Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Sklu_2357.331531516840.0
Kwal_27.1054330330913310.0
YBR061C (TRM7)31031112950.0
KLLA0F18414g30130812681e-177
Scas_718.4630931112291e-171
CAGL0H10252g30931112171e-169
AGR036W30631411291e-156
Scas_642.128392154251e-46
Kwal_33.130548302504232e-46
YCL054W (SPB1)8412154223e-46
AFR734C8452164214e-46
CAGL0B00484g8372154197e-46
Sklu_2421.108492154135e-45
KLLA0C00737g8332154092e-44
KLLA0B01980g2892522325e-22
Sklu_2160.23152762063e-18
CAGL0H08954g2812441753e-14
AFL117C3032671753e-14
Scas_720.46321971552e-11
Kwal_56.241583071391507e-11
YGL136C (MRM2)320941453e-10
Kwal_56.2317143864681.4
Sklu_2185.447787662.4
Kwal_26.6752522103663.1
CAGL0L06754g43869645.2
KLLA0C11231g43864635.7
CAGL0C01265g1501116636.8
Sklu_2336.863858637.3
Scas_633.343769627.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Sklu_2357.3
         (315 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Sklu_2357.3 YBR061C, Contig c2357 3590-4537 reverse complement        653   0.0  
Kwal_27.10543                                                         517   0.0  
YBR061C (TRM7) [252] chr2 complement(364747..365679) Methyltrans...   503   0.0  
KLLA0F18414g complement(1695869..1696774) similar to sp|P38238 S...   493   e-177
Scas_718.46                                                           478   e-171
CAGL0H10252g complement(1002563..1003492) highly similar to sp|P...   473   e-169
AGR036W [4346] [Homologous to ScYBR061C - SH] complement(774279....   439   e-156
Scas_642.12                                                           168   1e-46
Kwal_33.13054                                                         167   2e-46
YCL054W (SPB1) [493] chr3 (31449..33974) Putative S-adenosyl-met...   167   3e-46
AFR734C [3927] [Homologous to ScYCL054W (SPB1) - SH] (1785487..1...   166   4e-46
CAGL0B00484g 35991..38504 highly similar to sp|P25582 Saccharomy...   166   7e-46
Sklu_2421.10 YCL054W, Contig c2421 13526-16075 reverse complement     163   5e-45
KLLA0C00737g 53188..55689 similar to sp|P25582 Saccharomyces cer...   162   2e-44
KLLA0B01980g complement(173710..174579) similar to sp|P53123 Sac...    94   5e-22
Sklu_2160.2 YGL136C, Contig c2160 1404-2351                            84   3e-18
CAGL0H08954g complement(875104..875949) similar to sp|P53123 Sac...    72   3e-14
AFL117C [3078] [Homologous to ScYGL136C (MRM2) - SH] (218993..21...    72   3e-14
Scas_720.46                                                            64   2e-11
Kwal_56.24158                                                          62   7e-11
YGL136C (MRM2) [1851] chr7 complement(252900..253862) Methyltran...    60   3e-10
Kwal_56.23171                                                          31   1.4  
Sklu_2185.4 YNL022C, Contig c2185 6305-7738 reverse complement         30   2.4  
Kwal_26.6752                                                           30   3.1  
CAGL0L06754g 759181..760497 highly similar to sp|P12385 Saccharo...    29   5.2  
KLLA0C11231g 965524..966840 highly similar to sp|P12385 Saccharo...    29   5.7  
CAGL0C01265g complement(129884..134389) weakly similar to sp|P40...    29   6.8  
Sklu_2336.8 YLR234W, Contig c2336 10814-12730 reverse complement       29   7.3  
Scas_633.3                                                             28   7.4  

>Sklu_2357.3 YBR061C, Contig c2357 3590-4537 reverse complement
          Length = 315

 Score =  653 bits (1684), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 315/315 (100%), Positives = 315/315 (100%)

Query: 1   MGKSSKDKRDLYYRKAKEQGYRARSAFKLLQLNDHFHFLDNVTRVVDLCAAPGSWSQVLS 60
           MGKSSKDKRDLYYRKAKEQGYRARSAFKLLQLNDHFHFLDNVTRVVDLCAAPGSWSQVLS
Sbjct: 1   MGKSSKDKRDLYYRKAKEQGYRARSAFKLLQLNDHFHFLDNVTRVVDLCAAPGSWSQVLS 60

Query: 61  RKLFDNELENENKQSKKIVAVDLQPMSPIDHVTTLQADITHPGTLAKILELFGGDKADFV 120
           RKLFDNELENENKQSKKIVAVDLQPMSPIDHVTTLQADITHPGTLAKILELFGGDKADFV
Sbjct: 61  RKLFDNELENENKQSKKIVAVDLQPMSPIDHVTTLQADITHPGTLAKILELFGGDKADFV 120

Query: 121 CSDGAPDVTGLHDLDEYVQQQLILSALQLTTCLLKEGGCFVAKIFRGRDVDMLYSQLGYL 180
           CSDGAPDVTGLHDLDEYVQQQLILSALQLTTCLLKEGGCFVAKIFRGRDVDMLYSQLGYL
Sbjct: 121 CSDGAPDVTGLHDLDEYVQQQLILSALQLTTCLLKEGGCFVAKIFRGRDVDMLYSQLGYL 180

Query: 181 FERVVCAKPRSSRGSSLESFIVCLGYKPPHNWTPHLDVNQSIEDFFRGCDLGRLTLQDNL 240
           FERVVCAKPRSSRGSSLESFIVCLGYKPPHNWTPHLDVNQSIEDFFRGCDLGRLTLQDNL
Sbjct: 181 FERVVCAKPRSSRGSSLESFIVCLGYKPPHNWTPHLDVNQSIEDFFRGCDLGRLTLQDNL 240

Query: 241 VEFYDEPRNIAEFVSCGGLDSFDSDATYHNVEGSDVTSKSALDPVQAPTNPPYKKALELK 300
           VEFYDEPRNIAEFVSCGGLDSFDSDATYHNVEGSDVTSKSALDPVQAPTNPPYKKALELK
Sbjct: 241 VEFYDEPRNIAEFVSCGGLDSFDSDATYHNVEGSDVTSKSALDPVQAPTNPPYKKALELK 300

Query: 301 RSGKLARAAAIPHDK 315
           RSGKLARAAAIPHDK
Sbjct: 301 RSGKLARAAAIPHDK 315

>Kwal_27.10543
          Length = 303

 Score =  517 bits (1331), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 247/309 (79%), Positives = 279/309 (90%), Gaps = 6/309 (1%)

Query: 1   MGKSSKDKRDLYYRKAKEQGYRARSAFKLLQLNDHFHFLDNVTRVVDLCAAPGSWSQVLS 60
           MGKSSKDKRDLYYRKAKE+GYRARSAFKLLQL++ FHFLDNVTRVVDLCAAPGSWSQVLS
Sbjct: 1   MGKSSKDKRDLYYRKAKEEGYRARSAFKLLQLDEQFHFLDNVTRVVDLCAAPGSWSQVLS 60

Query: 61  RKLFDNELENENKQSKKIVAVDLQPMSPIDHVTTLQADITHPGTLAKILELFGGDKADFV 120
           R+LF  E + ENK SK+IV+VDLQPM PI++VTT+QADITHP TL KI++LF G+KADFV
Sbjct: 61  RRLF--EKDTENKGSKRIVSVDLQPMFPIENVTTIQADITHPKTLNKIMDLFDGEKADFV 118

Query: 121 CSDGAPDVTGLHDLDEYVQQQLILSALQLTTCLLKEGGCFVAKIFRGRDVDMLYSQLGYL 180
           CSDGAPDVTGLHDLDEYVQQQLILSALQLTTCLL+EGG FVAKIFRGRD+DMLYSQL +L
Sbjct: 119 CSDGAPDVTGLHDLDEYVQQQLILSALQLTTCLLREGGVFVAKIFRGRDIDMLYSQLSFL 178

Query: 181 FERVVCAKPRSSRGSSLESFIVCLGYKPPHNWTPHLDVNQSIEDFFRGCDLGRLTLQDNL 240
           FERVVCAKPRSSRG+SLESFIVCLGYKPP NWTPHLDVN S+EDFF+GCD+GRL+L D L
Sbjct: 179 FERVVCAKPRSSRGTSLESFIVCLGYKPPKNWTPHLDVNMSVEDFFQGCDIGRLSLDDKL 238

Query: 241 VEFYDEPRNIAEFVSCGGLDSFDSDATYHNVEGSDVTSKSALDPVQAPTNPPYKKALELK 300
            +++ +PR++AEF+SCGGLDSFDSDATYH+V    VT    L+PVQ PTNPPYK+ALELK
Sbjct: 239 PDYHVQPRSVAEFISCGGLDSFDSDATYHDVPVDRVT----LNPVQPPTNPPYKRALELK 294

Query: 301 RSGKLARAA 309
           R GKL +A 
Sbjct: 295 RKGKLTKAV 303

>YBR061C (TRM7) [252] chr2 complement(364747..365679)
           Methyltransferase that methylates 2-prime-O-riboses in
           tRNA anticodon loop, required for optimal protein
           synthesis activity, member of the 2-prime-O-RNA
           methyltransferase family which includes Spb1p, Mrm2p,
           and E. coli FtsJ protein [933 bp, 310 aa]
          Length = 310

 Score =  503 bits (1295), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 240/311 (77%), Positives = 274/311 (88%), Gaps = 3/311 (0%)

Query: 1   MGKSSKDKRDLYYRKAKEQGYRARSAFKLLQLNDHFHFLD--NVTRVVDLCAAPGSWSQV 58
           MGKSSKDKRDLYYRKAKEQGYRARSAFKLLQLND FHFLD  N+ RVVDLCAAPGSWSQV
Sbjct: 1   MGKSSKDKRDLYYRKAKEQGYRARSAFKLLQLNDQFHFLDDPNLKRVVDLCAAPGSWSQV 60

Query: 59  LSRKLFDNELENENKQSKKIVAVDLQPMSPIDHVTTLQADITHPGTLAKILELFGGDKAD 118
           LSRKLFD E  + +K+ +KIV+VDLQPMSPI HVTTLQADITHP TLA+IL+LFG +KAD
Sbjct: 61  LSRKLFD-ESPSSDKEDRKIVSVDLQPMSPIPHVTTLQADITHPKTLARILKLFGNEKAD 119

Query: 119 FVCSDGAPDVTGLHDLDEYVQQQLILSALQLTTCLLKEGGCFVAKIFRGRDVDMLYSQLG 178
           FVCSDGAPDVTGLHDLDEYVQQQLI+SALQLT C+LK+GG FVAKIFRGRD+DMLYSQLG
Sbjct: 120 FVCSDGAPDVTGLHDLDEYVQQQLIMSALQLTACILKKGGTFVAKIFRGRDIDMLYSQLG 179

Query: 179 YLFERVVCAKPRSSRGSSLESFIVCLGYKPPHNWTPHLDVNQSIEDFFRGCDLGRLTLQD 238
           YLF+++VCAKPRSSRG+SLE+FIVCLGY PP NWTP LDVN S+++FF+GC L +L + D
Sbjct: 180 YLFDKIVCAKPRSSRGTSLEAFIVCLGYNPPSNWTPKLDVNTSVDEFFQGCFLNKLCISD 239

Query: 239 NLVEFYDEPRNIAEFVSCGGLDSFDSDATYHNVEGSDVTSKSALDPVQAPTNPPYKKALE 298
            L  + +E RNIAEF++CG L SFDSDATYH++  S   + S+LDPVQ+PTNPPYKKALE
Sbjct: 240 KLSHWNEEERNIAEFMACGSLQSFDSDATYHDLPSSVAGTSSSLDPVQSPTNPPYKKALE 299

Query: 299 LKRSGKLARAA 309
           LKRSGKL R+ 
Sbjct: 300 LKRSGKLTRSV 310

>KLLA0F18414g complement(1695869..1696774) similar to sp|P38238
           Saccharomyces cerevisiae YBR061c, start by similarity
          Length = 301

 Score =  493 bits (1268), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 238/308 (77%), Positives = 266/308 (86%), Gaps = 8/308 (2%)

Query: 1   MGKSSKDKRDLYYRKAKEQGYRARSAFKLLQLNDHFHFLDNVTRVVDLCAAPGSWSQVLS 60
           MGKSSKDKRDLYYRKAKEQGYRARSAFKLLQL+D FHFL    RVVDLCAAPGSWSQVLS
Sbjct: 1   MGKSSKDKRDLYYRKAKEQGYRARSAFKLLQLDDDFHFLQQAVRVVDLCAAPGSWSQVLS 60

Query: 61  RKLFDNELENENKQSKKIVAVDLQPMSPIDHVTTLQADITHPGTLAKILELFGGDKADFV 120
           R+LF    +N ++   KIVAVDLQPMSPID+V TLQADITHP TL  I ELF G KADF+
Sbjct: 61  RRLFPQSSDNSDR---KIVAVDLQPMSPIDNVITLQADITHPKTLQTITELFEGKKADFI 117

Query: 121 CSDGAPDVTGLHDLDEYVQQQLILSALQLTTCLLKEGGCFVAKIFRGRDVDMLYSQLGYL 180
           CSDGAPDVTGLHDLDEYVQQQLILSALQL+TCLL++GG FVAKIFRGRD+DMLYSQLGYL
Sbjct: 118 CSDGAPDVTGLHDLDEYVQQQLILSALQLSTCLLRKGGNFVAKIFRGRDIDMLYSQLGYL 177

Query: 181 FERVVCAKPRSSRGSSLESFIVCLGYKPPHNWTPHLDVNQSIEDFFRGCDLGRLTLQDNL 240
           FE+V+CAKPRSSRG+SLESFIVCLGY PP NW P LDVN S+EDFF+GCD+G+L L+D  
Sbjct: 178 FEKVICAKPRSSRGTSLESFIVCLGYNPPANWEPKLDVNSSVEDFFQGCDIGKLRLEDKC 237

Query: 241 VEFYDEPRNIAEFVSCGGLDSFDSDATYHNVEGSDVTSKSALDPVQAPTNPPYKKALELK 300
             +++EPR+IA F++CGGL SFDSDATYH V+    TS  ALDPVQ+PTNPPYKKALELK
Sbjct: 238 PNYHEEPRSIATFIACGGLSSFDSDATYH-VD----TSTPALDPVQSPTNPPYKKALELK 292

Query: 301 RSGKLARA 308
           R GK+ RA
Sbjct: 293 RRGKMTRA 300

>Scas_718.46
          Length = 309

 Score =  478 bits (1229), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 229/311 (73%), Positives = 268/311 (86%), Gaps = 4/311 (1%)

Query: 1   MGKSSKDKRDLYYRKAKEQGYRARSAFKLLQLNDHFHFLD--NVTRVVDLCAAPGSWSQV 58
           MGK+SKDKRD+YYRKAKEQG+RARSAFKLLQLND FHFLD  N+ RVVDLCAAPGSWSQV
Sbjct: 1   MGKNSKDKRDMYYRKAKEQGFRARSAFKLLQLNDDFHFLDDPNLKRVVDLCAAPGSWSQV 60

Query: 59  LSRKLFDNELENENKQSKKIVAVDLQPMSPIDHVTTLQADITHPGTLAKILELFGGDKAD 118
           LS+KLFD +   E K  +KIVAVDLQPMSPI+HVTTLQADITHP TL +IL+LFG +KAD
Sbjct: 61  LSQKLFDGKTAEEIK-DRKIVAVDLQPMSPINHVTTLQADITHPKTLKRILDLFGNEKAD 119

Query: 119 FVCSDGAPDVTGLHDLDEYVQQQLILSALQLTTCLLKEGGCFVAKIFRGRDVDMLYSQLG 178
           FVCSDGAPDVTGLHDLDEYVQQQLI+SALQLT C+LK+GG FVAKIFRGRD+DMLYSQLG
Sbjct: 120 FVCSDGAPDVTGLHDLDEYVQQQLIMSALQLTACILKKGGIFVAKIFRGRDIDMLYSQLG 179

Query: 179 YLFERVVCAKPRSSRGSSLESFIVCLGYKPPHNWTPHLDVNQSIEDFFRGCDLGRLTLQD 238
           YLF++VVCAKP+SSRG+SLE+FIVC+GY PP +W   LDVN S+E+FF GC + +L++ D
Sbjct: 180 YLFDKVVCAKPKSSRGTSLEAFIVCIGYNPPSDWVSTLDVNSSVEEFFSGCHMSKLSIHD 239

Query: 239 NLVEFYDEPRNIAEFVSCGGLDSFDSDATYHNVEGSDVTSKSALDPVQAPTNPPYKKALE 298
            L  + ++ R IA+F+SCG L+SFDSDATYH ++       ++LDPVQ+PTNPPYKKALE
Sbjct: 240 KLPSWQEDERTIAKFMSCGNLESFDSDATYH-LDDFKEDLNTSLDPVQSPTNPPYKKALE 298

Query: 299 LKRSGKLARAA 309
           LKRSGKL RA 
Sbjct: 299 LKRSGKLTRAV 309

>CAGL0H10252g complement(1002563..1003492) highly similar to
           sp|P38238 Saccharomyces cerevisiae YBR061c, start by
           similarity
          Length = 309

 Score =  473 bits (1217), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 227/311 (72%), Positives = 262/311 (84%), Gaps = 8/311 (2%)

Query: 1   MGKSSKDKRDLYYRKAKEQGYRARSAFKLLQLNDHFHFLDN--VTRVVDLCAAPGSWSQV 58
           MGKSSKDKRDLYYRKAKE+GYRARSA+KLLQLN+ FHFLD+  + RVVDLCAAPGSWSQV
Sbjct: 1   MGKSSKDKRDLYYRKAKEEGYRARSAYKLLQLNEEFHFLDDPELKRVVDLCAAPGSWSQV 60

Query: 59  LSRKLFDNE--LENENKQSKKIVAVDLQPMSPIDHVTTLQADITHPGTLAKILELFGGDK 116
           LSRKLF     + +  +  +KI+AVDLQPMSPIDHV TLQADITHP TL +I ELFG  K
Sbjct: 61  LSRKLFAEREPVADGQEDDRKIIAVDLQPMSPIDHVITLQADITHPRTLERIYELFGNQK 120

Query: 117 ADFVCSDGAPDVTGLHDLDEYVQQQLILSALQLTTCLLKEGGCFVAKIFRGRDVDMLYSQ 176
           ADFVCSDGAPDVTGLHDLDEY+Q QLI+SALQLTTC+LK GG FVAKIFRGRD+DMLYSQ
Sbjct: 121 ADFVCSDGAPDVTGLHDLDEYIQHQLIMSALQLTTCVLKRGGTFVAKIFRGRDIDMLYSQ 180

Query: 177 LGYLFERVVCAKPRSSRGSSLESFIVCLGYKPPHNWTPHLDVNQSIEDFFRGCDLGRLTL 236
           LGYLFE++VCAKPRSSRG+SLE+FIVC+GY PP  W P LDVN S+ +FF  CDLG+L++
Sbjct: 181 LGYLFEKIVCAKPRSSRGTSLEAFIVCIGYNPPAGWEPKLDVNSSVTEFFATCDLGKLSI 240

Query: 237 QDNLVEFYDEPRNIAEFVSCGGLDSFDSDATYHNVEGSDVTSKSALDPVQAPTNPPYKKA 296
            D L  + D+PR+IA+F++CG L S+DSDATYH++    V    ALDPVQAPTNPPYK+A
Sbjct: 241 DDTLQPWKDQPRSIADFMACGSLSSYDSDATYHDLPKYGV----ALDPVQAPTNPPYKRA 296

Query: 297 LELKRSGKLAR 307
           LELKR GKL R
Sbjct: 297 LELKRDGKLTR 307

>AGR036W [4346] [Homologous to ScYBR061C - SH]
           complement(774279..775199) [921 bp, 306 aa]
          Length = 306

 Score =  439 bits (1129), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 226/314 (71%), Positives = 253/314 (80%), Gaps = 13/314 (4%)

Query: 1   MGKSSKDKRDLYYRKAKEQGYRARSAFKLLQLNDHFHFLDNVTRVVDLCAAPGSWSQVLS 60
           MGKSSKDKRDLYYRKAKEQG+RARSAFKLLQLND FHFLD V RVVDLCAAPGSWSQVLS
Sbjct: 1   MGKSSKDKRDLYYRKAKEQGFRARSAFKLLQLNDEFHFLDGVQRVVDLCAAPGSWSQVLS 60

Query: 61  RKLFDNELENENKQSKKIVAVDLQPMSPIDHVTTLQADITHPGTLAKILELFGGDKADFV 120
           R+LF     +     K+IVAVDLQPMS I+HVTTLQADITHP TL KI+ELF G+KADFV
Sbjct: 61  RELF----PDGKNTKKRIVAVDLQPMSRIEHVTTLQADITHPRTLTKIIELFKGEKADFV 116

Query: 121 CSDGAPDVTGLHDLDEYVQQQLILSALQLTTCLLKEGGCFVAKIFRGRDVDMLYSQLGYL 180
           CSDGAPDVTGLHDLDEYVQQQLILSAL+LT  LL  GGCFVAKIFRGRD+DMLYSQLG L
Sbjct: 117 CSDGAPDVTGLHDLDEYVQQQLILSALKLTVSLLAPGGCFVAKIFRGRDIDMLYSQLGLL 176

Query: 181 FERVVCAKPRSSRGSSLESFIVCLGYKPPHNWTPHLDVNQSIEDFFRGCDLGR-----LT 235
           F++V CAKPRSSRG+SLESFIVC GY PP +W P+++ N S+E+FF            LT
Sbjct: 177 FDKVTCAKPRSSRGTSLESFIVCQGYTPPLSWAPNIEKNVSVEEFFEEFFQNWSIQQPLT 236

Query: 236 LQDNLVEFYDEPRNIAEFVSCGGLDSFDSDATYHNVEGSDVTSKSALDPVQAPTNPPYKK 295
               L  + +  R IA F+SCGGLDSFDSDATYH++      S +ALDPVQ+PTNPPYK+
Sbjct: 237 PGRPLPMYSEGHRGIAPFISCGGLDSFDSDATYHDLP----KSATALDPVQSPTNPPYKR 292

Query: 296 ALELKRSGKLARAA 309
           ALELKRSGKL R+ 
Sbjct: 293 ALELKRSGKLGRSV 306

>Scas_642.12
          Length = 839

 Score =  168 bits (425), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 94/215 (43%), Positives = 124/215 (57%), Gaps = 10/215 (4%)

Query: 3   KSSKDKRDLYYRKAKEQGYRARSAFKLLQLNDHF-HFLDNVTRVVDLCAAPGSWSQVLSR 61
           K+SK + D YY  AKE+GYRARS+FK++Q+N+ F HFL+    V+DLCAAPGSW QV S+
Sbjct: 7   KNSKGRLDRYYYLAKEKGYRARSSFKIIQINEKFGHFLEKSKVVIDLCAAPGSWCQVASK 66

Query: 62  KLFDNELENENKQSKKIVAVDLQPMSPIDHVTTLQADITHPGTLAKILELFGGDKADFVC 121
               N L         I+ VD+ PM P+++  T Q+DIT     +K+       KAD V 
Sbjct: 67  LCPVNSL---------IIGVDIVPMKPMNNCITFQSDITTEDCRSKLRGYMKTWKADTVL 117

Query: 122 SDGAPDVTGLHDLDEYVQQQLILSALQLTTCLLKEGGCFVAKIFRGRDVDMLYSQLGYLF 181
            DGAP+V      D + Q QL L AL+L    L  GG FV K+FR +D + L      LF
Sbjct: 118 HDGAPNVGLGWVQDAFTQSQLTLQALKLAAENLVVGGTFVTKVFRSKDYNKLIWVFQQLF 177

Query: 182 ERVVCAKPRSSRGSSLESFIVCLGYKPPHNWTPHL 216
           ++V   KP +SR  S E F+VC G+K P    P L
Sbjct: 178 DKVEATKPPASRNVSAEIFVVCKGFKAPKRLDPRL 212

>Kwal_33.13054
          Length = 830

 Score =  167 bits (423), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 100/250 (40%), Positives = 135/250 (54%), Gaps = 18/250 (7%)

Query: 3   KSSKDKRDLYYRKAKEQGYRARSAFKLLQLNDHF-HFLDNVTRVVDLCAAPGSWSQVLSR 61
           K+SK + D YY  AKE+GYRARS+FK++Q+N+ F HF++    V+DLCAAPGSW QV S 
Sbjct: 7   KNSKGRLDRYYYLAKEKGYRARSSFKIIQINEKFGHFMEKSKVVIDLCAAPGSWCQVASN 66

Query: 62  KLFDNELENENKQSKKIVAVDLQPMSPIDHVTTLQADITHPGTLAKILELFGGDKADFVC 121
               N L         I+ VD+ PM P+ +V T Q+DIT     +K+       KAD V 
Sbjct: 67  LCPVNSL---------IIGVDIVPMKPMPNVITFQSDITTEDCRSKLRGYMKTWKADTVL 117

Query: 122 SDGAPDVTGLHDLDEYVQQQLILSALQLTTCLLKEGGCFVAKIFRGRDVDMLYSQLGYLF 181
            DGAP+V      D + Q  L L AL+L    L  GG FV KIFR +D + L      LF
Sbjct: 118 HDGAPNVGLGWAQDAFTQSHLTLQALKLAVENLVVGGTFVTKIFRSKDYNKLIWVFSQLF 177

Query: 182 ERVVCAKPRSSRGSSLESFIVCLGYKPPHNWTPH-LDVNQSIEDFFRGCDLGRLTLQDNL 240
           ++V   KP +SR  S E F+VC G+K P    P  LD  +  E+   G        Q+N 
Sbjct: 178 DKVEATKPPASRNVSAEIFVVCKGFKAPKKLDPRLLDAKEVFEELPDGP-------QNNE 230

Query: 241 VEFYDEPRNI 250
            + Y+  + +
Sbjct: 231 AKIYNPEKKV 240

>YCL054W (SPB1) [493] chr3 (31449..33974) Putative
           S-adenosyl-methionine-dependent methyltransferase
           required for synthesis of the 60S ribosomal subunit,
           member of the 2-prime-O-RNA methyltransferase family,
           which includes Trm7p, Mrm2p, and E. coli FtsJ protein
           [2526 bp, 841 aa]
          Length = 841

 Score =  167 bits (422), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 95/215 (44%), Positives = 123/215 (57%), Gaps = 10/215 (4%)

Query: 3   KSSKDKRDLYYRKAKEQGYRARSAFKLLQLNDHF-HFLDNVTRVVDLCAAPGSWSQVLSR 61
           K+SK + D YY  AKE+GYRARS+FK++Q+N+ + HFL+    V+DLCAAPGSW QV S+
Sbjct: 7   KNSKGRLDRYYYLAKEKGYRARSSFKIIQINEKYGHFLEKSKVVIDLCAAPGSWCQVASK 66

Query: 62  KLFDNELENENKQSKKIVAVDLQPMSPIDHVTTLQADITHPGTLAKILELFGGDKADFVC 121
               N L         I+ VD+ PM P+ +V T Q+DIT     +K+       KAD V 
Sbjct: 67  LCPVNSL---------IIGVDIVPMKPMPNVITFQSDITTEDCRSKLRGYMKTWKADTVL 117

Query: 122 SDGAPDVTGLHDLDEYVQQQLILSALQLTTCLLKEGGCFVAKIFRGRDVDMLYSQLGYLF 181
            DGAP+V      D + Q QL L AL+L    L   G FV KIFR +D + L      LF
Sbjct: 118 HDGAPNVGLGWVQDAFTQSQLTLQALKLAVENLVVNGTFVTKIFRSKDYNKLIWVFQQLF 177

Query: 182 ERVVCAKPRSSRGSSLESFIVCLGYKPPHNWTPHL 216
           E+V   KP +SR  S E F+VC G+K P    P L
Sbjct: 178 EKVEATKPPASRNVSAEIFVVCKGFKAPKRLDPRL 212

>AFR734C [3927] [Homologous to ScYCL054W (SPB1) - SH]
           (1785487..1788024) [2538 bp, 845 aa]
          Length = 845

 Score =  166 bits (421), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 97/216 (44%), Positives = 126/216 (58%), Gaps = 12/216 (5%)

Query: 3   KSSKDKRDLYYRKAKEQGYRARSAFKLLQLNDHF-HFLDNVTRVVDLCAAPGSWSQVLSR 61
           K+SK + D YY  AKE+GYRARS+FK++Q+N+ F HFL+    V+DLCAAPGSW QV S 
Sbjct: 7   KNSKGRLDRYYYLAKEKGYRARSSFKIIQINEKFGHFLEKSKVVIDLCAAPGSWCQVASN 66

Query: 62  KLFDNELENENKQSKKIVAVDLQPMSPIDHVTTLQADITHPGTLAKILELFGGDKADFVC 121
               N L         I+ VD+ PM P+ +V T Q+DIT     +K+       KAD V 
Sbjct: 67  LCPVNSL---------IIGVDIVPMQPMPNVITFQSDITTEDCRSKLRGYMKTWKADTVL 117

Query: 122 SDGAPDVTGLHDL-DEYVQQQLILSALQLTTCLLKEGGCFVAKIFRGRDVDMLYSQLGYL 180
            DGAP+V GL+ + D + Q  L L AL+L    L  GG FV KIFR +D + L      L
Sbjct: 118 HDGAPNV-GLNWVQDAFTQSHLTLQALKLAVENLVVGGTFVTKIFRSKDYNKLMWVFQQL 176

Query: 181 FERVVCAKPRSSRGSSLESFIVCLGYKPPHNWTPHL 216
           F++V   KP +SR  S E F+VC G+K P    P L
Sbjct: 177 FDKVEATKPPASRNVSAEIFVVCKGFKAPKKLDPRL 212

>CAGL0B00484g 35991..38504 highly similar to sp|P25582 Saccharomyces
           cerevisiae YCL054w SPB1, start by similarity
          Length = 837

 Score =  166 bits (419), Expect = 7e-46,   Method: Compositional matrix adjust.
 Identities = 94/215 (43%), Positives = 122/215 (56%), Gaps = 10/215 (4%)

Query: 3   KSSKDKRDLYYRKAKEQGYRARSAFKLLQLNDHF-HFLDNVTRVVDLCAAPGSWSQVLSR 61
           K+SK + D YY  AKE+GYRARS+FK++Q+N+ F HFL+    V+DLCAAPGSW QV S+
Sbjct: 7   KNSKGRLDRYYYLAKEKGYRARSSFKIIQINEKFGHFLEKSKVVIDLCAAPGSWCQVASK 66

Query: 62  KLFDNELENENKQSKKIVAVDLQPMSPIDHVTTLQADITHPGTLAKILELFGGDKADFVC 121
               N L         I+ VD+ PM P+ +V T Q+DIT     +++       KAD V 
Sbjct: 67  LCPVNSL---------IIGVDIVPMKPMPNVITFQSDITTEDCRSRLRGYMKTWKADTVL 117

Query: 122 SDGAPDVTGLHDLDEYVQQQLILSALQLTTCLLKEGGCFVAKIFRGRDVDMLYSQLGYLF 181
            DGAP+V      D + Q  L L AL+L    L   G FV KIFR +D + L      LF
Sbjct: 118 HDGAPNVGLGWAQDAFTQSHLTLQALKLAVENLVVNGTFVTKIFRSKDYNKLIWVFQQLF 177

Query: 182 ERVVCAKPRSSRGSSLESFIVCLGYKPPHNWTPHL 216
           E+V   KP +SR  S E F+VC G+K P    P L
Sbjct: 178 EKVEATKPPASRNVSAEIFVVCKGFKAPKKLDPRL 212

>Sklu_2421.10 YCL054W, Contig c2421 13526-16075 reverse complement
          Length = 849

 Score =  163 bits (413), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 94/215 (43%), Positives = 121/215 (56%), Gaps = 10/215 (4%)

Query: 3   KSSKDKRDLYYRKAKEQGYRARSAFKLLQLNDHF-HFLDNVTRVVDLCAAPGSWSQVLSR 61
           K+SK + D YY  AKE+GYRARS+FK++Q+N+ F HFL+    V+DLCAAPGSW QV S 
Sbjct: 7   KNSKGRLDRYYFLAKEKGYRARSSFKIIQINEKFGHFLEKSKVVIDLCAAPGSWCQVASN 66

Query: 62  KLFDNELENENKQSKKIVAVDLQPMSPIDHVTTLQADITHPGTLAKILELFGGDKADFVC 121
               N L         I+ VD+ PM  + +V T Q+DIT     +++       KAD V 
Sbjct: 67  LCPVNSL---------IIGVDIVPMKSMPNVITFQSDITTEDCRSRLRGYMKTWKADTVL 117

Query: 122 SDGAPDVTGLHDLDEYVQQQLILSALQLTTCLLKEGGCFVAKIFRGRDVDMLYSQLGYLF 181
            DGAP+V      D + Q  L L AL+L    L  GG FV K+FR +D + L      LF
Sbjct: 118 HDGAPNVGLGWVQDAFTQSHLTLQALKLAVENLVVGGTFVTKVFRSKDYNKLIWLFQQLF 177

Query: 182 ERVVCAKPRSSRGSSLESFIVCLGYKPPHNWTPHL 216
           ERV   KP +SR  S E F+VC G+K P    P L
Sbjct: 178 ERVEATKPPASRNVSAEIFVVCKGFKAPKKLDPRL 212

>KLLA0C00737g 53188..55689 similar to sp|P25582 Saccharomyces
           cerevisiae YCL054w SPB1 required for ribosome synthesis,
           putative methylase, start by similarity
          Length = 833

 Score =  162 bits (409), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 93/215 (43%), Positives = 120/215 (55%), Gaps = 10/215 (4%)

Query: 3   KSSKDKRDLYYRKAKEQGYRARSAFKLLQLNDHF-HFLDNVTRVVDLCAAPGSWSQVLSR 61
           K+SK + D YY  AKE+GYRARS+FK++Q+N+ + HFL+    V+DLCAAPGSW QV S 
Sbjct: 8   KNSKGRLDKYYYLAKEKGYRARSSFKIIQINEKYGHFLEKSKVVIDLCAAPGSWCQVASN 67

Query: 62  KLFDNELENENKQSKKIVAVDLQPMSPIDHVTTLQADITHPGTLAKILELFGGDKADFVC 121
               N L         I+ VD+ PM  + +V T Q+DIT     +K+       KAD V 
Sbjct: 68  LCPVNSL---------IIGVDIVPMKTMPNVITFQSDITTEDCRSKLRGYMKTWKADTVL 118

Query: 122 SDGAPDVTGLHDLDEYVQQQLILSALQLTTCLLKEGGCFVAKIFRGRDVDMLYSQLGYLF 181
            DGAP+V      D + Q  L L AL+L    L  GG FV KIFR +D + L      LF
Sbjct: 119 HDGAPNVGLSWAQDAFTQSHLTLQALKLAVENLVVGGTFVTKIFRSKDYNKLIWVFQQLF 178

Query: 182 ERVVCAKPRSSRGSSLESFIVCLGYKPPHNWTPHL 216
           E+V   KP +SR  S E F+VC  +K P    P L
Sbjct: 179 EKVEATKPPASRNVSAEIFVVCKNFKAPKKLDPRL 213

>KLLA0B01980g complement(173710..174579) similar to sp|P53123
           Saccharomyces cerevisiae YGL136c singleton, start by
           similarity
          Length = 289

 Score = 94.0 bits (232), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 74/252 (29%), Positives = 112/252 (44%), Gaps = 58/252 (23%)

Query: 5   SKDKRDLYYRKAKEQGYRARSAFKLLQLNDHFHFLDNVTRVVDLCAAPGSWSQVLSRKLF 64
           ++ K D + + AKEQ +R+R+AFKL+ ++D + F     +V+DL  APG+WSQV  +++ 
Sbjct: 35  ARQKNDHFTKAAKEQQFRSRAAFKLMDIDDKYRFFKQNQKVLDLGFAPGAWSQVARKRIG 94

Query: 65  DNELENENKQSKKIVAVDLQPMSPIDHVTTLQADI----THP------------------ 102
              +         I+ VDL   +P   V +LQA+I    TH                   
Sbjct: 95  SGGM---------IMGVDLLRCTPPKGVYSLQANILSKKTHELIRLCFARHIQLNKHDQL 145

Query: 103 ----GTLAKIL--------------ELFGGDK---------ADFVCSDGAPDVTGLHDLD 135
               G L  +L              ELF              D V SD   + TG+   D
Sbjct: 146 HKDHGYLQHMLEEELNHLKETEEYKELFSQTDISQNIERYPVDVVLSDMMANTTGIQSKD 205

Query: 136 EYVQQQLILSALQLTTCLLKEGGCFVAKIFRGRDVDMLYSQLGYLFERVVCAKPRSSRGS 195
            Y+   L  +AL +   LLK GG F  K++ G +  +L  +L  +F++V   KP +SR  
Sbjct: 206 HYMSMDLCDAALIVAIDLLKPGGSFTCKLYAGSEDTLLEKRLKKVFKKVDRFKPNASRNE 265

Query: 196 SLESFIVCLGYK 207
           S E + V  G K
Sbjct: 266 SKELYFVARGKK 277

>Sklu_2160.2 YGL136C, Contig c2160 1404-2351
          Length = 315

 Score = 84.0 bits (206), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 76/276 (27%), Positives = 115/276 (41%), Gaps = 85/276 (30%)

Query: 6   KDKRDLYYRKAKEQGYRARSAFKLLQLNDHFHFL--DNVTRVVDLCAAPGSWSQVLSRKL 63
           + + D Y ++AK Q  R+R+AFKL++L+D F F   +   RV+DL  APG+WSQV     
Sbjct: 36  RQRNDFYTKEAKNQDLRSRAAFKLIELDDRFKFFLKNKSQRVLDLGFAPGAWSQV----A 91

Query: 64  FDNELENENKQSKKIVAVDLQPMSPIDHVTTLQADI----THP----------------- 102
           FD       K +  ++ VD+ P  P   V+++QA+I    TH                  
Sbjct: 92  FD-----RTKPNGMVLGVDILPCKPPRGVSSIQANILSRKTHELIRLFFSKHFQINRHDE 146

Query: 103 -----GTLAKIL--------------ELFGGD-------------KADFVCSDG---APD 127
                G    +L              E+FG D               D + SD     P 
Sbjct: 147 LHEDHGYFQHMLEEDLKNLKQTDEYREIFGSDVELTNSSTSVEKFPIDVIVSDMYEPWPQ 206

Query: 128 VTGLHD------------------LDEYVQQQLILSALQLTTCLLKEGGCFVAKIFRGRD 169
           +TG  +                   D Y+   L  +AL +   LL+ GG F  K++ G++
Sbjct: 207 MTGFWNNLTNSAYYRMANTTGVAIKDHYMSMDLCDAALVVAIDLLRPGGSFACKVYTGKE 266

Query: 170 VDMLYSQLGYLFERVVCAKPRSSRGSSLESFIVCLG 205
             +L  ++  +F +V   KP SSR  S E + V LG
Sbjct: 267 DKLLEKRMKMVFSKVCRFKPDSSRNESKELYFVGLG 302

>CAGL0H08954g complement(875104..875949) similar to sp|P53123
           Saccharomyces cerevisiae YGL136c, hypothetical start
          Length = 281

 Score = 72.0 bits (175), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 61/244 (25%), Positives = 103/244 (42%), Gaps = 56/244 (22%)

Query: 6   KDKRDLYYRKAKEQGYRARSAFKLLQLNDHFHFLDNVT--RVVDLCAAPGSWSQVLSRKL 63
           + K+D Y R++K    R+R+ FKL QL+D +H        R++DL  APG+WSQV  ++ 
Sbjct: 32  RQKQDFYTRESKLDNLRSRAGFKLAQLDDVYHVFHKSVPQRILDLGYAPGAWSQVARKRT 91

Query: 64  FDNELENENKQSKKIVAVDLQPMSPIDHVTTLQADI----THPGTLAKILE-LFGGDK-- 116
             + +         ++ VD+ P  P   V+++QA+I    TH       +E +F  D   
Sbjct: 92  HPDSI---------VLGVDILPCDPPFGVSSMQANILSKRTHQLIRQFFMEQIFMNDSQV 142

Query: 117 -----------------ADFVCSDG-------APDVTGLHDLDEYVQQQ----------- 141
                             + + SD        +P +  L ++  Y               
Sbjct: 143 ESMARNDSDTEQQPQFPVNIILSDMYEPFPQLSPSLNNLTNMPYYRMSNTSGLNFKDHLN 202

Query: 142 ---LILSALQLTTCLLKEGGCFVAKIFRGRDVDMLYSQLGYLFERVVCAKPRSSRGSSLE 198
              L  +AL     LL+  G F+ K F G +  +   ++  +F+RV   KP +SR  S E
Sbjct: 203 SIDLCDAALITAVDLLEPAGSFICKQFSGAETSLFEKRMKKVFDRVEITKPSASRDESKE 262

Query: 199 SFIV 202
            + +
Sbjct: 263 IYFI 266

>AFL117C [3078] [Homologous to ScYGL136C (MRM2) - SH]
           (218993..219904) [912 bp, 303 aa]
          Length = 303

 Score = 72.0 bits (175), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 73/267 (27%), Positives = 111/267 (41%), Gaps = 76/267 (28%)

Query: 5   SKDKRDLYYRKAKEQGYRARSAFKLLQLNDHFHFLDNVTRVVDLCAAPGSWSQVLSRKLF 64
           S+ +RD Y R+AK Q  R+R+AFKL+++++ F       RV+DL  APG+WSQV  ++  
Sbjct: 32  SRQRRDPYTREAKVQELRSRAAFKLIEIDEQFRLFRAGQRVLDLGFAPGAWSQVAQQR-- 89

Query: 65  DNELENENKQSKKIVAVDLQPMSPIDHVTTLQADI----THP------------------ 102
                   +   K++ VD+ P  P   V+++QA+     TH                   
Sbjct: 90  -------TQPGGKVMGVDVLPCKPPTGVSSIQANALSRKTHELVRLYFSRHFQLNMHDEL 142

Query: 103 ----GTLAKILE--------------LFG------GDKADFVCSD---GAPDVTGLHD-- 133
               G    +LE              L+G          D V SD     P VTG  +  
Sbjct: 143 HKKHGYFQHMLEERLEELQKDNSFQPLYGMADPVHEHPLDVVLSDMYEPWPQVTGFWNNF 202

Query: 134 ----------------LDEYVQQQLILSALQLTTCLLKEGGCFVAKIFRGRDVDMLYSQL 177
                            D Y+   L  +AL     LL+ GG FV K++ G++  +L  +L
Sbjct: 203 TNAAYSRMANTSGVAVKDHYMSMDLCDAALLCAIALLRPGGSFVCKLYTGKEDQLLERRL 262

Query: 178 GYLFERVVCAKPRSSRGSSLESFIVCL 204
             +F +V   KP + R  S E + V L
Sbjct: 263 RKVFTKVRRFKPEACRSESKELYFVGL 289

>Scas_720.46
          Length = 321

 Score = 64.3 bits (155), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 38/97 (39%), Positives = 56/97 (57%), Gaps = 11/97 (11%)

Query: 10  DLYYRKAKEQGYRARSAFKLLQLNDHFHFLD--NVTRVVDLCAAPGSWSQVLSRKLFDNE 67
           D Y R+AK   +R+R+AFKL +++D FH  +   + RV+DL  APG+WSQV         
Sbjct: 42  DPYTREAKINNFRSRAAFKLTEIDDKFHIFNKSKIQRVLDLGFAPGAWSQVAR------- 94

Query: 68  LENENKQSKKIVAVDLQPMSPIDHVTTLQADITHPGT 104
            E  +K+S  I+ VD+ P  P   V+ +QA+I    T
Sbjct: 95  -ERTSKES-MILGVDILPCDPPHGVSAIQANILSKKT 129

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 24/81 (29%), Positives = 41/81 (50%)

Query: 127 DVTGLHDLDEYVQQQLILSALQLTTCLLKEGGCFVAKIFRGRDVDMLYSQLGYLFERVVC 186
           + +GL   D      L  +AL     LL+  G FV K+F G +  +   ++  +F++ + 
Sbjct: 230 NTSGLTVRDHQHSIDLCDAALVTALDLLRPKGSFVCKLFTGVEDKLFEKRVKMVFKKTIR 289

Query: 187 AKPRSSRGSSLESFIVCLGYK 207
            KP+SSR  S E +I+ +  K
Sbjct: 290 FKPKSSRNESKEVYIIGMDKK 310

>Kwal_56.24158
          Length = 307

 Score = 62.4 bits (150), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 47/139 (33%), Positives = 68/139 (48%), Gaps = 18/139 (12%)

Query: 6   KDKRDLYYRKAKEQGYRARSAFKLLQLNDHFHFLDNVTR--VVDLCAAPGSWSQVLSRKL 63
           + K D + R AK QG R+R+AFKL+Q++D  H      R  V+DL  APG+WSQV     
Sbjct: 35  RQKNDSFTRDAKVQGLRSRAAFKLMQIDDKVHLFRKNARQNVLDLGYAPGAWSQV----A 90

Query: 64  FDNELENENKQSKKIVAVDLQPMSPIDHVTTLQADITHPGTLAKILELFGGDKADFVCSD 123
           FD            I+ VD+ P +P   V+++QA+I    T  +++ LF   +      D
Sbjct: 91  FD-----RTGPDGVILGVDILPCAPPRGVSSIQANILSRKT-HELIRLFFSRQFQLYYED 144

Query: 124 GAPDVTGLHDLDEYVQQQL 142
                  LH  + Y Q  L
Sbjct: 145 ------RLHKDNGYFQHML 157

>YGL136C (MRM2) [1851] chr7 complement(252900..253862)
           Methyltransferase that methylates mitochondrial 21S rRNA
           at nucleotide U2791, member of the 2-prime-O-RNA
           methyltransferase family, which includes Trm7p, Spb1p,
           and E. coli FtsJ protein [963 bp, 320 aa]
          Length = 320

 Score = 60.5 bits (145), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 36/94 (38%), Positives = 56/94 (59%), Gaps = 12/94 (12%)

Query: 9   RDLYYRKAKEQGYRARSAFKLLQLNDHFH-FLDNVT--RVVDLCAAPGSWSQVLSRKLFD 65
           +D Y ++AK Q  R+R+AFKL+Q++D +  F  N T  R++DL  APG+WSQV  ++   
Sbjct: 37  KDPYTKEAKVQNLRSRAAFKLMQIDDKYRLFSKNRTDQRILDLGYAPGAWSQVARQRSSP 96

Query: 66  NELENENKQSKKIVAVDLQPMSPIDHVTTLQADI 99
           N +         I+ VD+ P  P   V ++QA+I
Sbjct: 97  NSM---------ILGVDILPCEPPHGVNSIQANI 121

 Score = 38.1 bits (87), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 23/81 (28%), Positives = 40/81 (49%)

Query: 127 DVTGLHDLDEYVQQQLILSALQLTTCLLKEGGCFVAKIFRGRDVDMLYSQLGYLFERVVC 186
           + +G+   D Y    L  +AL     LL+  G FV K++ G + ++   ++  +F  V  
Sbjct: 228 NTSGVSIRDHYQSIDLCDAALVTAIDLLRPLGSFVCKLYTGEEENLFKKRMQAVFTNVHK 287

Query: 187 AKPRSSRGSSLESFIVCLGYK 207
            KP +SR  S E++ + L  K
Sbjct: 288 FKPDASRDESKETYYIGLKKK 308

>Kwal_56.23171
          Length = 438

 Score = 30.8 bits (68), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 32/64 (50%), Gaps = 4/64 (6%)

Query: 68  LENENKQSKKIVAVDLQPMSPIDHVTTLQADITHPGTLAKILELFGGDKADFVCSDGAPD 127
           +  E K+ K  V +D++P  PI+    L  +  H   L+++LE    DK  F+  DG   
Sbjct: 98  ITEEGKEKK--VTIDIEPYKPINTSLYLCDNKFHTEVLSELLE--ADDKFGFIVMDGQGT 153

Query: 128 VTGL 131
           + GL
Sbjct: 154 LFGL 157

>Sklu_2185.4 YNL022C, Contig c2185 6305-7738 reverse complement
          Length = 477

 Score = 30.0 bits (66), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 26/87 (29%), Positives = 39/87 (44%), Gaps = 8/87 (9%)

Query: 45  VVDLCAAPGSWSQVLSRKLFDNELENENKQSKKIVAVDLQPMSPIDHVTTLQADITHPGT 104
           ++D C+APG+ +  ++  +FD E   + KQ   I A +  P    +   TLQ  I   G 
Sbjct: 242 IIDSCSAPGNKTTHVAAHMFDPEFVPKQKQ---IHAFEKDP----ERAKTLQKMIQVAGC 294

Query: 105 LAKILELFGGDKADFVCSDGAPDVTGL 131
             K +E+  GD       D    VTG 
Sbjct: 295 -DKSIEVHVGDFTKLAKPDKFSQVTGF 320

>Kwal_26.6752
          Length = 522

 Score = 30.0 bits (66), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 27/103 (26%), Positives = 49/103 (47%), Gaps = 13/103 (12%)

Query: 194 GSSLESFIVCLGYKPPHNWTPHLDVNQSIEDFFRG---------CDLGRLTLQDNLV-EF 243
           GS+L+   + LG K P+      D+ Q++++   G         C   R+ +++++  +F
Sbjct: 281 GSNLKKVTLELGGKSPNMVFGDADLKQAVQNIILGIYYNSGEVCCAGSRVYVEESVYDQF 340

Query: 244 YDEPRNIAEFVSCGGLDSFDSDATYHNVEGSDVTSKSALDPVQ 286
            +E +  AE V  G  D FD DAT+   + S +     L  V+
Sbjct: 341 LEEFKAAAENVKVG--DPFD-DATFQGAQTSQMQLSKILKYVE 380

>CAGL0L06754g 759181..760497 highly similar to sp|P12385
           Saccharomyces cerevisiae YBR143c SUP45 translational
           release factor, start by similarity
          Length = 438

 Score = 29.3 bits (64), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 21/69 (30%), Positives = 35/69 (50%), Gaps = 3/69 (4%)

Query: 63  LFDNELENENKQSKKIVAVDLQPMSPIDHVTTLQADITHPGTLAKILELFGGDKADFVCS 122
           L+  ++  E+ + KK V  D++P  PI+    L  +  H   L+++LE    DK  F+  
Sbjct: 92  LYCGDIITEDGKEKK-VTFDIEPYKPINTSLYLCDNKFHTEVLSELLE--ADDKFGFIVM 148

Query: 123 DGAPDVTGL 131
           DG   + GL
Sbjct: 149 DGQGALFGL 157

>KLLA0C11231g 965524..966840 highly similar to sp|P12385
           Saccharomyces cerevisiae YBR143c SUP45 translational
           release factor singleton, start by similarity
          Length = 438

 Score = 28.9 bits (63), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 31/64 (48%), Gaps = 4/64 (6%)

Query: 68  LENENKQSKKIVAVDLQPMSPIDHVTTLQADITHPGTLAKILELFGGDKADFVCSDGAPD 127
           +  E K+ K  V  D++P  PI+    L  +  H   L+++LE    DK  F+  DG   
Sbjct: 98  ITEEGKEKK--VTFDIEPYKPINTSLYLCDNKFHTEVLSELLE--ADDKFGFIVMDGQGA 153

Query: 128 VTGL 131
           + GL
Sbjct: 154 LFGL 157

>CAGL0C01265g complement(129884..134389) weakly similar to sp|P40477
           Saccharomyces cerevisiae YIL115c NUP159, start by
           similarity
          Length = 1501

 Score = 28.9 bits (63), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 30/116 (25%), Positives = 51/116 (43%), Gaps = 8/116 (6%)

Query: 41  NVTRVVDLCAAP---GSWSQVLSRKLFDNELENENKQSKKIVAVDLQPMSPIDHVTT--- 94
           N + +++L  +P    ++ +   +  F N   N N  SK+   VD    SP   ++T   
Sbjct: 831 NSSNILNLSNSPFAKSAFEKSTGQSPFSNSFSNLNCDSKRESQVDNASSSPFAKLSTNTH 890

Query: 95  LQADITHPGTLAKILELFGGDKADFVCSDGAPDVTGLHDLDEYVQQQLILSALQLT 150
            ++ + +      + E+   D+A+F  SD   + T L DLDE   Q    S   LT
Sbjct: 891 EKSKVDNGSEKEGVHEVQNSDEAEF--SDSTVEQTPLADLDESKGQVASPSISSLT 944

>Sklu_2336.8 YLR234W, Contig c2336 10814-12730 reverse complement
          Length = 638

 Score = 28.9 bits (63), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 14/58 (24%), Positives = 29/58 (50%)

Query: 46  VDLCAAPGSWSQVLSRKLFDNELENENKQSKKIVAVDLQPMSPIDHVTTLQADITHPG 103
           +D  +   +W+Q  +RKLFD  LE++  + ++ +A +++  S       +  D    G
Sbjct: 66  IDFGSEYSNWNQCDTRKLFDAPLEDKKSKDQQKIAKNIENESKYADFLMIWTDCDREG 123

>Scas_633.3
          Length = 437

 Score = 28.5 bits (62), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 21/69 (30%), Positives = 35/69 (50%), Gaps = 3/69 (4%)

Query: 63  LFDNELENENKQSKKIVAVDLQPMSPIDHVTTLQADITHPGTLAKILELFGGDKADFVCS 122
           L+  ++  E+ + KK V  D++P  PI+    L  +  H   L+++LE    DK  F+  
Sbjct: 92  LYCGDIITEDGKEKK-VTFDIEPYKPINTSLYLCDNKFHTEVLSELLE--ADDKFGFIVM 148

Query: 123 DGAPDVTGL 131
           DG   + GL
Sbjct: 149 DGQGCLFGL 157

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.319    0.136    0.408 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 10,587,129
Number of extensions: 447934
Number of successful extensions: 1257
Number of sequences better than 10.0: 37
Number of HSP's gapped: 1211
Number of HSP's successfully gapped: 44
Length of query: 315
Length of database: 16,596,109
Length adjustment: 102
Effective length of query: 213
Effective length of database: 13,065,073
Effective search space: 2782860549
Effective search space used: 2782860549
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 61 (28.1 bits)