Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Sklu_2357.636436419010.0
Kwal_27.105503353588311e-110
YBR065C (ECM2)3643347573e-98
Scas_718.453763386671e-84
AGR032W3313036249e-79
CAGL0L07458g3643445233e-63
KLLA0F18502g3023232064e-18
YBR214W (SDS24)527111770.16
KLLA0A05907g347148672.4
Sklu_2299.447191672.6
Scas_686.1647285663.6
Kwal_23.6139131970655.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Sklu_2357.6
         (364 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Sklu_2357.6 YBR065C, Contig c2357 7338-8432 reverse complement        736   0.0  
Kwal_27.10550                                                         324   e-110
YBR065C (ECM2) [255] chr2 complement(368545..369639) Putative pr...   296   3e-98
Scas_718.45                                                           261   1e-84
AGR032W [4342] [Homologous to ScYBR065C (ECM2) - SH] complement(...   244   9e-79
CAGL0L07458g complement(820608..821702) similar to sp|P38241 Sac...   206   3e-63
KLLA0F18502g complement(1699447..1700355) some similarities with...    84   4e-18
YBR214W (SDS24) [395] chr2 (651372..652955) Nuclear protein with...    34   0.16 
KLLA0A05907g complement(548720..549763) weakly similar to sp|P46...    30   2.4  
Sklu_2299.4 YBR214W, Contig c2299 7411-8826                            30   2.6  
Scas_686.16                                                            30   3.6  
Kwal_23.6139                                                           30   5.2  

>Sklu_2357.6 YBR065C, Contig c2357 7338-8432 reverse complement
          Length = 364

 Score =  736 bits (1901), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 356/364 (97%), Positives = 356/364 (97%)

Query: 1   MSDQHPAICESCLSRDSKFIRMTKAPDGATCKICTLPFTLFYFKLPGHRHLTKTLICLNC 60
           MSDQHPAICESCLSRDSKFIRMTKAPDGATCKICTLPFTLFYFKLPGHRHLTKTLICLNC
Sbjct: 1   MSDQHPAICESCLSRDSKFIRMTKAPDGATCKICTLPFTLFYFKLPGHRHLTKTLICLNC 60

Query: 61  SKQRNICQCCLLDLSWHVPTNVRDQILSMLNDSAVVTEEASNEMVKRFIGLKDGDSFKMG 120
           SKQRNICQCCLLDLSWHVPTNVRDQILSMLNDSAVVTEEASNEMVKRFIGLKDGDSFKMG
Sbjct: 61  SKQRNICQCCLLDLSWHVPTNVRDQILSMLNDSAVVTEEASNEMVKRFIGLKDGDSFKMG 120

Query: 121 GASVTSDYDSNQQVMLKLQNILNASTSQGTSPATAGEPDPLNDVATLVTKDKHDKREKYA 180
           GASVTSDYDSNQQVMLKLQNILNASTSQGTSPATAGEPDPLNDVATLVTKDKHDKREKYA
Sbjct: 121 GASVTSDYDSNQQVMLKLQNILNASTSQGTSPATAGEPDPLNDVATLVTKDKHDKREKYA 180

Query: 181 NLDISHILKRLPLKGSIDKGDSTRSFFLYNIDPGIPEWSIVEKISSMVETTQWQDRETTS 240
           NLDISHILKRLPLKGSIDKGDSTRSFFLYNIDPGIPEWSIVEKISSMVETTQWQDRETTS
Sbjct: 181 NLDISHILKRLPLKGSIDKGDSTRSFFLYNIDPGIPEWSIVEKISSMVETTQWQDRETTS 240

Query: 241 VIINHTAKCGGIRFKSADLANRFITQLEKNGSKGVLAVRNCRIHVVKWSSMHSGAFGDKY 300
           VIINHTAKCGGIRFKSADLANRFITQLEKNGSKGVLAVRNCRIHVVKWSSMHSGAFGDKY
Sbjct: 241 VIINHTAKCGGIRFKSADLANRFITQLEKNGSKGVLAVRNCRIHVVKWSSMHSGAFGDKY 300

Query: 301 AEFVKLGLSLDKLVQKDVSPSTTKKENPVTTKSNKKDTRATGKVQKIGILXXXXXXXXVL 360
           AEFVKLGLSLDKLVQKDVSPSTTKKENPVTTKSNKKDTRATGKVQKIGIL        VL
Sbjct: 301 AEFVKLGLSLDKLVQKDVSPSTTKKENPVTTKSNKKDTRATGKVQKIGILRDKKKKRRVL 360

Query: 361 DIEL 364
           DIEL
Sbjct: 361 DIEL 364

>Kwal_27.10550
          Length = 335

 Score =  324 bits (831), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 170/358 (47%), Positives = 229/358 (63%), Gaps = 44/358 (12%)

Query: 6   PAICESCLSRDSKFIRMTKAPDGATCKICTLPFTLFYFKLPGHRHLTKTLICLNCSKQRN 65
           PAICE+CL   +   R+T+A +GA CKICTL FT+++FK   H  + +T+IC NCSKQRN
Sbjct: 3   PAICEACLGDQT---RLTRAVNGAECKICTLAFTVYHFKT--HHKVNRTVICHNCSKQRN 57

Query: 66  ICQCCLLDLSWHVPTNVRDQILSMLNDSAVVTEEASNEMVKRFIGLKDGDSFKMGGASVT 125
           ICQCCLLDL WH+P  +RD++LS++  S V TEEA N+M+KRFI LKDG ++K+GGA VT
Sbjct: 58  ICQCCLLDLQWHIPVELRDRVLSLIQGSEVATEEAQNDMMKRFIALKDGSTYKVGGAKVT 117

Query: 126 SDYDSNQQVMLKLQNILNASTSQGTSPA----TAGEPDPLNDVATLVTKDKHDKREKYAN 181
           SD  +   V+ ++++ L A   +  S A     A  P  + +V                 
Sbjct: 118 SDASATADVIERIRDTLQAVEDKDNSNANVKSAAIAPQSVTEV----------------- 160

Query: 182 LDISHILKRLPLKGSIDKGDSTRSFFLYNIDPGIPEWSIVEKISSMVETTQWQDRETTSV 241
            DISH+LK+LPLKGS+ +G    +FFLYNIDP +PEW++V+ IS +VET  WQ+  + SV
Sbjct: 161 -DISHLLKKLPLKGSLSEGT---AFFLYNIDPALPEWAVVDAISEVVETPSWQEPVSASV 216

Query: 242 IINHTAKCGGIRFKSADLANRFITQLEKNGS-----KGVLAVRNCRIHVVKWSSMHSGAF 296
            INHTA+CGGIRFK+A+LA +F   +E   +     KG L V+N R+HVV W   H  A 
Sbjct: 217 AINHTARCGGIRFKNAELAQKFRDSIETFKAESGLIKGKLLVQNSRVHVVSWPQFHRAAL 276

Query: 297 GDKYAEFVKLGLSLDKLVQKDVSPST-----TKKENPVTTKSN----KKDTRATGKVQ 345
           G K AE  KL LSLDKLVQKD++ S+     TKK+  V  KS+    KK +R    ++
Sbjct: 277 GTKNAECRKLALSLDKLVQKDLTASSKNTTLTKKQGRVAKKSSAIKEKKRSRRIADIE 334

>YBR065C (ECM2) [255] chr2 complement(368545..369639) Putative
           pre-mRNA splicing factor, also involved in cell wall
           structure or biosynthesis [1095 bp, 364 aa]
          Length = 364

 Score =  296 bits (757), Expect = 3e-98,   Method: Compositional matrix adjust.
 Identities = 155/334 (46%), Positives = 218/334 (65%), Gaps = 24/334 (7%)

Query: 1   MSDQHPAICESCLSRDSKFIRMTKAPDGATCKICTLPFTLFYFKLPGH-RHLTKTLICLN 59
           +++  P ICE CL  D   IRMTK P G+ CKICTLPFTL++FK      ++ KTLIC+ 
Sbjct: 5   INEPPPNICEQCLG-DEANIRMTKIPQGSECKICTLPFTLYHFKTSKRSNNIIKTLICVR 63

Query: 60  CSKQRNICQCCLLDLSWHVPTNVRDQILSMLNDSAVVTEEASNEMVKRFIGLKDGDSFKM 119
           C+ QRNICQCC+LD  WH+P  +RD ++S++N+  V+TEEA N+M+KRF+ LK+    K+
Sbjct: 64  CATQRNICQCCMLDSRWHIPIQLRDHLISLVNEENVMTEEAKNDMMKRFLSLKN---VKL 120

Query: 120 GGASVTSDYDSNQQVMLKLQNILNASTSQGTSPATAGEPDPLNDVATLVTKDKHDKRE-- 177
           GGA +TSD      ++ KL+NIL  +TS G  P+T     PL    T + K++    E  
Sbjct: 121 GGAQITSDPSEADNIVDKLKNILLRATSDG--PST-----PLIKNTTALYKNEKGANEVK 173

Query: 178 ---KYANLDISHILKRLPLKGSIDKGDSTRSFFLYNIDPGIPEWSIVEKISSMVETTQWQ 234
              KYA++DISHILK+LPL  S  K  ST+SFFLYNID  IPEW I + +S ++   +W+
Sbjct: 174 NLEKYASVDISHILKKLPLNESFLKNPSTKSFFLYNIDASIPEWKITDTVSQLLGIKKWK 233

Query: 235 DRETTSVIINHTAKCGGIRFKSADLANRFITQLE------KNGSKGVLAVRNCRIHVVKW 288
           D  + S+I+NH AKCGG+RF+S++L  RF++++       K   +GVL +   RI ++ W
Sbjct: 234 DGNSLSLIVNHKAKCGGLRFQSSELGERFVSKISETLVTPKGLKRGVLLIDRFRIFIIPW 293

Query: 289 SSMHSGA-FGDKYAEFVKLGLSLDKLVQKDVSPS 321
           SS  S A FG   AE +KL LSL+KL+Q ++  S
Sbjct: 294 SSGFSAASFGTNTAENIKLSLSLNKLIQLELGLS 327

>Scas_718.45
          Length = 376

 Score =  261 bits (667), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 143/338 (42%), Positives = 214/338 (63%), Gaps = 33/338 (9%)

Query: 4   QHPAICESCLSRDSKFIRMTKAPDGATCKICTLPFTLFYFKLPGHR-HLTKTLICLNCSK 62
           Q P+IC+ CL  DS  IR+TK P+GA CKICT+ FT ++FK      +LTKTLICL C+ 
Sbjct: 9   QPPSICDVCLG-DSPNIRLTKLPNGAQCKICTMTFTSYHFKQQERSSNLTKTLICLRCAT 67

Query: 63  QRNICQCCLLDLSWHVPTNVRDQILSMLN-DSAVVTEEASNEMVKRFIGLKDGDSFKMGG 121
           QRN+CQCC+LD++WH+P  +RD I+S++N D +++T+EA N+++KRF+ LKDG   K+GG
Sbjct: 68  QRNVCQCCMLDMTWHIPVQLRDSIVSLVNQDKSMITKEAKNDIMKRFLALKDG---KLGG 124

Query: 122 ASVTSDYDSNQQVMLKLQNILNASTSQ-----GTSPATAGEPDPLNDVATLVTKDKHDKR 176
           A VTSD     ++M KL++IL  + S+      T   ++G+           +       
Sbjct: 125 AQVTSDSKQTDELMQKLKDILLQNNSKENIHKKTEAISSGDS----------SNSTRLDN 174

Query: 177 EKYANLDISHILKRLPLKGS-IDKGDSTRSFFLYNIDPGIPEWSIVEKISSMVETTQWQD 235
            K   +DISHI+++LPL+ S +D   S +SFFLYNIDP IPEW + ++IS++V T  W+D
Sbjct: 175 SKLKGIDISHIIRKLPLRESFLDTTASVKSFFLYNIDPSIPEWKVSDQISNIVGTKDWKD 234

Query: 236 RETTSVIINHTAKCGGIRFKSADLANRFITQLEKNGS----------KGVLAVRNCRIHV 285
             + S+II H AKCGG+RFKS +L ++F+  +  +GS          +G+L + + +I  
Sbjct: 235 PTSLSLIIIHKAKCGGVRFKSEELGSKFVKNMLASGSFMKSNDGKVQRGILKIDHFQIFA 294

Query: 286 VKW-SSMHSGAFGDKYAEFVKLGLSLDKLVQKDVSPST 322
           + W S     +FG    E +KL LS++KL+Q +   ST
Sbjct: 295 IPWRSGFSGSSFGGNVNENIKLSLSMNKLIQLENGAST 332

>AGR032W [4342] [Homologous to ScYBR065C (ECM2) - SH]
           complement(770660..771655) [996 bp, 331 aa]
          Length = 331

 Score =  244 bits (624), Expect = 9e-79,   Method: Compositional matrix adjust.
 Identities = 119/303 (39%), Positives = 181/303 (59%), Gaps = 36/303 (11%)

Query: 1   MSDQHPAICESCLSRDSKFIRMTKAPDGATCKICTLPFTLFYFKLPGHRHLTKTLICLNC 60
           M ++ P+ICE CL+ D+  +RMT+A  GA CKICTLPFTL++FK PG   +TKTL+C  C
Sbjct: 1   MDEETPSICEQCLT-DAD-LRMTRAARGAECKICTLPFTLYHFKPPGAPRVTKTLVCRRC 58

Query: 61  SKQRNICQCCLLDLSWHVPTNVRDQILSMLNDSAVVTEEASNEMVKRFIGLKDGDSFKMG 120
           + QRN+CQCC+LDL+W +P  +RD+++S++  S   T EASNEMV+RF+ L+ G   ++G
Sbjct: 59  AAQRNVCQCCMLDLAWKLPVALRDELVSLVQGSDERTPEASNEMVRRFLALRGG---QLG 115

Query: 121 GASVTSDYDSNQQVMLKLQNILNASTSQGTSPATAGEPDPLNDVATLVTKDKHDKREKYA 180
           GA +T+D    +++M K++ +  A+                           H  RE   
Sbjct: 116 GARLTADSAPLRELMGKMRAVAAAAAP---------------------AARAHGGREDAG 154

Query: 181 NLDISHILKRLPLKGSIDKGDSTRSFFLYNIDPGIPEWSIVEKISSMVETTQWQDRETTS 240
            +  +     LP  G++    ++RSFF+Y +DP +PEW +V+ +S +V T  W+D  + S
Sbjct: 155 EVPETQ----LPFGGALAT-PASRSFFIYGVDPALPEWELVDAVSQLVRTPDWRDAGSVS 209

Query: 241 VIINHTAKCGGIRFKSADLANRFITQLE-----KNGSKGVLAVRNCRIHVVKWSSMHSGA 295
           V++   A+C GIRF+  +LA  F+ +LE         KGVL +R+ R+HVV W   H  A
Sbjct: 210 VVVRQDARCAGIRFRREELAQAFVARLETLPAAAGAPKGVLRIRHLRMHVVAWPEFHLAA 269

Query: 296 FGD 298
           FG+
Sbjct: 270 FGE 272

>CAGL0L07458g complement(820608..821702) similar to sp|P38241
           Saccharomyces cerevisiae YBR065c ECM2, start by
           similarity
          Length = 364

 Score =  206 bits (523), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 119/344 (34%), Positives = 194/344 (56%), Gaps = 46/344 (13%)

Query: 2   SDQHPAICESCL--SRDSKFIRMTKAPDGATCKICTLPFTLFYFKLPGHRH--LTKTLIC 57
           S++ P ICE CL  S  ++ IRM + P+GA CKICTLP+TL++FK   HR   + KTLIC
Sbjct: 8   SEEVPQICEKCLGTSNTNENIRMNEVPNGAACKICTLPYTLYHFK-KSHRSADIIKTLIC 66

Query: 58  LNCSKQRNICQCCLLDLSWHVPTNVRDQILSMLNDSAVVTEEASNEMVKRFIGLKDGDSF 117
             C+ QRN+CQCC+LD+  H+   +RD+++S+++    +TEEA N M+K+FI +K G   
Sbjct: 67  KKCAIQRNVCQCCMLDMKLHISIQLRDKLMSIVSGKETITEEAKNIMMKKFIAMKGGS-- 124

Query: 118 KMGGASVTSDYDSNQQVMLKLQNILNASTSQGTSPATAGEPDPLND----VATLVTKDKH 173
            +G A +T + DS + ++L L+  L              E  PLND    ++ L  K+  
Sbjct: 125 -LGSADLTRNVDSIEDILLNLREKL--------------EGKPLNDENEPISALQNKELG 169

Query: 174 DKREKYANLDISHILKRLPLKGS------IDKG-DSTRSFFLYNIDPGIPEWSIVEKISS 226
           D      ++DI     + PL+ +      I KG DS +SFF+YNID  +PEW I +KI+ 
Sbjct: 170 D-NPHLKSVDIQPYWDKFPLQETFPNAIQIPKGNDSFKSFFIYNIDSSVPEWKISDKITE 228

Query: 227 MVETTQWQDRETTSVIINHTAKCGGIRFKSADLANRFITQLEK----------NG-SKGV 275
           ++ +  W+ +E+  +IINH A CG  R  + +L+ +F+  +            NG  +G+
Sbjct: 229 LLGSDSWKTKESIPIIINHKAMCGAFRIGNNELSEKFLQTINNSDNMIRINRSNGLRRGI 288

Query: 276 LAVRNCRIHVVKWSSMHS-GAFGDKYAEFVKLGLSLDKLVQKDV 318
           L V + ++ ++ W    S  +FG    E  K+  +L +++ +++
Sbjct: 289 LKVDHFQLFIIPWKQGFSVESFGRTPNESKKIAFALREIIVEEM 332

>KLLA0F18502g complement(1699447..1700355) some similarities with
           sp|P38241 Saccharomyces cerevisiae YBR065c ECM2 involved
           in cell wall biogenesis and architecture singleton,
           hypothetical start
          Length = 302

 Score = 84.0 bits (206), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 87/323 (26%), Positives = 136/323 (42%), Gaps = 81/323 (25%)

Query: 8   ICESCLSRDSKFIRMTKAPDGATCKICTLPFTLFYFKLPGHRHLT-KTLICLNCSKQRNI 66
           ICE CL        + + P+G  CK CT PF  + + +    H T  T+ C  C+ +  I
Sbjct: 10  ICERCLPLGENTPTLIRYPNGRECKFCTFPFDSYSYTI---NHTTFHTICCPKCATKNLI 66

Query: 67  CQCCLLDLSWHVPTNVRDQILSMLNDSA--VVTEEASNEMVKRFIGLKDGDSFKMGGASV 124
           CQ CL D    +P ++R+ +  +LN++A  V+     N+M+KRFIGL             
Sbjct: 67  CQVCLNDFEHGIPMHLRNSMKQLLNENADSVI---PKNDMMKRFIGL------------- 110

Query: 125 TSDYDSNQQVMLKLQNILNASTSQGTSPATAGEPDPLNDVATLVTKDKHDKREKYANLDI 184
                S++QV                         PLN        DK  + E      +
Sbjct: 111 -----SSKQVA------------------------PLN-------IDKLKQAESIRKWRV 134

Query: 185 SHILKRLPLKGSIDKGDSTRSFFLYNIDPGIPEWSIVEKISSMVETTQWQDRETTSVIIN 244
               + LP   +++  D+  +FFLYNIDP + E  IV ++  +V T    +RE TS+ +N
Sbjct: 135 ----RELPFNSNVN--DTKDTFFLYNIDPNLTESQIVSQL--IVATNNNLERENTSLKLN 186

Query: 245 HTAKCGGIRFKS-ADL-ANRFITQLEK-----NGSKGVLAVRNCRIHVVKWSSMHSGAFG 297
              +   + FK   DL   + I+ L K        K  L ++  RIH+       +    
Sbjct: 187 SKLRIATLTFKQDPDLWTQKLISILPKFKVGPTVEKCYLLMKGNRIHI-------TSCLS 239

Query: 298 DKY-AEFVKLGLSLDKLVQKDVS 319
           D +    V      D+LVQK ++
Sbjct: 240 DDFDVNNVNSEPEWDRLVQKIIT 262

>YBR214W (SDS24) [395] chr2 (651372..652955) Nuclear protein with
           similarity to S. pombe sds23/moc1 protein [1584 bp, 527
           aa]
          Length = 527

 Score = 34.3 bits (77), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 27/111 (24%), Positives = 49/111 (44%), Gaps = 2/111 (1%)

Query: 67  CQCCLLDLSW-HVP-TNVRDQILSMLNDSAVVTEEASNEMVKRFIGLKDGDSFKMGGASV 124
           C  C+    W H+P + + +Q   +    ++  EEA N ++K  +     +SF       
Sbjct: 96  CLSCVHAQKWQHIPLSQLIEQNKLIFVPGSISVEEAFNTLIKYHLNSIPVESFPGDMNCF 155

Query: 125 TSDYDSNQQVMLKLQNILNASTSQGTSPATAGEPDPLNDVATLVTKDKHDK 175
           T DY+     +L + N +  S  Q T+    G+P P+ ++  L  K+   K
Sbjct: 156 TFDYNDLNSYLLLVLNKITVSNKQLTADCQNGKPVPVGEMVKLTPKNPFYK 206

>KLLA0A05907g complement(548720..549763) weakly similar to sp|P46958
           Saccharomyces cerevisiae YJL146w IDS2 IME2-dependent
           signaling protein singleton, hypothetical start
          Length = 347

 Score = 30.4 bits (67), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 37/148 (25%), Positives = 55/148 (37%), Gaps = 25/148 (16%)

Query: 7   AICESCLSRDSKFIRMTKAPDGATCKICTLPFTLFYFKLPGHRHLTKTLICLNCSKQRNI 66
           A+  S  + DSK I     P      +  LPF L + KLP      K L  L      + 
Sbjct: 142 ALNSSLRAHDSKLILCVVIPKDWNIPLPQLPF-LTFVKLPKVTFADKELTLLTLWNHLDY 200

Query: 67  CQCCLLDLSWHVPTNVRDQILS--------------MLNDSAVVTEE-------ASNEM- 104
             CC L     + TN+ + +L+              + ND+    E+        S E+ 
Sbjct: 201 EFCCFLSPFAILQTNIDEMLLNDEIFLEIDNETCVFLTNDTYQRKEDIVFLLFKPSVEIG 260

Query: 105 --VKRFIGLKDGDSFKMGGASVTSDYDS 130
             V  F+ +  GDS K+     T  YD+
Sbjct: 261 TAVDEFLKVYSGDSAKLAQLQETDPYDA 288

>Sklu_2299.4 YBR214W, Contig c2299 7411-8826
          Length = 471

 Score = 30.4 bits (67), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 22/91 (24%), Positives = 39/91 (42%)

Query: 92  DSAVVTEEASNEMVKRFIGLKDGDSFKMGGASVTSDYDSNQQVMLKLQNILNASTSQGTS 151
           D +V  EEA N +VK  +     ++F      +T DY+     +L + N +  +      
Sbjct: 100 DGSVSVEEAFNTLVKYNLTSLPVEAFPGDMNCLTFDYNDLNSYLLLVLNKIKVNNDAVAR 159

Query: 152 PATAGEPDPLNDVATLVTKDKHDKREKYANL 182
               G P P+ ++  L  K++  K  +  NL
Sbjct: 160 DCQMGRPVPVGEIVKLTPKNQFYKLSETENL 190

>Scas_686.16
          Length = 472

 Score = 30.0 bits (66), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 21/85 (24%), Positives = 38/85 (44%)

Query: 98  EEASNEMVKRFIGLKDGDSFKMGGASVTSDYDSNQQVMLKLQNILNASTSQGTSPATAGE 157
           EEA N ++K  +     +S       +T DY+     +L + N +N +  + T     G+
Sbjct: 102 EEAFNVLIKNHLNSIPVESVPGDMNCLTFDYNDLNSYLLLVLNKINVNNKKITQDCQNGK 161

Query: 158 PDPLNDVATLVTKDKHDKREKYANL 182
           P P+ ++  L  K+   K  +  NL
Sbjct: 162 PVPVGEIVKLTPKNPFYKLPETENL 186

>Kwal_23.6139
          Length = 1319

 Score = 29.6 bits (65), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 26/70 (37%), Positives = 35/70 (50%), Gaps = 15/70 (21%)

Query: 117  FKMGGASVTSDYDSNQQVMLKLQNILNASTSQGTSPATAGEPD---PLNDVAT--LVTKD 171
             KM   SV S  D+       LQ   N +T+ G +P T+ EPD   PL + A+  +V KD
Sbjct: 1066 MKMQNPSVASFEDTT------LQPESNDTTASGDTPITSPEPDKGLPLENQASEDIVPKD 1119

Query: 172  KHDKREKYAN 181
                 E+YAN
Sbjct: 1120 S----ERYAN 1125

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.317    0.132    0.390 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 11,710,689
Number of extensions: 497966
Number of successful extensions: 1720
Number of sequences better than 10.0: 20
Number of HSP's gapped: 1720
Number of HSP's successfully gapped: 21
Length of query: 364
Length of database: 16,596,109
Length adjustment: 103
Effective length of query: 261
Effective length of database: 13,030,455
Effective search space: 3400948755
Effective search space used: 3400948755
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 62 (28.5 bits)