRCSMCDKSFKRRSWHKRHLLSHSSFKPYSCPW--CQSRHKRRDNLFQHMKT 438

>Sklu_2289.1 YGL254W, Contig c2289 150-1025 reverse complement
          Length = 291

 Score = 36.2 bits (82), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 30/57 (52%), Gaps = 2/57 (3%)

Query: 98  RRYVCKI--CSRGFTTSGHLARHNRIHTGEKNHVCPFEGCGQRFSRHDNCVQHYRTH 152
           ++Y+C +  C + ++    L +H R HT E+  VC   GCG+ F R  +   H  +H
Sbjct: 6   KKYLCSVDGCGKMYSRPCLLEQHRRSHTNERPFVCEEPGCGKGFLRASHLKVHKWSH 62

 Score = 32.7 bits (73), Expect = 0.090,   Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 18/27 (66%)

Query: 96  QRRRYVCKICSRGFTTSGHLARHNRIH 122
           Q +   C +CS+GFTT+  L+RH + H
Sbjct: 64  QVKPLACPVCSKGFTTNQQLSRHKKTH 90

 Score = 32.0 bits (71), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 21/68 (30%), Positives = 32/68 (47%), Gaps = 11/68 (16%)

Query: 94  IEQRRR-------YVCKI--CSRGFTTSGHLARHNRIHTGEKNHVCPFEGCGQRFSRHDN 144
           +EQ RR       +VC+   C +GF  + HL  H   H+  K   CP   C + F+ +  
Sbjct: 25  LEQHRRSHTNERPFVCEEPGCGKGFLRASHLKVHKWSHSQVKPLACPV--CSKGFTTNQQ 82

Query: 145 CVQHYRTH 152
             +H +TH
Sbjct: 83  LSRHKKTH 90

>Sklu_2359.5 YPR022C, Contig c2359 10655-12818
          Length = 722

 Score = 36.6 bits (83), Expect = 0.006,   Method: Composition-based stats.
 Identities = 23/69 (33%), Positives = 37/69 (53%), Gaps = 8/69 (11%)

Query: 95  EQRRRYVCK--ICSRGFTTSGHLARHNRIHTGEK----NHVCPFEG--CGQRFSRHDNCV 146
           + + RYVC    CS+ FT   HL+RH   H  ++    ++V P +G  C + F R D  V
Sbjct: 11  QGKPRYVCPHPNCSKSFTRQEHLSRHKLNHWPKEIFRCHYVYPEDGVACNRTFVRRDLLV 70

Query: 147 QHYRTHLKT 155
           +H + H ++
Sbjct: 71  RHEKRHSRS 79

>CAGL0L00583g 69547..70713 similar to tr|Q12132 Saccharomyces
           cerevisiae YPL230w USV1, hypothetical start
          Length = 388

 Score = 36.2 bits (82), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 24/41 (58%), Gaps = 2/41 (4%)

Query: 108 GFTTSGHLARHNRIHTGEKNHVCPFEGCGQRFSRHDNCVQH 148
            FT + H ARH R HTGEK   C  + C + FSR DN  QH
Sbjct: 2   AFTRAEHHARHIRKHTGEKPFQC--DICMKFFSRIDNLKQH 40

>YDR463W (STP1) [1281] chr4 (1386804..1388363) Transcription factor
           involved in regulating transcription of amino acid
           permease genes and involved in pre-tRNA splicing of
           specific tRNA species, has three C2H2-type zinc fingers
           [1560 bp, 519 aa]
          Length = 519

 Score = 36.2 bits (82), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 28/68 (41%), Gaps = 14/68 (20%)

Query: 97  RRRYVCKICSRGFTTSGHLARHNRIHTGEKNHVCPFEGCGQ----------RFSRHDNCV 146
              ++C  C   F   G+L RH + H  EK + CPF                FSR D   
Sbjct: 157 EEEFICHYCDATFRIRGYLTRHIKKHAIEKAYHCPFFNSATPPDLRCHNSGGFSRRDT-- 214

Query: 147 QHYRTHLK 154
             Y+THLK
Sbjct: 215 --YKTHLK 220

>CAGL0K03003g 276756..278699 weakly similar to sp|P54785
           Saccharomyces cerevisiae YMR070w MOT3, hypothetical
           start
          Length = 647

 Score = 35.8 bits (81), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 16/49 (32%), Positives = 26/49 (53%), Gaps = 2/49 (4%)

Query: 102 CKICSRGFTTSGHLARHNRIHTGEKNHVCPFEGCGQRFSRHDNCVQHYR 150
           C +C + F     L RH   H+ +++ +CP+  C  R  R DN +QH +
Sbjct: 536 CHLCPKLFKRKSWLKRHLLSHSQQRHFLCPW--CNSRHKRRDNLLQHMK 582

>AGL197W [4115] [Homologous to ScYDR146C (SWI5) - SH; ScYLR131C
           (ACE2) - SH] complement(325717..328251) [2535 bp, 844
           aa]
          Length = 844

 Score = 35.8 bits (81), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 24/44 (54%), Gaps = 4/44 (9%)

Query: 105 CSRGFTTSGHLARHNRIHTGEKNHVCPFEGCGQRFSRHDNCVQH 148
           C++ F  +  L RH + H  EK   CP   CG++FSR D  + H
Sbjct: 711 CTKAFVRNHDLIRHKKTHA-EKTFTCP---CGKKFSREDALLTH 750

 Score = 31.6 bits (70), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 17/79 (21%), Positives = 37/79 (46%), Gaps = 11/79 (13%)

Query: 90  ANVPIEQRRRYVCKI-----------CSRGFTTSGHLARHNRIHTGEKNHVCPFEGCGQR 138
           +N+P  +  +Y+ K+           C + F    ++  H + H  ++   C  EGC + 
Sbjct: 655 SNLPQGEIDQYIKKLQDKTFQCLYPECGKLFNRRYNIRSHIQTHLEDRPFRCDHEGCTKA 714

Query: 139 FSRHDNCVQHYRTHLKTNY 157
           F R+ + ++H +TH +  +
Sbjct: 715 FVRNHDLIRHKKTHAEKTF 733

>Scas_641.24
          Length = 532

 Score = 35.8 bits (81), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 22/65 (33%), Positives = 28/65 (43%), Gaps = 14/65 (21%)

Query: 100 YVCKICSRGFTTSGHLARHNRIHTGEKNHVCPFEGCG----------QRFSRHDNCVQHY 149
           ++C  C   F   G+L RH + H  EK + CPF                FSR D     Y
Sbjct: 183 FICHYCDAKFRIRGYLTRHIKKHAVEKAYHCPFFNSDILSESRCHNTGGFSRRDT----Y 238

Query: 150 RTHLK 154
           +THLK
Sbjct: 239 KTHLK 243

>CAGL0M04323g complement(474158..476269) similar to sp|P21192
           Saccharomyces cerevisiae YLR131c ACE2 or sp|P08153
           Saccharomyces cerevisiae YDR146c SWI5, hypothetical
           start
          Length = 703

 Score = 35.4 bits (80), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 27/50 (54%)

Query: 105 CSRGFTTSGHLARHNRIHTGEKNHVCPFEGCGQRFSRHDNCVQHYRTHLK 154
           C + F    ++  H + H  +K + C FEGC + F R+ +  +H +TH K
Sbjct: 530 CGKFFRRRYNIKSHIQTHLEDKPYKCDFEGCTKAFVRNHDLARHKKTHDK 579

 Score = 33.9 bits (76), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 29/55 (52%), Gaps = 7/55 (12%)

Query: 100 YVCKI--CSRGFTTSGHLARHNRIHTGEKNHVCPFEGCGQRFSRHDNCVQHYRTH 152
           Y C    C++ F  +  LARH + H  +K+  CP   CG++FS   + ++H   H
Sbjct: 553 YKCDFEGCTKAFVRNHDLARHKKTH--DKHFSCP---CGKKFSSEQSMMKHKNRH 602

 Score = 30.0 bits (66), Expect = 0.88,   Method: Compositional matrix adjust.
 Identities = 13/30 (43%), Positives = 17/30 (56%)

Query: 125 EKNHVCPFEGCGQRFSRHDNCVQHYRTHLK 154
           +KN  C F  CG+ F R  N   H +THL+
Sbjct: 520 DKNFECLFPNCGKFFRRRYNIKSHIQTHLE 549

>Scas_602.4
          Length = 266

 Score = 35.0 bits (79), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 25/52 (48%), Gaps = 4/52 (7%)

Query: 103 KICSRGFTTSGHLARHNRIHTGEKNHVCPFEGCGQRFSRHDNCVQHYRTHLK 154
           KICSR  T   H      IHTG+    C +  C + F+   N ++H + H K
Sbjct: 207 KICSRPSTLKAHYL----IHTGDTPFKCTWGNCNKAFNVKSNMLRHLKAHEK 254

>Kwal_56.23925
          Length = 745

 Score = 35.4 bits (80), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 15/53 (28%), Positives = 29/53 (54%)

Query: 105 CSRGFTTSGHLARHNRIHTGEKNHVCPFEGCGQRFSRHDNCVQHYRTHLKTNY 157
           C + F    ++  H + H  ++ + C FEGC + F R+ + ++H +TH +  Y
Sbjct: 592 CGKTFRRRYNIRSHIQTHLEDRPYFCDFEGCHKAFVRNHDLIRHKKTHAEKCY 644

>ADL050W [1691] [Homologous to NOHBY] complement(597229..597669)
           [441 bp, 146 aa]
          Length = 146

 Score = 34.3 bits (77), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 16/60 (26%), Positives = 26/60 (43%)

Query: 93  PIEQRRRYVCKICSRGFTTSGHLARHNRIHTGEKNHVCPFEGCGQRFSRHDNCVQHYRTH 152
           P+       C +C + FT    L  H  IH   + ++C +  C + F+   N  +H R H
Sbjct: 69  PLMALNSKTCPVCLKEFTRKTSLNTHLLIHADIRPYLCDYANCNKSFNVKSNLNRHLRIH 128

 Score = 27.3 bits (59), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 13/33 (39%), Positives = 18/33 (54%), Gaps = 2/33 (6%)

Query: 98  RRYVCKI--CSRGFTTSGHLARHNRIHTGEKNH 128
           R Y+C    C++ F    +L RH RIH G + H
Sbjct: 102 RPYLCDYANCNKSFNVKSNLNRHLRIHRGHELH 134

>CAGL0K02343g 208645..212133 similar to tr|Q12139 Saccharomyces
           cerevisiae YPR022c, hypothetical start
          Length = 1162

 Score = 35.0 bits (79), Expect = 0.016,   Method: Composition-based stats.
 Identities = 21/67 (31%), Positives = 32/67 (47%), Gaps = 8/67 (11%)

Query: 99  RYVCK--ICSRGFTTSGHLARHNRIHTGEK----NHVCPFEG--CGQRFSRHDNCVQHYR 150
           RY C    C + F+   HL+RH   H  ++    ++V P  G  CG+ F R D   +H +
Sbjct: 44  RYKCPHPTCDKSFSRQEHLSRHKLNHWPKEIFKCHYVSPLSGQPCGKTFVRRDLLNRHEK 103

Query: 151 THLKTNY 157
            H   +Y
Sbjct: 104 RHENKSY 110

>Scas_717.60d
          Length = 167

 Score = 34.3 bits (77), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 25/50 (50%), Gaps = 1/50 (2%)

Query: 100 YVCKICSRGFTTSGHLARHNRIHTGEKNHVCPFEGCGQRFSRHDNCVQHY 149
           + CK CS+ F TS  L +H +    ++   C +  CG+ F R D    HY
Sbjct: 99  FNCKECSKAFVTSQKLKKHTKDAHSKRMFPCEY-NCGKAFKRKDQRKSHY 147

>Kwal_27.11824
          Length = 199

 Score = 34.3 bits (77), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 20/67 (29%), Positives = 30/67 (44%), Gaps = 5/67 (7%)

Query: 88  ATANVPIEQR---RRYVCKICSRGFTTSGHLARHNRIHTGEKNHVCPFEGCGQRFSRHDN 144
           A  N  +E     +++ C  C   F  S  L RH R H     ++C    CG+ F+R D 
Sbjct: 104 AKGNASVEDDAGAKKFPCAKCELVFRRSSDLRRHERAHLPILPNICSL--CGKGFARKDA 161

Query: 145 CVQHYRT 151
             +H+ T
Sbjct: 162 LKRHFDT 168

>Scas_631.7
          Length = 433

 Score = 34.7 bits (78), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 16/43 (37%), Positives = 23/43 (53%), Gaps = 2/43 (4%)

Query: 100 YVCKICSRGFTTSGHLARHNRIHTGEKNHVCPFEGCGQRFSRH 142
           + C  C +G TT   L RH   HT  K+  CP+E C + + +H
Sbjct: 116 FCCLHCGKGVTTRQQLKRHEVTHT--KSFKCPYENCDEAYYKH 156

>Scas_602.4d
          Length = 256

 Score = 34.7 bits (78), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 15/51 (29%), Positives = 24/51 (47%)

Query: 102 CKICSRGFTTSGHLARHNRIHTGEKNHVCPFEGCGQRFSRHDNCVQHYRTH 152
           C +C +  +    L  H  IHTG+    C + GC + F+   N  +H + H
Sbjct: 197 CPVCGKMCSRPSTLKTHFLIHTGDTPFKCTYHGCKKSFNVKSNMFRHLKCH 247

>YDR146C (SWI5) [991] chr4 complement(748607..750736) Transcription
           factor that controls cell cycle-specific transcription
           of HO, has three tandem C2H2-type zinc fingers [2130 bp,
           709 aa]
          Length = 709

 Score = 35.0 bits (79), Expect = 0.020,   Method: Composition-based stats.
 Identities = 20/55 (36%), Positives = 28/55 (50%), Gaps = 6/55 (10%)

Query: 96  QRRRYVCKI--CSRGFTTSGHLARHNRIHTGEKNHVCPFEGCGQRFSRHDNCVQH 148
           + R Y C    C + F  +  L RH + H  EK + CP   CG++F+R D  V H
Sbjct: 576 EDRPYSCDHPGCDKAFVRNHDLIRHKKSHQ-EKAYACP---CGKKFNREDALVVH 626

 Score = 32.7 bits (73), Expect = 0.11,   Method: Composition-based stats.
 Identities = 12/53 (22%), Positives = 28/53 (52%)

Query: 105 CSRGFTTSGHLARHNRIHTGEKNHVCPFEGCGQRFSRHDNCVQHYRTHLKTNY 157
           C++ F    ++  H + H  ++ + C   GC + F R+ + ++H ++H +  Y
Sbjct: 557 CTKTFKRRYNIRSHIQTHLEDRPYSCDHPGCDKAFVRNHDLIRHKKSHQEKAY 609

 Score = 28.1 bits (61), Expect = 4.0,   Method: Composition-based stats.
 Identities = 12/30 (40%), Positives = 16/30 (53%)

Query: 125 EKNHVCPFEGCGQRFSRHDNCVQHYRTHLK 154
           +K   C F GC + F R  N   H +THL+
Sbjct: 547 DKTFECLFPGCTKTFKRRYNIRSHIQTHLE 576

>KLLA0D16456g complement(1387846..1390410) weakly similar to
           sp|P21192 Saccharomyces cerevisiae YLR131c ACE2
           metallothionein expression activator, hypothetical start
          Length = 854

 Score = 34.7 bits (78), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 19/77 (24%), Positives = 37/77 (48%), Gaps = 11/77 (14%)

Query: 92  VPIEQRRRYVCKI-----------CSRGFTTSGHLARHNRIHTGEKNHVCPFEGCGQRFS 140
           +P EQ  +Y+ +I           C + F    +   H + H  ++ + C F GC + F 
Sbjct: 676 LPREQIDKYILEIGPKQFQCKFKDCQKRFNRRYNARTHIQTHLCDRPYKCDFPGCQKAFV 735

Query: 141 RHDNCVQHYRTHLKTNY 157
           R+ + ++H ++HL+  Y
Sbjct: 736 RNHDLLRHKKSHLEKGY 752

 Score = 33.5 bits (75), Expect = 0.058,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 27/53 (50%), Gaps = 5/53 (9%)

Query: 98  RRYVCKI--CSRGFTTSGHLARHNRIHTGEKNHVCPFEGCGQRFSRHDNCVQH 148
           R Y C    C + F  +  L RH + H  EK + C   GCG++F   D+ V+H
Sbjct: 721 RPYKCDFPGCQKAFVRNHDLLRHKKSHL-EKGYSC--AGCGKKFHSEDSLVKH 770

>AGL071C [4240] [Homologous to ScYMR070W (MOT3) - SH]
           (574723..575913) [1191 bp, 396 aa]
          Length = 396

 Score = 34.3 bits (77), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 22/49 (44%), Gaps = 2/49 (4%)

Query: 102 CKICSRGFTTSGHLARHNRIHTGEKNHVCPFEGCGQRFSRHDNCVQHYR 150
           C  C + F     L RH   H+  K + CP+  C  R  R DN  QH +
Sbjct: 187 CHFCEKAFKRKSWLKRHLLSHSTMKPYSCPW--CHSRHKRKDNLSQHLK 233

>CAGL0B02651g complement(253495..254064) weakly similar to sp|Q12041
           Saccharomyces cerevisiae YDR253c MET32 transcriptional
           regulator of sulfur amino acid metabolism, hypothetical
           start
          Length = 189

 Score = 33.5 bits (75), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 28/55 (50%), Gaps = 3/55 (5%)

Query: 100 YVCKICSRGFTTSGHLARHNRI-HTGEKNHVCPFEGCGQRFSRHDNCVQHYRTHL 153
           Y C IC   +     L +H R  H  ++ +VC    CG++F+R D   +H+ T L
Sbjct: 120 YPCNICGISYDKLTDLRKHERASHEPKQENVC--MNCGKKFARKDALKRHFDTVL 172

>CAGL0K06413g 627811..628890 some similarities with sp|Q00947
           Saccharomyces cerevisiae YDR463w STP1, hypothetical
           start
          Length = 359

 Score = 33.5 bits (75), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 20/70 (28%), Positives = 30/70 (42%), Gaps = 14/70 (20%)

Query: 96  QRRRYVCKICSRGFTTSGHLARHNRIHTGEKNHVCPFEG----------CGQRFSRHDNC 145
           ++  +VC  C   F   G+L RH + H  +K + CP+                FSR D  
Sbjct: 37  EQEEFVCHYCDARFKIRGYLTRHIKKHALQKAYYCPYYNEKAPPDLRCHNNGGFSRRDT- 95

Query: 146 VQHYRTHLKT 155
              Y+ H+KT
Sbjct: 96  ---YKAHMKT 102

>KLLA0F07073g 675221..676897 some similarities with sgd|S0004367
           Saccharomyces cerevisiae YLR375w STP3 involved in
           pre-tRNA splicing and in uptake of branched-chain amino
           acids, hypothetical start
          Length = 558

 Score = 33.5 bits (75), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 18/27 (66%)

Query: 96  QRRRYVCKICSRGFTTSGHLARHNRIH 122
           + R + C++CSRGF  S  L RH ++H
Sbjct: 407 ETRPFKCEVCSRGFARSNDLIRHKKLH 433

 Score = 26.9 bits (58), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 14/60 (23%), Positives = 29/60 (48%), Gaps = 3/60 (5%)

Query: 97  RRRYVCKICSRGFTTSGHLARHNRIHTGEKNHVCPFEGCGQRFSRHDNCVQHYRTHLKTN 156
           R++  C +C   F+   +L+ H   H   +      E C + F+R ++ ++H + H K +
Sbjct: 381 RKKKQCPLCGLFFS---NLSTHKSTHLSPETRPFKCEVCSRGFARSNDLIRHKKLHWKDD 437

>Scas_713.52
          Length = 620

 Score = 33.5 bits (75), Expect = 0.062,   Method: Compositional matrix adjust.
 Identities = 14/48 (29%), Positives = 26/48 (54%)

Query: 105 CSRGFTTSGHLARHNRIHTGEKNHVCPFEGCGQRFSRHDNCVQHYRTH 152
           C + F    ++  H + H  +K + C F GC + F R+ + V+H ++H
Sbjct: 487 CGKIFKRRYNVRSHIQTHLEDKPYACDFPGCEKAFVRNHDLVRHKKSH 534

 Score = 28.9 bits (63), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 19/69 (27%), Positives = 28/69 (40%), Gaps = 5/69 (7%)

Query: 91  NVPIEQRRRYVCKICSRGFTTSGHLARHNRI-----HTGEKNHVCPFEGCGQRFSRHDNC 145
           N P++Q++R   K      T          I        +K   C +E CG+ F R  N 
Sbjct: 438 NTPVKQQQRTPIKTSPTRITNKPSTLPRGTIDLYVKELPDKLFECLYEDCGKIFKRRYNV 497

Query: 146 VQHYRTHLK 154
             H +THL+
Sbjct: 498 RSHIQTHLE 506

>AGR186C [4497] [Homologous to NOHBY] (1099513..1100376) [864 bp,
           287 aa]
          Length = 287

 Score = 33.1 bits (74), Expect = 0.071,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 24/52 (46%), Gaps = 2/52 (3%)

Query: 101 VCKICSRGFTTSGHLARHNRIHTGEKNHVCPFEGCGQRFSRHDNCVQHYRTH 152
           +C +C + FT    L  H  IHT  K   C F  C + F+   N  +H R H
Sbjct: 168 ICPLCGKSFTRRSTLQIHLLIHTNLKPFKCSF--CDKEFNVKSNLNRHERIH 217

>KLLA0D11902g 1015273..1016142 some similarities with sp|Q12041
           Saccharomyces cerevisiae YDR253c MET32 transcriptional
           regulator of sulfur amino acid metabolism, hypothetical
           start
          Length = 289

 Score = 32.7 bits (73), Expect = 0.077,   Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 27/54 (50%), Gaps = 2/54 (3%)

Query: 98  RRYVCKICSRGFTTSGHLARHNRIHTGEKNHVCPFEGCGQRFSRHDNCVQHYRT 151
           +R+ C+ C   F  S  L RH R H     ++C    CG+ F+R D   +H+ T
Sbjct: 202 KRFPCEKCHMVFRRSSDLRRHERQHLPILPNICTL--CGKGFARKDALKRHFDT 253

>Kwal_26.9300
          Length = 304

 Score = 32.3 bits (72), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 30/58 (51%), Gaps = 3/58 (5%)

Query: 97  RRRYVCKICSRGFTTSGHLARHNRIHTGEKNHVCPFEGCGQRFSRHDNCVQHYRTHLK 154
           RR+  C IC   F  +    R + +    K H CP   CG+ F+RH++ ++H + H K
Sbjct: 143 RRKKECPIC-HNFYANLSTHRSSHLQPENKPHKCPV--CGRGFTRHNDLLRHRKRHWK 197

 Score = 29.3 bits (64), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 11/29 (37%), Positives = 17/29 (58%)

Query: 102 CKICSRGFTTSGHLARHNRIHTGEKNHVC 130
           C +C RGFT    L RH + H  ++++ C
Sbjct: 175 CPVCGRGFTRHNDLLRHRKRHWKDEDNSC 203

>YPR022C (YPR022C) [5456] chr16 complement(603906..607307) Predicted
           transcription factor with two tandem C2H2-type zinc
           fingers, contains Q/N-rich regions which may mediate
           prion-like aggregation [3402 bp, 1133 aa]
          Length = 1133

 Score = 32.7 bits (73), Expect = 0.10,   Method: Composition-based stats.
 Identities = 16/56 (28%), Positives = 28/56 (50%), Gaps = 6/56 (10%)

Query: 105 CSRGFTTSGHLARHNRIHTGEKNHVCPF------EGCGQRFSRHDNCVQHYRTHLK 154
           C++ F+   HL+RH   H  ++ +VC +        C + F R D  ++H + H K
Sbjct: 38  CNKTFSRQEHLSRHKLNHWPKEIYVCSYVLPTTNAPCNKTFVRKDLLIRHEKRHSK 93

>Kwal_27.10167
          Length = 285

 Score = 32.3 bits (72), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 20/68 (29%), Positives = 31/68 (45%), Gaps = 2/68 (2%)

Query: 89  TANVPIEQRRRYVCKI--CSRGFTTSGHLARHNRIHTGEKNHVCPFEGCGQRFSRHDNCV 146
           T ++  E  ++Y+C I  C++ +     L  H   H   +   CP   CG+RF R  +  
Sbjct: 24  TWSMSRECDKKYICPITSCNKRYRKPSSLREHVNSHNNNRPFACPEPNCGKRFLRVCHMN 83

Query: 147 QHYRTHLK 154
            H  TH K
Sbjct: 84  VHRWTHSK 91

 Score = 27.7 bits (60), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 11/21 (52%), Positives = 14/21 (66%)

Query: 102 CKICSRGFTTSGHLARHNRIH 122
           C+ CS+GFTT   L+RH   H
Sbjct: 97  CEECSKGFTTKQQLSRHLATH 117

>Sklu_2154.3 , Contig c2154 4677-5249 reverse complement
          Length = 190

 Score = 31.6 bits (70), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 20/65 (30%), Positives = 29/65 (44%), Gaps = 10/65 (15%)

Query: 97  RRRYVCKICSRGFTTSGHLARHNRIHTGEKNHVCPFEG------CGQRFSRHDNCVQHYR 150
           R  + C  C   F   G+L RH + H   K++ CP+            FSR D     ++
Sbjct: 75  REIFQCPHCPSNFKVKGYLTRHLKKHLPNKDYHCPYWSPDCKCHTTGEFSRKDT----FK 130

Query: 151 THLKT 155
           THLK+
Sbjct: 131 THLKS 135

>CAGL0H04873g complement(465069..466424) some similarities with
           tr|Q05937 Saccharomyces cerevisiae YLR375w STP3 or
           tr|Q07351 Saccharomyces cerevisiae YDL048c STP4,
           hypothetical start
          Length = 451

 Score = 31.2 bits (69), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 10/27 (37%), Positives = 16/27 (59%)

Query: 100 YVCKICSRGFTTSGHLARHNRIHTGEK 126
           +VC +C RGF     + RH ++H  +K
Sbjct: 291 FVCSVCQRGFVRQNDVMRHEKMHWKDK 317

>CAGL0L12562g complement(1350878..1351549) similar to sp|Q12041
           Saccharomyces cerevisiae YDR253c MET32 or tr|Q03081
           Saccharomyces cerevisiae YPL038w MET31, hypothetical
           start
          Length = 223

 Score = 30.8 bits (68), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 23/50 (46%), Gaps = 2/50 (4%)

Query: 102 CKICSRGFTTSGHLARHNRIHTGEKNHVCPFEGCGQRFSRHDNCVQHYRT 151
           C  CS  F  S  L RH R H     ++C    CG+ F+R D   +H  T
Sbjct: 144 CSQCSLKFNRSSDLRRHERAHLLVLPYICT--QCGKGFARKDALKRHSGT 191

 Score = 29.3 bits (64), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 13/41 (31%), Positives = 19/41 (46%)

Query: 100 YVCKICSRGFTTSGHLARHNRIHTGEKNHVCPFEGCGQRFS 140
           Y+C  C +GF     L RH+   T ++N     E  G+  S
Sbjct: 170 YICTQCGKGFARKDALKRHSGTMTCKRNRRKLMEAAGREVS 210

>YDL048C (STP4) [816] chr4 complement(366739..368211) Protein with
           strong similarity to Stp1p, which is involved in tRNA
           splicing and branched-chain amino acid uptake [1473 bp,
           490 aa]
          Length = 490

 Score = 30.8 bits (68), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 17/65 (26%), Positives = 34/65 (52%), Gaps = 7/65 (10%)

Query: 95  EQRRRYVCKICSRGFTTSGHLARHNRIHTG--EKNHVCPFEGCGQRFSRHDNCVQHYRTH 152
           +QR++  C IC   +    +L+ H   H    ++ H CP   C + F+R+++ ++H + H
Sbjct: 272 KQRKKKECPICHNFY---ANLSTHKSTHLTPEDRPHKCPI--CQRGFARNNDLIRHKKRH 326

Query: 153 LKTNY 157
            K  +
Sbjct: 327 WKDEF 331

>CAGL0I02838g complement(248704..250671) similar to sp|P41696
           Saccharomyces cerevisiae YOR113w AZF1 asparagine-rich
           zinc finger protein, hypothetical start
          Length = 655

 Score = 30.8 bits (68), Expect = 0.41,   Method: Composition-based stats.
 Identities = 15/40 (37%), Positives = 22/40 (55%), Gaps = 2/40 (5%)

Query: 98  RRYVCKICSRGFTTSGHLARHNRIHTGEKNHVCPFEGCGQ 137
           +++ C+ C R F    HL  H R H G+K + C  E CG+
Sbjct: 612 KQFECQYCHRCFAQVTHLDVHIRSHLGKKPYQC--EYCGK 649

>YGL254W (FZF1) [1746] chr7 (22304..23203) Transcription factor
           involved in sulfite metabolism, has five C2H2-type zinc
           fingers [900 bp, 299 aa]
          Length = 299

 Score = 30.4 bits (67), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 15/48 (31%), Positives = 23/48 (47%), Gaps = 2/48 (4%)

Query: 96  QRRRYVCKI--CSRGFTTSGHLARHNRIHTGEKNHVCPFEGCGQRFSR 141
           + R Y C    C + +     L +H   HT +K + C   GCG++F R
Sbjct: 8   KSRNYKCSFDGCEKVYNRPSLLQQHQNSHTNQKPYHCDEPGCGKKFIR 55

>Scas_670.2
          Length = 435

 Score = 30.4 bits (67), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 18/61 (29%), Positives = 31/61 (50%), Gaps = 7/61 (11%)

Query: 96  QRRRYVCKICSRGFTTSGHLARHNRIHT--GEKNHVCPFEGCGQRFSRHDNCVQHYRTHL 153
           +RR+  C ICS  +    +L  H   H    ++ H CP   C + F R+++ ++H + H 
Sbjct: 248 KRRKKQCPICSGYY---ANLTTHKATHLVPEDRPHKCPI--CQRGFGRNNDLIRHQKRHW 302

Query: 154 K 154
           K
Sbjct: 303 K 303

 Score = 27.3 bits (59), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 11/29 (37%), Positives = 16/29 (55%)

Query: 94  IEQRRRYVCKICSRGFTTSGHLARHNRIH 122
           + + R + C IC RGF  +  L RH + H
Sbjct: 273 VPEDRPHKCPICQRGFGRNNDLIRHQKRH 301

>KLLA0E13519g complement(1190615..1191307) some similarities with
           sgd|S0006226 Saccharomyces cerevisiae YPR022c,
           hypothetical start
          Length = 230

 Score = 30.0 bits (66), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 30/62 (48%), Gaps = 8/62 (12%)

Query: 99  RYVCK--ICSRGFTTSGHLARHNRIHTGEK----NHVCPFEG--CGQRFSRHDNCVQHYR 150
           RYVC    C + F+   HL RH   H  ++     +V P +G  C + F R D  V+H R
Sbjct: 17  RYVCPHPDCEKTFSRYEHLQRHKLNHWPKQIFRCEYVYPDDGIVCNRTFVRKDLLVRHQR 76

Query: 151 TH 152
            H
Sbjct: 77  RH 78

>Scas_721.56
          Length = 199

 Score = 30.0 bits (66), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 16/56 (28%), Positives = 25/56 (44%), Gaps = 2/56 (3%)

Query: 96  QRRRYVCKICSRGFTTSGHLARHNRIHTGEKNHVCPFEGCGQRFSRHDNCVQHYRT 151
            R  + C  C   F  S  L RH + H     ++C    CG+ F+R D   +++ T
Sbjct: 111 SRTGFQCNKCELYFIRSSDLRRHEKTHLSILPNIC--SQCGKGFARKDALKRYFGT 164

>AFR588W [3780] [Homologous to ScYLR375W (STP3) - SH; ScYDL048C
           (STP4) - SH] complement(1496510..1497469) [960 bp, 319
           aa]
          Length = 319

 Score = 30.0 bits (66), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 13/31 (41%), Positives = 18/31 (58%)

Query: 96  QRRRYVCKICSRGFTTSGHLARHNRIHTGEK 126
           + R + C ICSRGF  S  L RH + H  ++
Sbjct: 150 EARPHKCDICSRGFARSNDLQRHKKRHWKDE 180

>Sklu_2206.2 YLR375W, Contig c2206 7136-8212
          Length = 358

 Score = 30.0 bits (66), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 12/31 (38%), Positives = 18/31 (58%)

Query: 96  QRRRYVCKICSRGFTTSGHLARHNRIHTGEK 126
           + R + C +CSRGF  S  L RH + H  ++
Sbjct: 184 EDRPHKCSVCSRGFARSNDLLRHKKRHWKDE 214

>Sklu_2126.5 YHL027W, Contig c2126 7763-9109
          Length = 448

 Score = 30.0 bits (66), Expect = 0.87,   Method: Compositional matrix adjust.
 Identities = 15/49 (30%), Positives = 22/49 (44%), Gaps = 2/49 (4%)

Query: 105 CSRGFTTSGHLARHNRIHTGEKNHVCPFEGCGQRFSRHDNCVQHYRTHL 153
           C+       H+  H R+H   K   C    CG++F R  +  +H R HL
Sbjct: 95  CNTKTVKRDHITSHLRVHVPLKPFGC--STCGKKFKRPQDLKKHLRVHL 141

>CAGL0K04257g complement(391287..392930) some similarities with
           sp|P32338 Saccharomyces cerevisiae YGR044c, hypothetical
           start
          Length = 547

 Score = 29.6 bits (65), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 14/45 (31%), Positives = 19/45 (42%)

Query: 95  EQRRRYVCKICSRGFTTSGHLARHNRIHTGEKNHVCPFEGCGQRF 139
           ++R  Y C  C   F      A H   +  E+ H CPF+ C  R 
Sbjct: 401 QKRGLYRCAHCPSTFNNIFEYASHLDEYEVERKHKCPFKNCAWRI 445

>Scas_604.4
          Length = 585

 Score = 29.3 bits (64), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 14/42 (33%), Positives = 22/42 (52%), Gaps = 2/42 (4%)

Query: 114 HLARHNRIHTGEKNHVCPFEGCGQRFSRHDNCVQHYRTHLKT 155
           H+  H R+H   K   C  + C ++F R  +  +H RTHL +
Sbjct: 233 HITSHLRVHVPLKPFAC--KKCTKKFKRPQDLKKHLRTHLDS 272

>CAGL0E03762g complement(351003..352757) weakly similar to sp|P33400
           Saccharomyces cerevisiae YHL027w RIM101 meiotic
           regulatory protein, hypothetical start
          Length = 584

 Score = 28.9 bits (63), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 14/49 (28%), Positives = 21/49 (42%), Gaps = 2/49 (4%)

Query: 105 CSRGFTTSGHLARHNRIHTGEKNHVCPFEGCGQRFSRHDNCVQHYRTHL 153
           C+       H+  H R+H   K   C    C +RF R  +  +H + HL
Sbjct: 196 CTSKTEKRDHMTSHLRVHVPLKPFAC--STCSKRFKRPQDLKKHLKIHL 242

>AGL205C [4107] [Homologous to ScYDR052C (DBF4) - SH]
           (314646..316493) [1848 bp, 615 aa]
          Length = 615

 Score = 28.5 bits (62), Expect = 2.9,   Method: Composition-based stats.
 Identities = 31/131 (23%), Positives = 52/131 (39%), Gaps = 12/131 (9%)

Query: 25  LPPLVYSGANQNIEAQLKKILDRTAFTTAALPPKPEI-RPAVTVCAHQXXXXXXXXXXXX 83
           L P   S  N+++++  + ++DR  FT   +PP P+  +P +T    Q            
Sbjct: 482 LAPAKASNVNKSLKSLNRLVVDRK-FTQQTIPPPPQAAKPTLTAACIQEKHSASPQGSLA 540

Query: 84  XXXXATANVPIEQRRRYVCKI----CSRGFTTSGHLARHNRIHTGEKNHVCPFEGCGQRF 139
                TA+ P+  +R    K+    C        HL +H R    EK+    F     +F
Sbjct: 541 PNHTVTAS-PVPAKRPLQGKLGGGYCENCRVKYDHLDQHIRT---EKHQ--SFAENDNKF 594

Query: 140 SRHDNCVQHYR 150
            R D+ +   R
Sbjct: 595 ERIDSLINTLR 605

>Scas_683.30
          Length = 478

 Score = 28.1 bits (61), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 16/63 (25%), Positives = 31/63 (49%), Gaps = 7/63 (11%)

Query: 97  RRRYVCKICSRGFTTSGHLARHNRIHTG--EKNHVCPFEGCGQRFSRHDNCVQHYRTHLK 154
           RR+  C  C   +    +L+ H   H    ++ H CP   C + F+R+++ ++H + H K
Sbjct: 284 RRKKQCPTCLNYY---ANLSTHKSTHLTPEDRPHKCPI--CERGFARNNDLIRHKKRHWK 338

Query: 155 TNY 157
             +
Sbjct: 339 DEF 341

 Score = 27.7 bits (60), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 11/31 (35%), Positives = 17/31 (54%)

Query: 96  QRRRYVCKICSRGFTTSGHLARHNRIHTGEK 126
           + R + C IC RGF  +  L RH + H  ++
Sbjct: 310 EDRPHKCPICERGFARNNDLIRHKKRHWKDE 340

>Sklu_2030.3 YGR044C, Contig c2030 2836-4116
          Length = 426

 Score = 28.1 bits (61), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 14/40 (35%), Positives = 20/40 (50%)

Query: 96  QRRRYVCKICSRGFTTSGHLARHNRIHTGEKNHVCPFEGC 135
           +R  Y C  CS  F T    A+H   +  E+ + CPF+ C
Sbjct: 269 KRGSYRCTHCSELFPTIFEYAKHLDENEIEREYKCPFKLC 308

>Kwal_34.16068
          Length = 999

 Score = 27.7 bits (60), Expect = 4.5,   Method: Composition-based stats.
 Identities = 12/43 (27%), Positives = 22/43 (51%), Gaps = 5/43 (11%)

Query: 120 RIHTGEKNHVCPFEGCGQRF-----SRHDNCVQHYRTHLKTNY 157
           +++  E   VC FE CG +F         N ++H+R   +++Y
Sbjct: 286 KVNGPEPFAVCKFEKCGHKFYLQGNPTSSNIIRHFRRQHRSDY 328

>Kwal_33.15612
          Length = 999

 Score = 27.7 bits (60), Expect = 4.5,   Method: Composition-based stats.
 Identities = 12/43 (27%), Positives = 22/43 (51%), Gaps = 5/43 (11%)

Query: 120 RIHTGEKNHVCPFEGCGQRF-----SRHDNCVQHYRTHLKTNY 157
           +++  E   VC FE CG +F         N ++H+R   +++Y
Sbjct: 286 KVNGPEPFAVCKFEKCGHKFYLQGNPTSSNIIRHFRRQHRSDY 328

>Scas_636.14d
          Length = 275

 Score = 27.3 bits (59), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 13/50 (26%), Positives = 24/50 (48%), Gaps = 2/50 (4%)

Query: 99  RYVCKICSRGFTTSGHLARHNRIHTGEKNHVCPFEGCGQRFSRHDNCVQH 148
            + C  C + + T     +H +    E+ H+C F  C + F R D+ ++H
Sbjct: 214 EFPCPHCQKTYRTEAQQKKHLKDVHVERKHMCLF--CSRWFKRKDHMIKH 261

>Scas_627.17d
          Length = 275

 Score = 27.3 bits (59), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 13/49 (26%), Positives = 24/49 (48%), Gaps = 2/49 (4%)

Query: 100 YVCKICSRGFTTSGHLARHNRIHTGEKNHVCPFEGCGQRFSRHDNCVQH 148
           + C  C + + T     +H +    E+ H+C F  C + F R D+ ++H
Sbjct: 215 FPCPHCQKTYLTEAQQKKHLKDVHVERKHMCLF--CSRWFKRKDHMIKH 261

>CAGL0K04697g 458366..459913 some similarities with tr|Q07351
           Saccharomyces cerevisiae YDL048c STP4 or tr|Q05937
           Saccharomyces cerevisiae YLR375w STP3, hypothetical
           start
          Length = 515

 Score = 27.3 bits (59), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 18/63 (28%), Positives = 24/63 (38%), Gaps = 10/63 (15%)

Query: 95  EQRRRYVCKICSRGFTTSGHLARHNRIHT----------GEKNHVCPFEGCGQRFSRHDN 144
            Q R + C IC  GF  +  L RH + H           G  N  C     GQR  + + 
Sbjct: 346 SQDRPHKCIICQSGFARNNDLIRHRKRHWKDDIQNIANLGNTNQQCQNTIQGQRALKKNQ 405

Query: 145 CVQ 147
            +Q
Sbjct: 406 LIQ 408

>YLR375W (YLR375W) [3755] chr12 (871696..872727) Protein with strong
           similarity to Stp1p, which is involved in tRNA splicing
           and branched-chain amino acid uptake [1032 bp, 343 aa]
          Length = 343

 Score = 26.9 bits (58), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 11/31 (35%), Positives = 17/31 (54%)

Query: 96  QRRRYVCKICSRGFTTSGHLARHNRIHTGEK 126
           + R + C IC RGF  +  L RH + H  ++
Sbjct: 165 EDRPHKCPICHRGFARNNDLLRHKKRHWKDE 195

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.322    0.134    0.429 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 4,702,122
Number of extensions: 156316
Number of successful extensions: 818
Number of sequences better than 10.0: 211
Number of HSP's gapped: 663
Number of HSP's successfully gapped: 299
Length of query: 157
Length of database: 16,596,109
Length adjustment: 93
Effective length of query: 64
Effective length of database: 13,376,635
Effective search space: 856104640
Effective search space used: 856104640
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)
S2: 57 (26.6 bits)