Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Sklu_2357.420420410861e-153
Kwal_27.105452022027811e-107
YDR041W (RSM10)2032016645e-89
AGR035C2071736403e-85
CAGL0K12056g2351846345e-84
KLLA0F18436g2072026316e-84
Scas_569.12411946042e-79
CAGL0I08151g38230651.8
Scas_595.9114861642.7
Sklu_2438.12312605910.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Sklu_2357.4
         (204 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Sklu_2357.4 YDR041W, Contig c2357 5034-5648                           422   e-153
Kwal_27.10545                                                         305   e-107
YDR041W (RSM10) [894] chr4 (539798..540409) Component of the mit...   260   5e-89
AGR035C [4345] [Homologous to ScYDR041W (RSM10) - SH] (773294..7...   251   3e-85
CAGL0K12056g 1166627..1167334 similar to tr|Q03201 Saccharomyces...   248   5e-84
KLLA0F18436g 1697109..1697732 similar to sgd|S0002448 Saccharomy...   247   6e-84
Scas_569.1                                                            237   2e-79
CAGL0I08151g 793647..794795 highly similar to KLLA0D01243g Kluyv...    30   1.8  
Scas_595.9                                                             29   2.7  
Sklu_2438.12 YDL124W, Contig c2438 25491-26429 reverse complement      27   10.0 

>Sklu_2357.4 YDR041W, Contig c2357 5034-5648
          Length = 204

 Score =  422 bits (1086), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 204/204 (100%), Positives = 204/204 (100%)

Query: 1   MLLTMSQMFKRVTGTPLLRQFTRFQSTVAPPNAFPINVTAVYHAPLKLPITHGDLVADLQ 60
           MLLTMSQMFKRVTGTPLLRQFTRFQSTVAPPNAFPINVTAVYHAPLKLPITHGDLVADLQ
Sbjct: 1   MLLTMSQMFKRVTGTPLLRQFTRFQSTVAPPNAFPINVTAVYHAPLKLPITHGDLVADLQ 60

Query: 61  LRSYDNENLDFFSDFILRAGFYLGMPLTGPKPLPTRRERWTVIRSPFAQAKSKENFERHT 120
           LRSYDNENLDFFSDFILRAGFYLGMPLTGPKPLPTRRERWTVIRSPFAQAKSKENFERHT
Sbjct: 61  LRSYDNENLDFFSDFILRAGFYLGMPLTGPKPLPTRRERWTVIRSPFAQAKSKENFERHT 120

Query: 121 HKRLIRVWDTNPEVIELWLSYLTKHSIPGVGIKCNVYQREGVRLSDSIDTSVLPELEGNT 180
           HKRLIRVWDTNPEVIELWLSYLTKHSIPGVGIKCNVYQREGVRLSDSIDTSVLPELEGNT
Sbjct: 121 HKRLIRVWDTNPEVIELWLSYLTKHSIPGVGIKCNVYQREGVRLSDSIDTSVLPELEGNT 180

Query: 181 KTLDEAVGERVVELLNDPEFKKHI 204
           KTLDEAVGERVVELLNDPEFKKHI
Sbjct: 181 KTLDEAVGERVVELLNDPEFKKHI 204

>Kwal_27.10545
          Length = 202

 Score =  305 bits (781), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 146/202 (72%), Positives = 169/202 (83%), Gaps = 7/202 (3%)

Query: 8   MFKRVTGTPLLRQFTRFQSTVAPPNA------FPINVTAVYHAPLKLPITHGDLVADLQL 61
           MF+     PL R F RFQST     A       PINV AVY+APL++PITHGDL+ADLQL
Sbjct: 1   MFRPSLLAPL-RHFARFQSTSVASEAPNVAKKLPINVEAVYYAPLRIPITHGDLIADLQL 59

Query: 62  RSYDNENLDFFSDFILRAGFYLGMPLTGPKPLPTRRERWTVIRSPFAQAKSKENFERHTH 121
           RSYD+ENLDFF+DFILRAGFYLGMPLTGPKPLPTRRERWTVIRSPFAQAKSKENFERHTH
Sbjct: 60  RSYDHENLDFFADFILRAGFYLGMPLTGPKPLPTRRERWTVIRSPFAQAKSKENFERHTH 119

Query: 122 KRLIRVWDTNPEVIELWLSYLTKHSIPGVGIKCNVYQREGVRLSDSIDTSVLPELEGNTK 181
           KRLIRVWDTNPEV+ELWLSY++KHSIPGVGIKCN++Q+EG++LS +++ + L +  G + 
Sbjct: 120 KRLIRVWDTNPEVVELWLSYISKHSIPGVGIKCNLFQKEGLQLSQNLEQNSLLQSPGKSN 179

Query: 182 TLDEAVGERVVELLNDPEFKKH 203
           +LDEAVGERV+ELLN   FKK 
Sbjct: 180 SLDEAVGERVLELLNSENFKKQ 201

>YDR041W (RSM10) [894] chr4 (539798..540409) Component of the
           mitochondrial ribosomal small subunit [612 bp, 203 aa]
          Length = 203

 Score =  260 bits (664), Expect = 5e-89,   Method: Compositional matrix adjust.
 Identities = 124/201 (61%), Positives = 152/201 (75%), Gaps = 14/201 (6%)

Query: 14  GTPLLRQFTRFQSTVAPPNAFPINVTAVYHAPLKLPITHGDLVADLQLRSYDNENLDFFS 73
            T  LR F R QST      +P+NV AVY+APLKLPI +GDLVAD+QLRSYDNENLDF+S
Sbjct: 4   NTIALRSFIRTQST----RPYPVNVEAVYYAPLKLPIKYGDLVADIQLRSYDNENLDFYS 59

Query: 74  DFILRAGFYLGMPLTGPKPLPTRRERWTVIRSPFAQAKSKENFERHTHKRLIRVWDTNPE 133
           DFILR G+YLG+PLTGPKPLPTRRERWTVI+SPF  AKSKENFERHTHKRLIR WDTNPE
Sbjct: 60  DFILRTGYYLGIPLTGPKPLPTRRERWTVIKSPFVHAKSKENFERHTHKRLIRAWDTNPE 119

Query: 134 VIELWLSYLTKHSIPGVGIKCNVYQREGVRLSDSIDTSVLPE----------LEGNTKTL 183
           V+++ ++Y+TKHS+ GVG+KCN +QR  + L    D + L +          L  + K  
Sbjct: 120 VLQMLIAYITKHSMAGVGMKCNFFQRSEISLDLGSDANGLEKSLSNIDELYSLRNDDKAQ 179

Query: 184 DEAVGERVVELLNDPEFKKHI 204
             AVG++V+ELL+ P+FKKH+
Sbjct: 180 TSAVGQKVLELLDSPDFKKHL 200

>AGR035C [4345] [Homologous to ScYDR041W (RSM10) - SH]
           (773294..773917) [624 bp, 207 aa]
          Length = 207

 Score =  251 bits (640), Expect = 3e-85,   Method: Compositional matrix adjust.
 Identities = 111/173 (64%), Positives = 144/173 (83%), Gaps = 2/173 (1%)

Query: 32  NAFPINVTAVYHAPLKLPITHGDLVADLQLRSYDNENLDFFSDFILRAGFYLGMPLTGPK 91
           +A P +V A+Y  PLKLP+ H DLVADLQLR++DN++LDFF++F LR G+YLG+P+TGPK
Sbjct: 37  SALPKSVHALYFQPLKLPVKHHDLVADLQLRAFDNQSLDFFANFALRVGYYLGIPMTGPK 96

Query: 92  PLPTRRERWTVIRSPFAQAKSKENFERHTHKRLIRVWDTNPEVIELWLSYLTKHSIPGVG 151
           PLPTRRERWTVIR+PFA AKSKENFERHTHKRL+R+WD NPEV+E++LSY+TKHS+ GVG
Sbjct: 97  PLPTRRERWTVIRAPFAHAKSKENFERHTHKRLLRLWDANPEVVEMFLSYITKHSMAGVG 156

Query: 152 IKCNVYQREGVRLSDSIDTSVLPELEGNTKTLDEAVGERVVELLNDPEFKKHI 204
           +KCN++QRE V+L+  +  + +P   G  +T DE VG +V EL+  PEFKKH+
Sbjct: 157 MKCNMFQRESVQLAQEL--ADVPLAPGAPQTADEVVGAKVAELMQSPEFKKHL 207

>CAGL0K12056g 1166627..1167334 similar to tr|Q03201 Saccharomyces
           cerevisiae YDR041w RSM10, hypothetical start
          Length = 235

 Score =  248 bits (634), Expect = 5e-84,   Method: Compositional matrix adjust.
 Identities = 118/184 (64%), Positives = 145/184 (78%), Gaps = 15/184 (8%)

Query: 31  PNAFPINVTAVYHAPLKLPITHGDLVADLQLRSYDNENLDFFSDFILRAGFYLGMPLTGP 90
           P   P+NV A+Y+APLK P+THG LVADLQLR+YDNENLDFF DFILRAG+YLG+P+TGP
Sbjct: 54  PPQLPVNVEALYYAPLKNPVTHGHLVADLQLRAYDNENLDFFCDFILRAGYYLGLPMTGP 113

Query: 91  KPLPTRRERWTVIRSPFAQAKSKENFERHTHKRLIRVWDTNPEVIELWLSYLTKHSIPGV 150
           KPLPTRRERWTVIRSPF  AKSKENFERHTHKRLIRVWD+NPEV+++ + Y+TK+SI GV
Sbjct: 114 KPLPTRRERWTVIRSPFVHAKSKENFERHTHKRLIRVWDSNPEVVQMLVDYITKNSIAGV 173

Query: 151 GIKCNVYQREGV-----RLSDSIDT-----SVLPELEGNTKTLDEAVGERVVELLNDPEF 200
           G+KC  YQR  V     ++SD+I+      ++ P L+ N     E +G +VVELLN P F
Sbjct: 174 GLKCTTYQRTTVDAKSGKISDAIEEINSTHNINPSLKEN-----EEIGAKVVELLNTPTF 228

Query: 201 KKHI 204
           KK++
Sbjct: 229 KKYL 232

>KLLA0F18436g 1697109..1697732 similar to sgd|S0002448 Saccharomyces
           cerevisiae YDR041w RSM10 component of the mitochondrial
           ribosomal small subunit, hypothetical start
          Length = 207

 Score =  247 bits (631), Expect = 6e-84,   Method: Compositional matrix adjust.
 Identities = 122/202 (60%), Positives = 148/202 (73%), Gaps = 18/202 (8%)

Query: 18  LRQFTRFQSTVA-PPNAFPIN---------VTAVYHAPLKLPITHGDLVADLQLRSYDNE 67
           +R F R+QST +  P   P N         V AVYHAPLK+  TH DL+AD+QLRSYDNE
Sbjct: 8   VRSFVRYQSTTSLNPKILPFNAKETPIPKCVEAVYHAPLKIEPTHRDLIADIQLRSYDNE 67

Query: 68  NLDFFSDFILRAGFYLGMPLTGPKPLPTRRERWTVIRSPFAQAKSKENFERHTHKRLIRV 127
           NLDFFS F+LRAG+YLG+P+ GPKPLPT+R+RWTVIR+PF  AKSKENFERHTH RLIR+
Sbjct: 68  NLDFFSSFVLRAGYYLGIPMKGPKPLPTKRKRWTVIRAPFVMAKSKENFERHTHARLIRL 127

Query: 128 WDTNPEVIELWLSYLTKHSIPGVGIKCNVYQREGVRLSDSIDTSVLPELE-----GNTKT 182
           +D N E++E  LSY++KH I GVGIKCN+YQRE + L    D    PELE        + 
Sbjct: 128 YDCNTELVETLLSYISKHGISGVGIKCNLYQREPIDLDSKKDG---PELENIDISSQLQG 184

Query: 183 LDEAVGERVVELLNDPEFKKHI 204
           LD+ VG +VVELLN+PEFKKH+
Sbjct: 185 LDDVVGAKVVELLNNPEFKKHL 206

>Scas_569.1
          Length = 241

 Score =  237 bits (604), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 114/194 (58%), Positives = 144/194 (74%), Gaps = 14/194 (7%)

Query: 23  RFQSTVAPPNAFPINVTAVYHAPLKLPITHGDLVADLQLRSYDNENLDFFSDFILRAGFY 82
           R Q   AP    PIN+ AVYHAPL+ PI +GDLVA++QLRSYDNENLDF+SDF LR GFY
Sbjct: 50  RNQPVDAP--IVPINIKAVYHAPLRNPIKYGDLVAEIQLRSYDNENLDFYSDFALRVGFY 107

Query: 83  LGMPLTGPKPLPTRRERWTVIRSPFAQAKSKENFERHTHKRLIRVWDTNPEVIELWLSYL 142
           LG+PLTGPKPLPTRRERWTVI+SPF  AKSKENFERHTHKR+I+VWDTN E+IE+W+SY+
Sbjct: 108 LGIPLTGPKPLPTRRERWTVIKSPFVHAKSKENFERHTHKRIIKVWDTNSELIEMWISYI 167

Query: 143 TKHSIPGVGIKCNVYQREGVRLSDS------------IDTSVLPELEGNTKTLDEAVGER 190
           TKH++ GVG+KC V+QR  +   +             +  S++ + +    T ++ V E+
Sbjct: 168 TKHAMAGVGMKCTVFQRSPIASKEDATNGVSSSDSSSVLKSIVNQKDDVKLTDNDLVNEK 227

Query: 191 VVELLNDPEFKKHI 204
           +VELL   EFKK+I
Sbjct: 228 IVELLGREEFKKYI 241

>CAGL0I08151g 793647..794795 highly similar to KLLA0D01243g
           Kluyveromyces lactis and DEHA0E07447g Debaryomyces
           hansenii and YALI0E33297g Yarrowia lipolytica and
           CA2891|CaIFS4 Candida albicans, hypothetical start
          Length = 382

 Score = 29.6 bits (65), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 15/30 (50%), Positives = 18/30 (60%), Gaps = 4/30 (13%)

Query: 10  KRVTGTPLLRQFTRF----QSTVAPPNAFP 35
           +R  GT  +R+FT F      TVAPPN FP
Sbjct: 103 RRSVGTYQMRRFTPFLMLDDFTVAPPNGFP 132

>Scas_595.9
          Length = 1148

 Score = 29.3 bits (64), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 17/61 (27%), Positives = 34/61 (55%), Gaps = 2/61 (3%)

Query: 125 IRVWDTNPEVIELWLSYLTKHSIPGVGIKCNVYQREGVRLSDSIDTSVLPELEGNTKTLD 184
           + +W++N +V+   L YL K S+P +    ++ +    +    ID+S+ P+++ N   LD
Sbjct: 595 LTIWESNIQVLNTLLPYLKKQSVPRIDTVASLSKPPVQQQQQQIDSSI-PDID-NLSDLD 652

Query: 185 E 185
           E
Sbjct: 653 E 653

>Sklu_2438.12 YDL124W, Contig c2438 25491-26429 reverse complement
          Length = 312

 Score = 27.3 bits (59), Expect = 10.0,   Method: Compositional matrix adjust.
 Identities = 12/60 (20%), Positives = 29/60 (48%), Gaps = 4/60 (6%)

Query: 95  TRRERWTVIRSPFAQAKSK----ENFERHTHKRLIRVWDTNPEVIELWLSYLTKHSIPGV 150
           T  + W  +   +   K+K     NF +   +R++++ +  P+V ++  S   ++  PG+
Sbjct: 134 TLEQAWKYLEELYKSGKAKNIGVSNFAKEDLERILKIAEIKPQVNQIEYSAFLQNQTPGI 193

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.321    0.138    0.417 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 7,075,249
Number of extensions: 306350
Number of successful extensions: 710
Number of sequences better than 10.0: 12
Number of HSP's gapped: 705
Number of HSP's successfully gapped: 12
Length of query: 204
Length of database: 16,596,109
Length adjustment: 97
Effective length of query: 107
Effective length of database: 13,238,163
Effective search space: 1416483441
Effective search space used: 1416483441
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 59 (27.3 bits)