Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Sklu_2357.258858831270.0
Scas_661.2862158928120.0
Kwal_27.1054159158427940.0
CAGL0K12012g59158927810.0
YDR037W (KRS1)59158827780.0
AGR037C58958827650.0
KLLA0F18392g58858626940.0
CAGL0J10230g5435126721e-80
Scas_633.285925026682e-79
KLLA0F04796g5175016482e-77
Kwal_23.47175275036266e-74
YNL073W (MSK1)5764825738e-66
AER362W5255045672e-65
CAGL0D06556g5536002317e-20
ADL039C5564872183e-18
Scas_347.35524952103e-17
Sklu_2189.35584982005e-16
YLL018C (DPS1)5574801979e-16
KLLA0D03839g5554861872e-14
Kwal_27.122356501991613e-11
YHR019C (DED81)5544741586e-11
KLLA0A08426g5544731586e-11
Sklu_2265.35604951416e-09
Kwal_14.23034752661372e-08
Sklu_1963.16551421345e-08
Scas_700.66582781283e-07
KLLA0A11484g4743541263e-07
AGR206C6511181265e-07
AEL020W5523391231e-06
YPL104W (MSD1)6581311202e-06
CAGL0A02112g5484751166e-06
Scas_607.145553391167e-06
KLLA0E24486g6451111159e-06
CAGL0H05907g6591341104e-05
Kwal_0.3754283131004e-04
CAGL0K07656g49776810.10
KLLA0F25234g49976800.11
AFR516W49976780.21
Scas_707.1449976780.24
Kwal_47.1799849976760.36
YFL022C (FRS2)50376750.55
Kwal_34.1598950651711.4
CAGL0L08030g46741683.0
Scas_628.2448732674.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Sklu_2357.2
         (588 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Sklu_2357.2 YDR037W, Contig c2357 1101-2867                          1209   0.0  
Scas_661.28                                                          1087   0.0  
Kwal_27.10541                                                        1080   0.0  
CAGL0K12012g 1159164..1160939 highly similar to sp|P15180 Saccha...  1075   0.0  
YDR037W (KRS1) [890] chr4 (525435..527210) Lysyl-tRNA synthetase...  1074   0.0  
AGR037C [4347] [Homologous to ScYDR037W (KRS1) - SH] (775332..77...  1069   0.0  
KLLA0F18392g 1693928..1695694 highly similar to sp|P15180 Saccha...  1042   0.0  
CAGL0J10230g complement(998449..1000080) similar to sp|P32048 Sa...   263   1e-80
Scas_633.28                                                           261   2e-79
KLLA0F04796g complement(466476..468029) similar to sp|P32048 Sac...   254   2e-77
Kwal_23.4717                                                          245   6e-74
YNL073W (MSK1) [4517] chr14 (488385..490115) Lysyl-tRNA syntheta...   225   8e-66
AER362W [2863] [Homologous to ScYNL073W (MSK1) - SH] complement(...   223   2e-65
CAGL0D06556g 623770..625431 highly similar to sp|P04802 Saccharo...    94   7e-20
ADL039C [1702] [Homologous to ScYLL018C (DPS1) - SH] (620628..62...    89   3e-18
Scas_347.3                                                             86   3e-17
Sklu_2189.3 YLL018C, Contig c2189 5672-7348 reverse complement         82   5e-16
YLL018C (DPS1) [3401] chr12 complement(109901..111574) Aspartyl-...    80   9e-16
KLLA0D03839g 324274..325941 highly similar to sp|P04802 Saccharo...    77   2e-14
Kwal_27.12235                                                          67   3e-11
YHR019C (DED81) [2305] chr8 complement(141886..143550) Asparagin...    65   6e-11
KLLA0A08426g complement(745048..746712) similar to sp|P38707 Sac...    65   6e-11
Sklu_2265.3 YHR019C, Contig c2265 4970-6652                            59   6e-09
Kwal_14.2303                                                           57   2e-08
Sklu_1963.1 YPL104W, Contig c1963 1525-3492 reverse complement         56   5e-08
Scas_700.6                                                             54   3e-07
KLLA0A11484g 992734..994158 similar to sp|P25345 Saccharomyces c...    53   3e-07
AGR206C [4517] [Homologous to ScYPL104W (MSD1) - SH] (1144536..1...    53   5e-07
AEL020W [2486] [Homologous to ScYHR019C (DED81) - SH] complement...    52   1e-06
YPL104W (MSD1) [5340] chr16 (355695..357671) Aspartyl-tRNA synth...    51   2e-06
CAGL0A02112g 216596..218242 highly similar to sp|P38707 Saccharo...    49   6e-06
Scas_607.14                                                            49   7e-06
KLLA0E24486g complement(2173560..2175497) similar to sp|P15179 S...    49   9e-06
CAGL0H05907g complement(579444..581423) similar to sp|P15179 Sac...    47   4e-05
Kwal_0.375                                                             43   4e-04
CAGL0K07656g 761388..762881 highly similar to sp|P15625 Saccharo...    36   0.10 
KLLA0F25234g complement(2349192..2350691) highly similar to sp|P...    35   0.11 
AFR516W [3708] [Homologous to ScYFL022C (FRS2) - SH] complement(...    35   0.21 
Scas_707.14                                                            35   0.24 
Kwal_47.17998                                                          34   0.36 
YFL022C (FRS2) [1661] chr6 complement(93497..95008) Phenylalanyl...    33   0.55 
Kwal_34.15989                                                          32   1.4  
CAGL0L08030g 875106..876509 similar to sp|P25345 Saccharomyces c...    31   3.0  
Scas_628.24                                                            30   4.4  

>Sklu_2357.2 YDR037W, Contig c2357 1101-2867
          Length = 588

 Score = 1209 bits (3127), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 580/588 (98%), Positives = 580/588 (98%)

Query: 1   MSQEEATKAATESVANLHLDEVTGEKVSKSELKKRIKQRQIEXXXXXXXXNAQPKPETKK 60
           MSQEEATKAATESVANLHLDEVTGEKVSKSELKKRIKQRQIE        NAQPKPETKK
Sbjct: 1   MSQEEATKAATESVANLHLDEVTGEKVSKSELKKRIKQRQIEAKKAAKKANAQPKPETKK 60

Query: 61  KVDTFADLDPSQYFEARSRQIQELRKSHLPNPYPHKFHVSISLPDFLKKYENLKRGETLP 120
           KVDTFADLDPSQYFEARSRQIQELRKSHLPNPYPHKFHVSISLPDFLKKYENLKRGETLP
Sbjct: 61  KVDTFADLDPSQYFEARSRQIQELRKSHLPNPYPHKFHVSISLPDFLKKYENLKRGETLP 120

Query: 121 NEKVSIAGRIHAKRESGSKLKFYVLHGDGVEVQVMSQLQDYHSEEAYEQDHGLLKRGDIV 180
           NEKVSIAGRIHAKRESGSKLKFYVLHGDGVEVQVMSQLQDYHSEEAYEQDHGLLKRGDIV
Sbjct: 121 NEKVSIAGRIHAKRESGSKLKFYVLHGDGVEVQVMSQLQDYHSEEAYEQDHGLLKRGDIV 180

Query: 181 GVEGYVGRTQPKKGGEGEISVFVSRIELLTPCLHMLPADHFGFKDQETRYRKRYLDLIMN 240
           GVEGYVGRTQPKKGGEGEISVFVSRIELLTPCLHMLPADHFGFKDQETRYRKRYLDLIMN
Sbjct: 181 GVEGYVGRTQPKKGGEGEISVFVSRIELLTPCLHMLPADHFGFKDQETRYRKRYLDLIMN 240

Query: 241 KDARSRFITRSKIITFIRKFLDERSFIEVETPMMNVIAGGATAKPFVTHHNDLNMDMFMR 300
           KDARSRFITRSKIITFIRKFLDERSFIEVETPMMNVIAGGATAKPFVTHHNDLNMDMFMR
Sbjct: 241 KDARSRFITRSKIITFIRKFLDERSFIEVETPMMNVIAGGATAKPFVTHHNDLNMDMFMR 300

Query: 301 IAPELFLKQLVVGGMDRVYEIGRQFRNEGIDMTHNPEFTTCEFYQAYADVYDLMDMTELL 360
           IAPELFLKQLVVGGMDRVYEIGRQFRNEGIDMTHNPEFTTCEFYQAYADVYDLMDMTELL
Sbjct: 301 IAPELFLKQLVVGGMDRVYEIGRQFRNEGIDMTHNPEFTTCEFYQAYADVYDLMDMTELL 360

Query: 361 FSEMVKEITGSYVIKYHPNPQNPELEMELNFARPWKRINMIEELEKRFNVKFPAGDQLHT 420
           FSEMVKEITGSYVIKYHPNPQNPELEMELNFARPWKRINMIEELEKRFNVKFPAGDQLHT
Sbjct: 361 FSEMVKEITGSYVIKYHPNPQNPELEMELNFARPWKRINMIEELEKRFNVKFPAGDQLHT 420

Query: 421 AETGEFLKNILTENKMECTPPLTNARMLDKLVGELEDTCINPTFIFGHPQMMSPLAKYSR 480
           AETGEFLKNILTENKMECTPPLTNARMLDKLVGELEDTCINPTFIFGHPQMMSPLAKYSR
Sbjct: 421 AETGEFLKNILTENKMECTPPLTNARMLDKLVGELEDTCINPTFIFGHPQMMSPLAKYSR 480

Query: 481 DVPGLCERFEVFVATKEICNAYTELNDPFDQRARFEEQARQKDQGDDEVQLIDETFCNAL 540
           DVPGLCERFEVFVATKEICNAYTELNDPFDQRARFEEQARQKDQGDDEVQLIDETFCNAL
Sbjct: 481 DVPGLCERFEVFVATKEICNAYTELNDPFDQRARFEEQARQKDQGDDEVQLIDETFCNAL 540

Query: 541 EYGLPPTGGWGCGVDRLAMFLTDSNTIREVLLFPTLKPDVLKEEIKKD 588
           EYGLPPTGGWGCGVDRLAMFLTDSNTIREVLLFPTLKPDVLKEEIKKD
Sbjct: 541 EYGLPPTGGWGCGVDRLAMFLTDSNTIREVLLFPTLKPDVLKEEIKKD 588

>Scas_661.28
          Length = 621

 Score = 1087 bits (2812), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 517/589 (87%), Positives = 547/589 (92%), Gaps = 2/589 (0%)

Query: 1   MSQEEATKAATESVANLHLDEVTGEKVSKSELKKRIKQRQIEXXXXXXXXNAQPKPETKK 60
           MSQEEA +   E+VANLHLDE TGE VSKSELKKRIKQRQ+E         AQPKPE+KK
Sbjct: 31  MSQEEAVQKVAENVANLHLDEATGEMVSKSELKKRIKQRQVEAKKAAKKAAAQPKPESKK 90

Query: 61  K--VDTFADLDPSQYFEARSRQIQELRKSHLPNPYPHKFHVSISLPDFLKKYENLKRGET 118
           K   D FADLDPSQYFEARSRQIQELRK+  PNPYPHKF VSIS P+FLKKY  L+RGET
Sbjct: 91  KKNTDLFADLDPSQYFEARSRQIQELRKTQSPNPYPHKFKVSISNPEFLKKYAYLQRGET 150

Query: 119 LPNEKVSIAGRIHAKRESGSKLKFYVLHGDGVEVQVMSQLQDYHSEEAYEQDHGLLKRGD 178
           LPNEKV+IAGRIHAKRESGSKLKFYVLHGDGVEVQ+MSQLQDY++E  YE+DH LLKRGD
Sbjct: 151 LPNEKVAIAGRIHAKRESGSKLKFYVLHGDGVEVQLMSQLQDYNNEADYEKDHDLLKRGD 210

Query: 179 IVGVEGYVGRTQPKKGGEGEISVFVSRIELLTPCLHMLPADHFGFKDQETRYRKRYLDLI 238
           IVGVEGYVGRTQPKKGGEGEISVFVSRIELLTPCLHMLPADHFGFKDQETRYRKRYLDLI
Sbjct: 211 IVGVEGYVGRTQPKKGGEGEISVFVSRIELLTPCLHMLPADHFGFKDQETRYRKRYLDLI 270

Query: 239 MNKDARSRFITRSKIITFIRKFLDERSFIEVETPMMNVIAGGATAKPFVTHHNDLNMDMF 298
           MNKDAR RFI RS+II FIR+FLD+R FIEVETPMMNVIAGGATAKPFVTHHNDL+MDM+
Sbjct: 271 MNKDARGRFIKRSQIIRFIRRFLDQREFIEVETPMMNVIAGGATAKPFVTHHNDLDMDMY 330

Query: 299 MRIAPELFLKQLVVGGMDRVYEIGRQFRNEGIDMTHNPEFTTCEFYQAYADVYDLMDMTE 358
           MRIAPELFLK+LVVGGMDRVYEIGRQFRNEGIDMTHNPEFTTCEFYQAYADVYDLMDMTE
Sbjct: 331 MRIAPELFLKELVVGGMDRVYEIGRQFRNEGIDMTHNPEFTTCEFYQAYADVYDLMDMTE 390

Query: 359 LLFSEMVKEITGSYVIKYHPNPQNPELEMELNFARPWKRINMIEELEKRFNVKFPAGDQL 418
           L+FSEMVKEITGSY+IKYHP+P NPE EMELNF RPWKR+NMIEELEKRFNV FPAGDQL
Sbjct: 391 LMFSEMVKEITGSYIIKYHPDPNNPEKEMELNFTRPWKRMNMIEELEKRFNVTFPAGDQL 450

Query: 419 HTAETGEFLKNILTENKMECTPPLTNARMLDKLVGELEDTCINPTFIFGHPQMMSPLAKY 478
           HTAETGEFLK +L +NKMEC PPLTNARMLDKLVGELED CINPTFIFGHPQMMSPLAKY
Sbjct: 451 HTAETGEFLKKVLADNKMECPPPLTNARMLDKLVGELEDVCINPTFIFGHPQMMSPLAKY 510

Query: 479 SRDVPGLCERFEVFVATKEICNAYTELNDPFDQRARFEEQARQKDQGDDEVQLIDETFCN 538
           SRD PGLCERFEVFVATKEICNAYTELNDPFDQRARFEEQARQKDQGDDE QL+DETFCN
Sbjct: 511 SRDTPGLCERFEVFVATKEICNAYTELNDPFDQRARFEEQARQKDQGDDEAQLVDETFCN 570

Query: 539 ALEYGLPPTGGWGCGVDRLAMFLTDSNTIREVLLFPTLKPDVLKEEIKK 587
           ALEYGLPPTGGWGCG+DRLAMFLTDSNTIREVLLFPTLKPDVL+EE+++
Sbjct: 571 ALEYGLPPTGGWGCGIDRLAMFLTDSNTIREVLLFPTLKPDVLREEVEE 619

>Kwal_27.10541
          Length = 591

 Score = 1080 bits (2794), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 509/584 (87%), Positives = 545/584 (93%), Gaps = 1/584 (0%)

Query: 1   MSQEEATKAATESVANLHLDEVTGEKVSKSELKKRIKQRQIEXXXXXXXXNAQPKPETKK 60
           MSQEEA K+A +++ANLHLDE TGE VSKSELKKR KQRQ+E        +AQPKPE KK
Sbjct: 1   MSQEEAVKSANDAIANLHLDEATGEMVSKSELKKRAKQRQVEAKKAAKKASAQPKPEPKK 60

Query: 61  KV-DTFADLDPSQYFEARSRQIQELRKSHLPNPYPHKFHVSISLPDFLKKYENLKRGETL 119
           K  D FADLDPSQYFEARSRQIQEL+K+  PNPYPHKFHVSI L +FL+KY +L+RGETL
Sbjct: 61  KANDAFADLDPSQYFEARSRQIQELKKTQSPNPYPHKFHVSIGLSEFLQKYAHLQRGETL 120

Query: 120 PNEKVSIAGRIHAKRESGSKLKFYVLHGDGVEVQVMSQLQDYHSEEAYEQDHGLLKRGDI 179
           P EKVSIAGR+HAKRESGSKLKFYVLHGDGVEVQ+MSQLQDY SE AYE DH L+KRGDI
Sbjct: 121 PEEKVSIAGRVHAKRESGSKLKFYVLHGDGVEVQLMSQLQDYGSESAYEADHDLIKRGDI 180

Query: 180 VGVEGYVGRTQPKKGGEGEISVFVSRIELLTPCLHMLPADHFGFKDQETRYRKRYLDLIM 239
           +GVEGYVGRTQPKKGGEGEISVFVSRI+LLTPCLH+LPADHFGFKDQETRYRKRYLDLIM
Sbjct: 181 IGVEGYVGRTQPKKGGEGEISVFVSRIQLLTPCLHILPADHFGFKDQETRYRKRYLDLIM 240

Query: 240 NKDARSRFITRSKIITFIRKFLDERSFIEVETPMMNVIAGGATAKPFVTHHNDLNMDMFM 299
           NKDAR RFITRSKII++IRKFLDER+FIEVETPMMNVIAGGATAKPFVTHHNDLNMDMFM
Sbjct: 241 NKDARPRFITRSKIISYIRKFLDERNFIEVETPMMNVIAGGATAKPFVTHHNDLNMDMFM 300

Query: 300 RIAPELFLKQLVVGGMDRVYEIGRQFRNEGIDMTHNPEFTTCEFYQAYADVYDLMDMTEL 359
           RIAPELFLK+LVVGGM+RVYEIGRQFRNEGIDMTHNPEFTTCEFYQA+ADVYDLMDMTE+
Sbjct: 301 RIAPELFLKELVVGGMERVYEIGRQFRNEGIDMTHNPEFTTCEFYQAFADVYDLMDMTEV 360

Query: 360 LFSEMVKEITGSYVIKYHPNPQNPELEMELNFARPWKRINMIEELEKRFNVKFPAGDQLH 419
           LFSEMVKEITGSYVIKYHP+P++P  E+ELNFARPWKRINMIEELEKR NVKFPAGD+LH
Sbjct: 361 LFSEMVKEITGSYVIKYHPDPRDPAKELELNFARPWKRINMIEELEKRLNVKFPAGDELH 420

Query: 420 TAETGEFLKNILTENKMECTPPLTNARMLDKLVGELEDTCINPTFIFGHPQMMSPLAKYS 479
           TAETGEFLK +L EN +EC PPLTNARMLDKLVGELEDTCINPTFIFGHPQMMSPLAK S
Sbjct: 421 TAETGEFLKRVLKENNLECPPPLTNARMLDKLVGELEDTCINPTFIFGHPQMMSPLAKKS 480

Query: 480 RDVPGLCERFEVFVATKEICNAYTELNDPFDQRARFEEQARQKDQGDDEVQLIDETFCNA 539
           RD+PGLCERFEVFVATKEICNAYTELNDPFDQRARFEEQARQKDQGDDE QL+DETFCNA
Sbjct: 481 RDIPGLCERFEVFVATKEICNAYTELNDPFDQRARFEEQARQKDQGDDEAQLVDETFCNA 540

Query: 540 LEYGLPPTGGWGCGVDRLAMFLTDSNTIREVLLFPTLKPDVLKE 583
           LEYGLPPTGGWGCG+DRLAMFLTDSNTIREVLLFPTLKPD  K+
Sbjct: 541 LEYGLPPTGGWGCGIDRLAMFLTDSNTIREVLLFPTLKPDTQKD 584

>CAGL0K12012g 1159164..1160939 highly similar to sp|P15180
           Saccharomyces cerevisiae YDR037w KRS1 lysyl-tRNA
           synthetase, start by similarity
          Length = 591

 Score = 1075 bits (2781), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 523/589 (88%), Positives = 545/589 (92%), Gaps = 1/589 (0%)

Query: 1   MSQEEATKAATESVANLHLDEVTGEKVSKSELKKRIKQRQIEXXXXXXXXNAQPKPETKK 60
           MSQEEATKAATE VANLHLDEVTGE VSKSELKKR+K RQ+E        +AQPKPE KK
Sbjct: 1   MSQEEATKAATEGVANLHLDEVTGEMVSKSELKKRMKARQVEAKKAAKKASAQPKPEPKK 60

Query: 61  KV-DTFADLDPSQYFEARSRQIQELRKSHLPNPYPHKFHVSISLPDFLKKYENLKRGETL 119
           K  D  ADLDPSQYFEARSRQI ELRK+H PNPYPHKF VSIS P+FL KY +LKRGETL
Sbjct: 61  KKNDLLADLDPSQYFEARSRQILELRKTHSPNPYPHKFQVSISNPEFLAKYAHLKRGETL 120

Query: 120 PNEKVSIAGRIHAKRESGSKLKFYVLHGDGVEVQVMSQLQDYHSEEAYEQDHGLLKRGDI 179
           PNE VSIAGRIHAKRESGSKLKFYVLHGDGVEVQVMSQLQDY   EAYE DH L+KRGDI
Sbjct: 121 PNEIVSIAGRIHAKRESGSKLKFYVLHGDGVEVQVMSQLQDYADAEAYENDHDLIKRGDI 180

Query: 180 VGVEGYVGRTQPKKGGEGEISVFVSRIELLTPCLHMLPADHFGFKDQETRYRKRYLDLIM 239
           VGVEGYVGRTQPKKGGEGEISVFV RIELLTPCLHMLPADHFGFKDQETRYRKRYLDLIM
Sbjct: 181 VGVEGYVGRTQPKKGGEGEISVFVKRIELLTPCLHMLPADHFGFKDQETRYRKRYLDLIM 240

Query: 240 NKDARSRFITRSKIITFIRKFLDERSFIEVETPMMNVIAGGATAKPFVTHHNDLNMDMFM 299
           NKD+R RFITRSKII +IRKFLD R FIEVETPMMNVIAGGATAKPFVTHHNDL+MDMFM
Sbjct: 241 NKDSRKRFITRSKIIKYIRKFLDNRDFIEVETPMMNVIAGGATAKPFVTHHNDLDMDMFM 300

Query: 300 RIAPELFLKQLVVGGMDRVYEIGRQFRNEGIDMTHNPEFTTCEFYQAYADVYDLMDMTEL 359
           RIAPELFLK+LVVGGMDRVYEIGRQFRNEGIDMTHNPEFTTCEFYQAYADVYDLMDMTEL
Sbjct: 301 RIAPELFLKELVVGGMDRVYEIGRQFRNEGIDMTHNPEFTTCEFYQAYADVYDLMDMTEL 360

Query: 360 LFSEMVKEITGSYVIKYHPNPQNPELEMELNFARPWKRINMIEELEKRFNVKFPAGDQLH 419
           LFSEMVKEI GSYVIKYHP+P NPE EMELNFARPWKRINMIEELEKRFNV FPAGDQLH
Sbjct: 361 LFSEMVKEINGSYVIKYHPDPNNPEKEMELNFARPWKRINMIEELEKRFNVTFPAGDQLH 420

Query: 420 TAETGEFLKNILTENKMECTPPLTNARMLDKLVGELEDTCINPTFIFGHPQMMSPLAKYS 479
           T ETGEFL+ +L +N +EC PP+TNARMLDKLVGELEDTCINPTFIFGHPQMMSPLAKYS
Sbjct: 421 TKETGEFLQKVLKDNNLECPPPITNARMLDKLVGELEDTCINPTFIFGHPQMMSPLAKYS 480

Query: 480 RDVPGLCERFEVFVATKEICNAYTELNDPFDQRARFEEQARQKDQGDDEVQLIDETFCNA 539
           RD PGLCERFEVFVATKEICNAYTELNDPFDQRARFEEQARQKDQGDDE QLIDETFCNA
Sbjct: 481 RDQPGLCERFEVFVATKEICNAYTELNDPFDQRARFEEQARQKDQGDDEAQLIDETFCNA 540

Query: 540 LEYGLPPTGGWGCGVDRLAMFLTDSNTIREVLLFPTLKPDVLKEEIKKD 588
           LEYGLPPTGGWGCG+DRLAMFLTDSNTIREVLLFPTLKPDVL++E+KK+
Sbjct: 541 LEYGLPPTGGWGCGIDRLAMFLTDSNTIREVLLFPTLKPDVLRDEVKKE 589

>YDR037W (KRS1) [890] chr4 (525435..527210) Lysyl-tRNA synthetase,
           cytoplasmic [1776 bp, 591 aa]
          Length = 591

 Score = 1074 bits (2778), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 511/588 (86%), Positives = 549/588 (93%)

Query: 1   MSQEEATKAATESVANLHLDEVTGEKVSKSELKKRIKQRQIEXXXXXXXXNAQPKPETKK 60
           MSQ++  KAA E VANLHLDE TGE VSKSELKKRIKQRQ+E         AQPKP +KK
Sbjct: 1   MSQQDNVKAAAEGVANLHLDEATGEMVSKSELKKRIKQRQVEAKKAAKKAAAQPKPASKK 60

Query: 61  KVDTFADLDPSQYFEARSRQIQELRKSHLPNPYPHKFHVSISLPDFLKKYENLKRGETLP 120
           K D FADLDPSQYFE RSRQIQELRK+H PNPYPHKFHVSIS P+FL KY +LK+GETLP
Sbjct: 61  KTDLFADLDPSQYFETRSRQIQELRKTHEPNPYPHKFHVSISNPEFLAKYAHLKKGETLP 120

Query: 121 NEKVSIAGRIHAKRESGSKLKFYVLHGDGVEVQVMSQLQDYHSEEAYEQDHGLLKRGDIV 180
            EKVSIAGRIHAKRESGSKLKFYVLHGDGVEVQ+MSQLQDY   ++YE+DH LLKRGDIV
Sbjct: 121 EEKVSIAGRIHAKRESGSKLKFYVLHGDGVEVQLMSQLQDYCDPDSYEKDHDLLKRGDIV 180

Query: 181 GVEGYVGRTQPKKGGEGEISVFVSRIELLTPCLHMLPADHFGFKDQETRYRKRYLDLIMN 240
           GVEGYVGRTQPKKGGEGE+SVFVSR++LLTPCLHMLPADHFGFKDQETRYRKRYLDLIMN
Sbjct: 181 GVEGYVGRTQPKKGGEGEVSVFVSRVQLLTPCLHMLPADHFGFKDQETRYRKRYLDLIMN 240

Query: 241 KDARSRFITRSKIITFIRKFLDERSFIEVETPMMNVIAGGATAKPFVTHHNDLNMDMFMR 300
           KDAR+RFITRS+II +IR+FLD+R FIEVETPMMNVIAGGATAKPF+THHNDL+MDM+MR
Sbjct: 241 KDARNRFITRSEIIRYIRRFLDQRKFIEVETPMMNVIAGGATAKPFITHHNDLDMDMYMR 300

Query: 301 IAPELFLKQLVVGGMDRVYEIGRQFRNEGIDMTHNPEFTTCEFYQAYADVYDLMDMTELL 360
           IAPELFLKQLVVGG+DRVYEIGRQFRNEGIDMTHNPEFTTCEFYQAYADVYDLMDMTEL+
Sbjct: 301 IAPELFLKQLVVGGLDRVYEIGRQFRNEGIDMTHNPEFTTCEFYQAYADVYDLMDMTELM 360

Query: 361 FSEMVKEITGSYVIKYHPNPQNPELEMELNFARPWKRINMIEELEKRFNVKFPAGDQLHT 420
           FSEMVKEITGSY+IKYHP+P +P  E+ELNF+RPWKRINMIEELEK FNVKFP+GDQLHT
Sbjct: 361 FSEMVKEITGSYIIKYHPDPADPAKELELNFSRPWKRINMIEELEKVFNVKFPSGDQLHT 420

Query: 421 AETGEFLKNILTENKMECTPPLTNARMLDKLVGELEDTCINPTFIFGHPQMMSPLAKYSR 480
           AETGEFLK IL +NK+EC PPLTNARMLDKLVGELEDTCINPTFIFGHPQMMSPLAKYSR
Sbjct: 421 AETGEFLKKILVDNKLECPPPLTNARMLDKLVGELEDTCINPTFIFGHPQMMSPLAKYSR 480

Query: 481 DVPGLCERFEVFVATKEICNAYTELNDPFDQRARFEEQARQKDQGDDEVQLIDETFCNAL 540
           D PGLCERFEVFVATKEICNAYTELNDPFDQRARFEEQARQKDQGDDE QL+DETFCNAL
Sbjct: 481 DQPGLCERFEVFVATKEICNAYTELNDPFDQRARFEEQARQKDQGDDEAQLVDETFCNAL 540

Query: 541 EYGLPPTGGWGCGVDRLAMFLTDSNTIREVLLFPTLKPDVLKEEIKKD 588
           EYGLPPTGGWGCG+DRLAMFLTDSNTIREVLLFPTLKPDVL+EE+KK+
Sbjct: 541 EYGLPPTGGWGCGIDRLAMFLTDSNTIREVLLFPTLKPDVLREEVKKE 588

>AGR037C [4347] [Homologous to ScYDR037W (KRS1) - SH]
           (775332..777101) [1770 bp, 589 aa]
          Length = 589

 Score = 1069 bits (2765), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 515/588 (87%), Positives = 547/588 (93%)

Query: 1   MSQEEATKAATESVANLHLDEVTGEKVSKSELKKRIKQRQIEXXXXXXXXNAQPKPETKK 60
           MS+E A +   E+VANLHLDEVTGE VSKSELKKRIKQRQ+E         ++PKPE KK
Sbjct: 1   MSEEAAVQQVAENVANLHLDEVTGEMVSKSELKKRIKQRQVEAKKAAKKATSKPKPEPKK 60

Query: 61  KVDTFADLDPSQYFEARSRQIQELRKSHLPNPYPHKFHVSISLPDFLKKYENLKRGETLP 120
           KV+  ADLDPS+YFEARSRQIQELRK+  PNPYPHKF+V+I LP FL KY +L+RGETLP
Sbjct: 61  KVENMADLDPSKYFEARSRQIQELRKTQEPNPYPHKFNVTIGLPAFLNKYAHLQRGETLP 120

Query: 121 NEKVSIAGRIHAKRESGSKLKFYVLHGDGVEVQVMSQLQDYHSEEAYEQDHGLLKRGDIV 180
            E+VSIAGRIHAKRESGSKL+FYVLH DGVEVQVMSQLQDYHSEEAYEQDHGLLKRGDIV
Sbjct: 121 EERVSIAGRIHAKRESGSKLRFYVLHADGVEVQVMSQLQDYHSEEAYEQDHGLLKRGDIV 180

Query: 181 GVEGYVGRTQPKKGGEGEISVFVSRIELLTPCLHMLPADHFGFKDQETRYRKRYLDLIMN 240
           GVEGYVGRTQPKKGGEGEISVFVSRI+LLTPCLHMLPADHFGFKDQETRYRKRYLDLIMN
Sbjct: 181 GVEGYVGRTQPKKGGEGEISVFVSRIQLLTPCLHMLPADHFGFKDQETRYRKRYLDLIMN 240

Query: 241 KDARSRFITRSKIITFIRKFLDERSFIEVETPMMNVIAGGATAKPFVTHHNDLNMDMFMR 300
           KDAR RFITRSKIIT+IRKFLD R FIEVETPMMNVIAGGATAKPFVTHHNDL+M M+MR
Sbjct: 241 KDARGRFITRSKIITYIRKFLDNRDFIEVETPMMNVIAGGATAKPFVTHHNDLDMQMYMR 300

Query: 301 IAPELFLKQLVVGGMDRVYEIGRQFRNEGIDMTHNPEFTTCEFYQAYADVYDLMDMTELL 360
           IAPELFLKQLVVGGMDRVYEIGRQFRNEGIDMTHNPEFTTCEFYQAYADVYDLMDMTELL
Sbjct: 301 IAPELFLKQLVVGGMDRVYEIGRQFRNEGIDMTHNPEFTTCEFYQAYADVYDLMDMTELL 360

Query: 361 FSEMVKEITGSYVIKYHPNPQNPELEMELNFARPWKRINMIEELEKRFNVKFPAGDQLHT 420
           FSEMVKEITG Y IK+HP+P +P  E ++NFARPWKRINMIEELEKRFNV FPAGDQLHT
Sbjct: 361 FSEMVKEITGDYKIKFHPDPNDPSKEYDINFARPWKRINMIEELEKRFNVTFPAGDQLHT 420

Query: 421 AETGEFLKNILTENKMECTPPLTNARMLDKLVGELEDTCINPTFIFGHPQMMSPLAKYSR 480
           AETGEFLK IL++NKM+C PPLTNARMLDKLVGELEDTCI+PTFIFGHPQMMSPLAK+SR
Sbjct: 421 AETGEFLKKILSDNKMDCPPPLTNARMLDKLVGELEDTCIDPTFIFGHPQMMSPLAKHSR 480

Query: 481 DVPGLCERFEVFVATKEICNAYTELNDPFDQRARFEEQARQKDQGDDEVQLIDETFCNAL 540
           D PGLCERFEVFVATKEICNAYTELNDPFDQRARFEEQARQKDQGDDE QLIDETFCNAL
Sbjct: 481 DQPGLCERFEVFVATKEICNAYTELNDPFDQRARFEEQARQKDQGDDEAQLIDETFCNAL 540

Query: 541 EYGLPPTGGWGCGVDRLAMFLTDSNTIREVLLFPTLKPDVLKEEIKKD 588
           EYGLPPTGGWGCGVDRLAMFLTDSNTIREVLLFPTLKPDVLKE++KK+
Sbjct: 541 EYGLPPTGGWGCGVDRLAMFLTDSNTIREVLLFPTLKPDVLKEDLKKE 588

>KLLA0F18392g 1693928..1695694 highly similar to sp|P15180
           Saccharomyces cerevisiae YDR037w KRS1 lysyl-tRNA
           synthetase, cytosolic, start by similarity
          Length = 588

 Score = 1042 bits (2694), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 502/586 (85%), Positives = 537/586 (91%), Gaps = 2/586 (0%)

Query: 1   MSQEEATKAATESVANLHLDEVTGEKVSKSELKKRIKQRQIEXXXXXXXXNAQPKPETKK 60
           MSQ     AATE+VAN+HLDE+TGE VSKSELKKRIKQRQ+E         A+P PE KK
Sbjct: 1   MSQPHEVAAATEAVANMHLDELTGEMVSKSELKKRIKQRQVEAKKAAKKATAKPTPEPKK 60

Query: 61  KVDT--FADLDPSQYFEARSRQIQELRKSHLPNPYPHKFHVSISLPDFLKKYENLKRGET 118
           K +T  FADLDPSQYFEARSRQI ELRK+H PNPYPHKF VS++LP+FL KY NLKRGET
Sbjct: 61  KANTDAFADLDPSQYFEARSRQINELRKTHSPNPYPHKFQVSVTLPEFLSKYANLKRGET 120

Query: 119 LPNEKVSIAGRIHAKRESGSKLKFYVLHGDGVEVQVMSQLQDYHSEEAYEQDHGLLKRGD 178
           LP EKVSIAGRIHAKRESGSKLKFYVLHGDGVEVQVMSQLQDYH+E +YE DH L+KRGD
Sbjct: 121 LPEEKVSIAGRIHAKRESGSKLKFYVLHGDGVEVQVMSQLQDYHTESSYEDDHSLIKRGD 180

Query: 179 IVGVEGYVGRTQPKKGGEGEISVFVSRIELLTPCLHMLPADHFGFKDQETRYRKRYLDLI 238
           IVGVEGYVGRT PKKGGEGEISVFVSRI+LLTPCLHMLP DHFGFKDQE RYRKRYLDLI
Sbjct: 181 IVGVEGYVGRTSPKKGGEGEISVFVSRIQLLTPCLHMLPTDHFGFKDQELRYRKRYLDLI 240

Query: 239 MNKDARSRFITRSKIITFIRKFLDERSFIEVETPMMNVIAGGATAKPFVTHHNDLNMDMF 298
           MNKDAR+RFITRSKII+++RKFLD R+FIEVETPMMNVIAGGATAKPFVTHHNDL+MDM+
Sbjct: 241 MNKDARNRFITRSKIISYVRKFLDTRNFIEVETPMMNVIAGGATAKPFVTHHNDLDMDMY 300

Query: 299 MRIAPELFLKQLVVGGMDRVYEIGRQFRNEGIDMTHNPEFTTCEFYQAYADVYDLMDMTE 358
           MRIAPELFLK+LVVGGMDRVYEIGRQFRNEGIDMTHNPEFTTCEFYQAYADVYDLMDMTE
Sbjct: 301 MRIAPELFLKELVVGGMDRVYEIGRQFRNEGIDMTHNPEFTTCEFYQAYADVYDLMDMTE 360

Query: 359 LLFSEMVKEITGSYVIKYHPNPQNPELEMELNFARPWKRINMIEELEKRFNVKFPAGDQL 418
           ++ SEMVKEITGSYVIKYHP+P +   E+ELNF RPWKRINMIEELE RF+V FPAGDQL
Sbjct: 361 IMISEMVKEITGSYVIKYHPDPNDETKELELNFTRPWKRINMIEELENRFHVTFPAGDQL 420

Query: 419 HTAETGEFLKNILTENKMECTPPLTNARMLDKLVGELEDTCINPTFIFGHPQMMSPLAKY 478
           HTAETGEFLK +L +NKM+C PPLTNARMLDKLVGELEDTCINPTFIFGHPQMMSPLAKY
Sbjct: 421 HTAETGEFLKKVLKDNKMDCAPPLTNARMLDKLVGELEDTCINPTFIFGHPQMMSPLAKY 480

Query: 479 SRDVPGLCERFEVFVATKEICNAYTELNDPFDQRARFEEQARQKDQGDDEVQLIDETFCN 538
           SRD PGLCERFEVFVATKEICNAYTELNDPFDQRARFEEQA QK QGDDE QL+DETFCN
Sbjct: 481 SRDQPGLCERFEVFVATKEICNAYTELNDPFDQRARFEEQANQKAQGDDEAQLVDETFCN 540

Query: 539 ALEYGLPPTGGWGCGVDRLAMFLTDSNTIREVLLFPTLKPDVLKEE 584
           ALEYGLPPTGGWGCG+DRLAMFL DSNTIREVLLFPTLKP+V+KEE
Sbjct: 541 ALEYGLPPTGGWGCGIDRLAMFLADSNTIREVLLFPTLKPEVVKEE 586

>CAGL0J10230g complement(998449..1000080) similar to sp|P32048
           Saccharomyces cerevisiae YNL073w MSK1, hypothetical
           start
          Length = 543

 Score =  263 bits (672), Expect = 1e-80,   Method: Compositional matrix adjust.
 Identities = 181/512 (35%), Positives = 282/512 (55%), Gaps = 32/512 (6%)

Query: 83  ELRKSHLPNPYPHKFHVS----ISLPDFLKKYENLKRGE-TLPNEKVSIAGRIHAKRESG 137
           EL  S L   YP    +     +S+  FLKKY +    +    N+K+S+ GRI + R SG
Sbjct: 40  ELVLSSLDRYYPSMSSIERGNLVSIDIFLKKYGSTSEDQLNKINQKISLCGRIKSIRFSG 99

Query: 138 SKLKFYVLHGDGVE-VQVMSQLQDYHSEEAYEQDHGLLKRGDIVGVEGYVGRTQPKKGGE 196
            K+ F  L  DG+  +Q++   ++  +   +E +   L++GD V   G     +  K   
Sbjct: 100 KKMAFIDLV-DGIHGIQLILNCREIGNSATFESELSFLRKGDYVMTTGL---PRLSKSRM 155

Query: 197 GEISVFVSRIELLTPCLHM-LPADHFGFKDQETRYRKRYLDLIMNKDARSRFITRSKIIT 255
             IS+  + +  +     M LP       D       + +D  +N     R   RS I+ 
Sbjct: 156 KNISLRCTDLPKILSVAQMPLPPKLI---DTVKSNSNKVVDYQINGFQNIRI--RSSILK 210

Query: 256 FIRKFLDERSFIEVETPMMNVIAGGATAKPFVTHHNDLNMDMFMRIAPELFLKQLVVGGM 315
            IR FL+ER FIEVETP+++  + GA AKPF++   D +  + +R+APEL+LK+L++ G 
Sbjct: 211 SIRNFLEERDFIEVETPILSSKSNGAVAKPFMSSSKDFD-KLMLRVAPELWLKRLIISGC 269

Query: 316 DRVYEIGRQFRNEGIDMTHNPEFTTCEFYQAYADVYDLMDMTELLFSEMVKEITGSYVIK 375
           ++V+EIG+ FRNEGID +HNPEFTT EFYQ+Y  + DL+ + E LF +++ ++T +  IK
Sbjct: 270 NKVFEIGKSFRNEGIDGSHNPEFTTLEFYQSYLTMEDLIKLNEDLFKKIITDLTNNLTIK 329

Query: 376 YHPNPQNPELEMELNFARPW--KRINMIEELEKRFNVKFPAGDQLHTAETGEFLKNILTE 433
            +      ELE  L  +  W  KR+  +  L K   V      Q+   ++ + L+ I  +
Sbjct: 330 QYLPESLLELEDILK-SNNWKFKRVEFLPTLSKELGVDL---SQVKIEDSKQLLEVIPQK 385

Query: 434 NKMEC---TPPLTNARMLDKLVGEL--EDTC--INPTFIFGHPQMMSPLAKYSRDVPGLC 486
            K +    +   +++++L++L  EL  E  C   +PT I+ HP ++SPLAK + D     
Sbjct: 386 YKGQFFGKSSSYSSSQILNRLCSELIEEKYCNSSHPTIIYHHPAVISPLAKSNPDDSRTT 445

Query: 487 ERFEVFVATKEICNAYTELNDPFDQRARFEEQARQK-DQGD-DEVQLIDETFCNALEYGL 544
           +RFE+F+  +E  NAY E N P  Q  +FE+QAR K D GD D +  ID+ + NA+++G+
Sbjct: 446 KRFELFIKGREYSNAYEEENCPQVQLEKFEQQARMKEDYGDNDTLSSIDQEYINAMKWGM 505

Query: 545 PPTGGWGCGVDRLAMFLTDSNTIREVLLFPTL 576
           PP GG+G G+DRL M +T    I +VL F TL
Sbjct: 506 PPIGGFGLGIDRLCMLITGCQRIEQVLPFGTL 537

>Scas_633.28
          Length = 592

 Score =  261 bits (668), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 183/502 (36%), Positives = 277/502 (55%), Gaps = 35/502 (6%)

Query: 95  HKFHVSISLPDFLKKYE-NLKR--GETLPNEKVSIAGRIHAKRESGSKLKFYVLHGD--G 149
           H  +  I++  FL  +E N +R  GE      + + GRI   R SG K+ F  L      
Sbjct: 94  HDNYKQITVKKFLDTFEKNPQRLNGEDDYKSFLQLNGRIKNIRYSGKKIAFIDLFDSRYN 153

Query: 150 VEVQV---MSQLQDYHSEEAYEQDHGLLKRGDIVGVEGYVGRTQPKKGGEGEISVFVSRI 206
           V++QV   +++L+   SEE +++   LLK+GD +   G  G ++ +      +S+  +++
Sbjct: 154 VKIQVILNLNKLKQETSEERFQEVVQLLKKGDYIKAFGIPGFSESRSHT---LSLKGTKL 210

Query: 207 E-LLTPCLHMLPADHFGFKDQETRYRKRYLDLIMNKDARSRFITRSKIITFIRKFLDERS 265
             LL+   + LP+     KD+    + R LD  +N    S  + RS II  +R FLD++ 
Sbjct: 211 PVLLSAAQYPLPSQ---LKDELKARKNRVLDYQVN--GVSSLLLRSNIIRLLRSFLDKQE 265

Query: 266 FIEVETPMMNVIAGGATAKPFVTHHNDLNMDMFMRIAPELFLKQLVVGGMDRVYEIGRQF 325
           FIEVETP+++  + GA A+PF+T    LN ++ +RIAPEL+LK+L++ G+DRVYEIG+ F
Sbjct: 266 FIEVETPILSSKSNGANARPFITKSGSLNENLELRIAPELWLKRLIISGLDRVYEIGKVF 325

Query: 326 RNEGIDMTHNPEFTTCEFYQAYADVYDLMDMTELLFSEMVK--EITGSYVIKYHPNPQNP 383
           RNEG+D THNPEFT  EFY+ Y  + DL++ +E LF  ++   E+  S   +YH +P   
Sbjct: 326 RNEGVDSTHNPEFTLLEFYERYLSMTDLIEKSEDLFKHILVNLELKKS---EYHFSPAFD 382

Query: 384 ELEMELNFARPWK--RINMIEELEKRFNVKFPAGDQLHTAETGEFLKNILTENKMECTPP 441
            L   L  A  WK  RI  +  L +  N+ F   D     +  E L     +   E  PP
Sbjct: 383 NLYRTLEQAN-WKFRRIEFLPTLSQELNIDFSLIDLNDAEKLLESLPAHSRKELFENVPP 441

Query: 442 --LTNARMLDKLVGELEDT----CINPTFIFGHPQMMSPLAKYSRDVPGLCERFEVFVAT 495
             L++ ++L+KL     ++     I+PT IF HP+++SPLAK       + +RFE+F+  
Sbjct: 442 GELSSQQILNKLCSFYLESRYCDTIHPTIIFHHPRIISPLAKAHPSNQQITKRFEMFING 501

Query: 496 KEICNAYTELNDPFDQRARFEEQARQ----KDQGDDEVQLIDETFCNALEYGLPPTGGWG 551
           KE  NAY E N P  Q   F+ Q       K++ +DE+   DE F NA++ G+PP GG+G
Sbjct: 502 KEYINAYEEENCPQLQEKNFQLQQFSKETIKNKENDELISPDEGFINAMKSGMPPVGGFG 561

Query: 552 CGVDRLAMFLTDSNTIREVLLF 573
            GVDRL M L +   I +VL F
Sbjct: 562 LGVDRLCMLLMNKGRIEDVLPF 583

>KLLA0F04796g complement(466476..468029) similar to sp|P32048
           Saccharomyces cerevisiae YNL073w MSK1 lysyl-tRNA
           synthetase, mitochondrial, hypothetical start
          Length = 517

 Score =  254 bits (648), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 174/501 (34%), Positives = 271/501 (54%), Gaps = 43/501 (8%)

Query: 87  SHLPNPYPHKFHVSISLPDFLKKYENLKRGETLPNEKVSIAGRIHAKRESGSKLKFYVLH 146
           S++P P       +I +  F+K+Y+ LK  +       ++ G+I   R SG K+ F  L 
Sbjct: 43  SNIPKP-------TIDVSRFIKEYDGLKVDDRSTTH--TLRGKITNMRFSGKKIGFINLL 93

Query: 147 GDGVEVQVMSQLQDYHSEEAYEQDHGL-LKRGDIVGVEGYVGRTQPKKGGEGEISVFV-S 204
            D   +QV+  L +        Q H    K GD + V G+ G +Q     +G +S+ V S
Sbjct: 94  NDEKSLQVIVNLSNLPMSVGEFQAHMRKFKIGDHIQVTGFPGVSQK----QGTLSLKVNS 149

Query: 205 RIELLTPCLHMLPADHFGFKDQETRYRKRYLDLIMNKDARSRFITRSKIITFIRKFLDER 264
            +++L+P    +P       D   R   + LD ++N         R  +   IR++L ++
Sbjct: 150 ELKMLSPAQIPIPPKLL---DSSKRNSNKTLDYLVN--GTEAIYIRHLVTKRIREWLYKQ 204

Query: 265 SFIEVETPMMNVIAGGATAKPFVTHHNDLNMD--MFMRIAPELFLKQLVVGGMDRVYEIG 322
            FIEVETP+++  + GA AKPF+TH   ++ +    +RIAPEL+LK+L +GGM++++EIG
Sbjct: 205 EFIEVETPIISSKSNGANAKPFITHCTAIDKEQPFELRIAPELWLKRLCIGGMNKIFEIG 264

Query: 323 RQFRNEGIDMTHNPEFTTCEFYQAYADVYDLMDMTELLFSEMVKEITGSYVIKYHPNPQN 382
           + FRNEGID THNPEFTT EFYQ Y ++  L++M+E L           YV +    P+ 
Sbjct: 265 KVFRNEGIDSTHNPEFTTLEFYQCYINMEQLIEMSESLL---------IYVCQGIDKPKA 315

Query: 383 PEL--EMELNFARPWKRINMIEELEKRFNVKFPAGDQLHTAETGEFLKNILTENKMECT- 439
            EL  +++ N  + +KR+  +  L ++  + F   D        E LK  L +  +  + 
Sbjct: 316 QELLDQIKANNGK-FKRLEFLPTLTQKTGIDFDNMD----LNNAELLKEKLRKANISISE 370

Query: 440 PPLTNARMLDKLVGE-LEDTC--INPTFIFGHPQMMSPLAKYSRDVPGLCERFEVFVATK 496
             ++  ++LD+L G+ +E  C  + PT I+ HP ++SPLAK   +   + +RFE+F+  K
Sbjct: 371 SSVSPQQILDELCGKYIESQCDTLLPTIIYHHPTVLSPLAKTDSNNVQITKRFEIFINRK 430

Query: 497 EICNAYTELNDPFDQRARFEEQARQKDQ-GDDEVQLIDETFCNALEYGLPPTGGWGCGVD 555
           E  NAY E N P  Q  +F  Q   K Q  DDE+  +D  +  A++YG+PP GG+G G+D
Sbjct: 431 EYMNAYEEENCPDLQLEKFTNQLASKTQFKDDEMMAVDLPYVQAMKYGMPPIGGFGLGID 490

Query: 556 RLAMFLTDSNTIREVLLFPTL 576
           RL M L D+  I EVL F TL
Sbjct: 491 RLCMLLADTQRIEEVLSFGTL 511

>Kwal_23.4717
          Length = 527

 Score =  245 bits (626), Expect = 6e-74,   Method: Compositional matrix adjust.
 Identities = 171/503 (33%), Positives = 270/503 (53%), Gaps = 42/503 (8%)

Query: 93  YPHKFHVS---ISLPDFLKKYENLKRGETLPNEKVSIAGRIHAKRESGSKLKFYVLHGDG 149
           YP    +S    ++ +F +KY+ L   E  P     +  RI + R SG  + F  +    
Sbjct: 42  YPSLSKISPATTTVSEFKQKYQALH--EDQPQSSEVLRARIDSVRISGKNMCFVDVSNAR 99

Query: 150 VEVQVM--------SQLQDYHSEEAYEQDHGLLKRGDIVGVEGYVGRTQPKKGGEGEISV 201
             VQ++        +      + E + Q    L+ GD +   G+ G +Q     E  +S+
Sbjct: 100 NSVQLILNYNVMKTAMPSSALTREQFFQHVQDLRPGDHIQACGFPGLSQ----RERTLSL 155

Query: 202 FVSRI-ELLTPCLHMLPADHFGFKDQETRYRKRYLDLIMNKDARSRFITRSKIITFIRKF 260
             +++ E+L P L  +P       D   R   R LD ++N       + R ++ T IR+F
Sbjct: 156 KCTKLTEILAPALLAVPPK---LTDPAKRNTNRVLDYLVN--GHETLVVRHQVNTAIREF 210

Query: 261 LDERSFIEVETPMMNVIAGGATAKPFVTHHNDLNMDMFMRIAPELFLKQLVVGGMDRVYE 320
           L+ R F+EVETP+++  A GA A+PF T     N ++ +R+APEL+LK+LVV G++RVYE
Sbjct: 211 LNMRGFLEVETPVLSSKANGAAAEPFSTRTKATNAELELRVAPELWLKRLVVAGVNRVYE 270

Query: 321 IGRQFRNEGIDMTHNPEFTTCEFYQAYADVYDLMDMTELLFSEMVKEITGSYVIKYHPNP 380
           +G+ FRNEG+D THNPEFTT EFYQ+YA + +L++++E L+  ++  +   +        
Sbjct: 271 LGKVFRNEGVDATHNPEFTTLEFYQSYASMDELIELSEQLYLHVLNRVDNRFA------- 323

Query: 381 QNPELEME-LNFARPWKRINMIEELEKRFNVKFPAGDQLHTAETGEFLKNILTENKMECT 439
              EL+ E L  A  +KR+  +  L +   V F   D LH ++     + ++ +N    T
Sbjct: 324 --RELKNELLANAGKFKRVEFLPTLLRETGVDFTQID-LHNSDL--ISRALIAKNIHMDT 378

Query: 440 PPLTNARMLDKLVGELEDT--CIN--PTFIFGHPQMMSPLAKYSRDVPGL-CERFEVFVA 494
              +  ++LD L G   +   C +  PT I+ HP +MSPLAK + D   L  +RFEVF+ 
Sbjct: 379 TGKSPQQILDMLCGRFIENKYCTSSLPTVIYHHPTVMSPLAKGNPDDNMLTTKRFEVFIN 438

Query: 495 TKEICNAYTELNDPFDQRARFE-EQARQKDQGDDEVQLIDETFCNALEYGLPPTGGWGCG 553
            KE  NAY E N P +Q  +FE +++ Q+  GD E   +D ++  A+++G+PP GG+G G
Sbjct: 439 GKEYINAYEEENCPQEQLQKFELQKSAQETYGDRESLAVDYSYVEAMKWGMPPIGGFGLG 498

Query: 554 VDRLAMFLTDSNTIREVLLFPTL 576
           +DRL M LT +  I  VL F T+
Sbjct: 499 IDRLCMLLTGNKRIERVLSFGTI 521

>YNL073W (MSK1) [4517] chr14 (488385..490115) Lysyl-tRNA synthetase,
           mitochondrial [1731 bp, 576 aa]
          Length = 576

 Score =  225 bits (573), Expect = 8e-66,   Method: Compositional matrix adjust.
 Identities = 157/482 (32%), Positives = 248/482 (51%), Gaps = 39/482 (8%)

Query: 120 PNEKVSIAGRIHAKRESGSKLKFYVLHGDGVEVQVMSQLQ---DYHSEEAYEQDHG---- 172
           PN  +SI GRI + R SG K+ F  L+     ++  +QLQ   +Y+      +D      
Sbjct: 97  PNLLLSINGRIKSIRFSGQKIVFIDLYNGSSGLKNDTQLQLIVNYNKIGGSSEDKANFSE 156

Query: 173 ---LLKRGDIVGVEGYVGRTQPKKGGEGEISVFVSRIELLTPCLHM-LPADHFGFKDQET 228
               LK+GD +   GY G +Q +      +S+  +++ ++     + LP+      D+  
Sbjct: 157 YMNFLKKGDYIKALGYPGFSQSR---VKMLSLICNKLPIVLSVSQLPLPSR---LNDETK 210

Query: 229 RYRKRYLDLIMNKDARSRFITRSKIITFIRKFLDERSFIEVETPMMNVIAGGATAKPFVT 288
               R +D  +N       + R++II  +RKFLD+R+F+EVETP+++  + GA AKPF+T
Sbjct: 211 IKSNRVVDYQLN--GTQTLLVRARIIKLLRKFLDDRNFVEVETPILSSKSNGAMAKPFIT 268

Query: 289 HHNDLNMDMFMRIAPELFLKQLVVGGMDRVYEIGRQFRNEGIDMTHNPEFTTCEFYQAYA 348
              D +  + +RIAPEL+LK+L++ G+ +VYEIG+ FRNEGID THN EF+T EFY+ Y 
Sbjct: 269 SSKDFD-HLELRIAPELWLKRLIISGLQKVYEIGKVFRNEGIDSTHNAEFSTLEFYETYM 327

Query: 349 DVYDLMDMTELLFSEMVKEITGSYVIKYHPNPQN-PELEMELNFARPWK--RINMIEELE 405
            + D++  TE LF  ++  +   +     P P+   EL + L+    WK  ++  +  L 
Sbjct: 328 SMDDIVTRTEDLFKFLITNLQKFFQDTRLPVPKTFSELHLALS-ENNWKFRKVEFLPTLN 386

Query: 406 KRFNVKFPAGDQLHTAETGEFLKNILTENKMECTPPLTNARMLDKL--VGELEDTCIN-- 461
           K   +       L   +  E LK +  +   +  P   N   L  L  + +L D  +   
Sbjct: 387 KELGIDL-MNSGLDINKPSELLKALPKDIAKKYFPSADNTGQLSSLQILNKLSDVFLEQR 445

Query: 462 ------PTFIFGHPQMMSPLAKYSRDVPGLCERFEVFVATKEICNAYTELNDPFDQRARF 515
                 PT I+  P ++SPLAK       + +RFEVF+  KE  NAY E N P  Q  +F
Sbjct: 446 HCQSTLPTVIYHQPAILSPLAKTDPQNKQVTKRFEVFIKGKEYINAYEEENCPQLQLQKF 505

Query: 516 EEQARQKDQGDDEVQ----LIDETFCNALEYGLPPTGGWGCGVDRLAMFLTDSNTIREVL 571
            +Q +  +   ++ +    +ID  +   ++YG+PP GG+G G+DRL M   D   I EVL
Sbjct: 506 LQQKQINELTGNKTETLSPVIDYQYVETMKYGMPPVGGFGLGIDRLCMLFCDKKRIEEVL 565

Query: 572 LF 573
            F
Sbjct: 566 PF 567

>AER362W [2863] [Homologous to ScYNL073W (MSK1) - SH]
           complement(1309431..1311008) [1578 bp, 525 aa]
          Length = 525

 Score =  223 bits (567), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 164/504 (32%), Positives = 244/504 (48%), Gaps = 48/504 (9%)

Query: 87  SHLPNPYPHKFHVSISLPDFLKKYENLKRGETLPNEKVSIAGRIHAKRESGSKLKFYVLH 146
           S +P P       + S+ +F  +Y   K     P     I G+I   R  G  + F  L 
Sbjct: 50  SSVPRP-------TASIAEFNNRYVG-KLSNDEPERTYVINGQIRGIRVVGRSMCFVDLQ 101

Query: 147 GDGVEVQVMSQLQDYHSE----EAYEQDHGLLKRGDIVGVEGYVGRTQPKKGGEGEISVF 202
             G  +Q+M       ++      ++     L+ GD V   G+ G ++ ++     +S+ 
Sbjct: 102 QQGSALQLMVNHSLVRAQLVAKRPFQNAIAGLRLGDHVQPTGFPGLSKTER----TLSLK 157

Query: 203 VSRIELLTPCLHMLPADHFG----FKDQETRYRKRYLDLIMNKDARSRFITRSKIITFIR 258
             ++        ML A          D+  R + R LD ++N      F  R K +T +R
Sbjct: 158 CRKVP------RMLAAAQIAIPQRLTDRVKRQQNRTLDYLVNGLKVLEF--RHKALTALR 209

Query: 259 KFLDERSFIEVETPMMNVIAGGATAKPFVTHHNDLNMDMF-MRIAPELFLKQLVVGGMDR 317
            +L+ R F+EVETPM++  + GA A PFVTH    +     +RIAPEL+LK+L VGG  R
Sbjct: 210 AYLNRRGFLEVETPMLSAKSSGANATPFVTHLRGQDKQALELRIAPELWLKRLCVGGAQR 269

Query: 318 VYEIGRQFRNEGIDMTHNPEFTTCEFYQAYADVYDLMDMTELLFSEMVKEITGSYVIKYH 377
           VYEIG+ FRNEGID THNPEFTT E YQ YA + +L+++ ++L  ++   +         
Sbjct: 270 VYEIGKVFRNEGIDATHNPEFTTLELYQCYAPLDELLELAQVLLRDICVAVD-------T 322

Query: 378 PNPQNPELEMELNFARPWKRINMIEELEKRFNVKFPAGDQLHTAETGEFLKNILTENKME 437
           P  +    EM  N    ++R+  +  L +   V + A D   +      L     +    
Sbjct: 323 PVSRQLLAEMAQN-GGAFRRVEFLPTLSRETGVDWAAVDLADSTAIRVALSGAGIDVPES 381

Query: 438 CTPPLTNARMLDKLVGE-LED---TCINPTFIFGHPQMMSPLAKYSRDVPGLCERFEVFV 493
              P    ++L+KL  + +ED     + PT I  HP +MSPLAK +  V     RFE+FV
Sbjct: 382 IVSP---QQILNKLCADYIEDRYCQSLLPTAILHHPAVMSPLAKSAGLVA---NRFELFV 435

Query: 494 ATKEICNAYTELNDPFDQRARFEEQARQKDQ-GDDEVQLIDETFCNALEYGLPPTGGWGC 552
             +E+ NAY E N P +Q  + + Q R ++Q  D E   ID  +  A++YG+PP GG G 
Sbjct: 436 CGRELINAYEEENCPQEQLKKMQLQQRHREQFHDQESMQIDHHYIEAMKYGMPPIGGLGL 495

Query: 553 GVDRLAMFLTDSNTIREVLLFPTL 576
           G+DRL M L     I EVL F  L
Sbjct: 496 GIDRLCMLLLAKARIEEVLPFGCL 519

>CAGL0D06556g 623770..625431 highly similar to sp|P04802
           Saccharomyces cerevisiae YLL018c DPS1, start by
           similarity
          Length = 553

 Score = 93.6 bits (231), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 144/600 (24%), Positives = 247/600 (41%), Gaps = 81/600 (13%)

Query: 1   MSQEEATKAATESVANLHLDEVTGEKVSKSELKKRIKQRQIEXXXXXXXXNAQPKPETKK 60
           MS EEA  A+ E+   + L E  G+ +SK  LKK   Q++ E         AQ + E K+
Sbjct: 1   MSAEEAKAASPEAPKEVILGE-DGQPLSKKALKKL--QKEQEKQKRKQERAAQLEAEQKE 57

Query: 61  KVDTFADLDPSQYFEARSRQIQELRKSHLPNPYPHKFHVSISLPDFLKKYENLKRGETLP 120
           +             +A++ ++    +++ P P+           +   K+E+L + +   
Sbjct: 58  RE------------QAKANEVDHSAENYGPAPF---VQSQFRTGEKRVKFEDLSKEDA-- 100

Query: 121 NEKVSIAGRIHAKRESGSKLKFYVLHGDGVEVQVMSQLQDYHSEEAYE---QDHGLLKRG 177
           +++V    R+H  R+ G+ L F  L      +Q + +  D   E+  +   +  G L   
Sbjct: 101 DKEVLFRARVHNTRQQGATLAFLTLRQQSSLIQALVK-ADKAGEKISKNMVKWAGSLNLE 159

Query: 178 DIVGVEGYVGRT-QPKKGGE-GEISVFVSRIELLTPCLHMLP------------ADHFGF 223
            IV V G V    +P K     ++ + V++I  ++     LP            A+  G 
Sbjct: 160 SIVLVRGIVKVVDEPIKSATIQDLEIHVTQIHTISETPETLPILIEDASRSEAEAEAAGL 219

Query: 224 K--DQETRYRKRYLDL--IMNKDARSRFITRSKIITFIRKFLDERSFIEVETPMMNVIAG 279
              + +TR   R +DL  + N+   + F  +  +    R+FL  + F+EV TP M   A 
Sbjct: 220 PVVNLDTRLDNRVIDLRTVTNQ---AIFRIQHGVCALFREFLANKKFVEVHTPKMLGAAS 276

Query: 280 GATAKPF-VTHHNDLNMDMFMRIAPELFLKQLVVGGMDRVYEIGRQFRNEGIDM-THNPE 337
              A  F VT+        ++  +P+   +QL+V   ++V+EIG  FR E  +   H  E
Sbjct: 277 EGGANVFEVTY---FKGKAYLAQSPQFNKQQLIVADFEKVFEIGPVFRAENSNTHRHMTE 333

Query: 338 FTTCEFYQAYADVY-DLMDMTELLFSEMVKEITGSYVIKYH-PNPQNPELEMELNFARPW 395
           FT  +   A+ + Y +++D+   LF  +  E+   Y  +      Q P  E +L      
Sbjct: 334 FTGLDMEMAFEEHYHEVLDVLSELFVFLFTELKKRYAKEIELVRKQYPVEEFKLPKDGKM 393

Query: 396 KRINMIEELEKRFNVKFPAGD-QLHTAETGEFLKNILTENKMECTPPLTNARMLDKLVGE 454
            RI   E ++         GD +  + E  +FL  ++ E         T+  +LDK   E
Sbjct: 394 VRITYKEGIQMLKEAGKDIGDFEDLSTENEKFLGKLVREKYD------TDFYILDKFPLE 447

Query: 455 LEDTCINPTFIFGHPQMMSPLAKYSRDVPGLCERFEVFVATKEICNAYTELNDPFDQRAR 514
                I P +    P+            P     ++ F+  +EI +    ++D    +  
Sbjct: 448 -----IRPFYTMPDPED-----------PRYSNSYDFFMRGEEILSGAQRIHD---HKML 488

Query: 515 FEEQARQKDQGDDEVQLIDETFCNALEYGLPPTGGWGCGVDRLAMFLTDSNTIREVLLFP 574
            E   R K  G D      + +C+   YG PP  G G G++R+ MF  D   IR   LFP
Sbjct: 489 ME---RMKVHGLDPEDPGLKDYCDGFSYGCPPHAGGGIGLERVVMFFLDLKNIRRASLFP 545

>ADL039C [1702] [Homologous to ScYLL018C (DPS1) - SH]
           (620628..622298) [1671 bp, 556 aa]
          Length = 556

 Score = 88.6 bits (218), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 114/487 (23%), Positives = 195/487 (40%), Gaps = 76/487 (15%)

Query: 121 NEKVSIAGRIHAKRESGSKLKFYVLHGDGVEVQVMSQLQDYHS-EEAYEQDHGLLKRGDI 179
            ++V +  R+H  R+ G+ L F +L      +Q + +     +  +   +  G L    I
Sbjct: 105 GKEVLLRSRVHTVRQQGATLAFLMLRQRSSLIQALVKANAEGTVSKQMVKWAGSLNLESI 164

Query: 180 VGVEGYVGRTQP--KKGGEGEISVFVSRIELLTPCLHMLP------------ADHFGFK- 224
           V V G V + +   K     +  + ++++  ++     LP            A+  G   
Sbjct: 165 VLVRGVVRKVEEPVKSATVQDFEIQITQLHTISETPQQLPILIEDASRSEAEAEAAGLPV 224

Query: 225 -DQETRYRKRYLDL--IMNKDARSRFITRSKIITFIRKFLDERSFIEVETPMMNVIAGGA 281
            + +TR   R +DL  + N+   + F  ++ +    R+F   R+F E+ TP +       
Sbjct: 225 VNLDTRLDARVIDLRTVTNQ---AIFRIKAGVCGLFREFFQSRNFTEIHTPKLLASPSEG 281

Query: 282 TAKPFVTHHNDLNMDMFMRIAPELFLKQLVVGGMDRVYEIGRQFRNEGIDM-THNPEFTT 340
            A  F   +     + ++  +P+ + +QL+    +RV+E+   FR E  +   H  EFT 
Sbjct: 282 GANVFEVKY--FKGNAYLAQSPQFYKQQLIAADFERVFEVAPVFRAENSNTHRHMTEFTG 339

Query: 341 CE----FYQAYADVYDLM-DMTELLFSEMVKEITGSYVIKYHPNPQNPELEMELNFARPW 395
            +    F + Y +V ++M +M   +F+E+ K                        FAR  
Sbjct: 340 VDLEMAFEEHYHEVIEVMGEMFMFVFTELKK-----------------------RFARE- 375

Query: 396 KRINMIEELEKRFNV---KFPAGDQ---LHTAETGEFLKNILTENKMECTPPLTNARMLD 449
                I ++ K++ V   KFPA  +   LH  E    L+    E          N R L 
Sbjct: 376 -----IAQVRKQYPVEEFKFPADGKMVILHYKEGIAMLREAGKEIGDFDDLSTENERFLG 430

Query: 450 KLVGELEDTCINPTFIFGHPQMMSPLAKYSRDV-PGLCERFEVFVATKEICNAYTELNDP 508
           KLV E  DT       F  P  + P         P     ++ F+  +EI +    ++DP
Sbjct: 431 KLVREKYDTDFYILDKF--PAELRPFYTMPDPADPRYSNSYDFFMRGEEIMSGAQRIHDP 488

Query: 509 FDQRARFEEQARQ-KDQGDDEVQLIDETFCNALEYGLPPTGGWGCGVDRLAMFLTDSNTI 567
              R R +    Q +D G  +       +C+A  YG PP  G G G++R+ MF  D   I
Sbjct: 489 ELLRERMKHHGLQPEDAGFKD-------YCDAFTYGCPPHAGGGIGLERIVMFYLDLKNI 541

Query: 568 REVLLFP 574
           R   LFP
Sbjct: 542 RRATLFP 548

>Scas_347.3
          Length = 552

 Score = 85.5 bits (210), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 117/495 (23%), Positives = 201/495 (40%), Gaps = 69/495 (13%)

Query: 109 KYENLKRGETLPNEKVSIAGRIHAKRESGSKLKFYVLHGDGVEVQVMSQLQ-DYHSEEAY 167
           K+E+L    T   ++V    R+H  R+ G+ L F         +Q + ++Q D    +  
Sbjct: 90  KFESLNPA-TDDGKEVVFRARVHNTRQQGATLSFLTFRQQHDLIQGLVKVQKDGSVSKQM 148

Query: 168 EQDHGLLKRGDIVGVEGYVGRTQP--KKGGEGEISVFVSRIELLTPCLHMLP-------- 217
            +  G L    IV V+G V R +   K     ++ + ++ I  ++     LP        
Sbjct: 149 VKWAGSLNLESIVVVKGIVKRVEEPIKSATVQDLEIHITDIHSISETPETLPILLEDASR 208

Query: 218 ----ADHFGFK--DQETRYRKRYLDL--IMNKDARSRFITRSKIITFIRKFLDERSFIEV 269
               A+  G    + +TR   R +DL  + N+   + F  +S +    R++L    F EV
Sbjct: 209 SEAEAEAAGLPVVNLDTRLDARVIDLRTVTNQ---AIFKIQSGVCQLFREYLSGLKFTEV 265

Query: 270 ETPMMNVIAGGATAKPFVTHHNDLNMDMFMRIAPELFLKQLVVGGMDRVYEIGRQFRNEG 329
            TP +        A  F   +       ++  +P+   +QL+V   ++V+EIG  FR E 
Sbjct: 266 HTPKLLGAPSEGGASVFEVSY--FKGKAYLAQSPQFNKQQLIVADFEKVFEIGPVFRAEN 323

Query: 330 IDM-THNPEFTTCE----FYQAYADVYDLM-DMTELLFSEMVKEITGSYVIKYHPNPQNP 383
            +   H  EFT  +    F + Y +V D++ D+   +F+E+ K  +    I     P   
Sbjct: 324 SNTHRHMTEFTGLDMEMAFEEHYHEVLDVLSDLFVFIFTELKKRFSKEIEIVRKQYPVE- 382

Query: 384 ELEMELNFARPWKRINMIEELEKRFNVKFPAGDQL---HTAETGEFLKNILTENKMECTP 440
                 +F  P           K   +++  G Q+      E G+F  ++ TEN+     
Sbjct: 383 ------DFKLPADG--------KMVRIQYKEGIQMLKDAGKEIGDF-DDLSTENE----- 422

Query: 441 PLTNARMLDKLVGELEDTCINPTFIFGHPQMMSPLAKY-SRDVPGLCERFEVFVATKEIC 499
                + L KLV E  DT       F  P  + P       + P     ++ F+  +EI 
Sbjct: 423 -----KFLGKLVREKYDTDFYILDKF--PLAIRPFYTMPDAEDPRYSNSYDFFMRGEEIL 475

Query: 500 NAYTELNDPFDQRARFEEQARQKDQGDDEVQLIDETFCNALEYGLPPTGGWGCGVDRLAM 559
           +    ++D     A  +E+ +      ++  L D  +C+   YG PP  G G G++R+ M
Sbjct: 476 SGAQRIHD----HALLQERMKVHGLSSEDPGLKD--YCDGFSYGCPPHAGGGIGLERVVM 529

Query: 560 FLTDSNTIREVLLFP 574
           F  D   IR   LFP
Sbjct: 530 FFLDLKNIRRASLFP 544

>Sklu_2189.3 YLL018C, Contig c2189 5672-7348 reverse complement
          Length = 558

 Score = 81.6 bits (200), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 114/498 (22%), Positives = 209/498 (41%), Gaps = 98/498 (19%)

Query: 121 NEKVSIAGRIHAKRESGSKLKFYVL--HGDGVEVQVMSQLQDYHSEEAYEQDHGLLKRGD 178
            ++V    R+H  R+ G+ L F  L    + ++  V S  +   S++  +    +     
Sbjct: 107 GKEVVFRARVHNSRQQGATLNFLTLRQQAELIQALVKSNKEGTVSKQMVKWTSSI-NLES 165

Query: 179 IVGVEGYVGRTQP--KKGGEGEISVFVSRIELLTPCLHMLP------------ADHFGFK 224
           IV V G V + +   K      + + +++I  ++     +P            A+  G  
Sbjct: 166 IVLVHGIVRKVEEPIKSATVQNLEIHITKIFTISETPQQMPILLEDASRSEAEAEAAGLP 225

Query: 225 --DQETRYRKRYLDL--IMNKDARSRFITRSKIITFIRKFLDERSFIEVETPMMNVIAGG 280
             + +TR   R +DL  + N+   + F  +S +    R+FL  R F E+ TP +      
Sbjct: 226 VVNLDTRLDARVIDLRTVTNQ---AIFKIQSGVCELFREFLRNRDFTEIHTPKLLGSPSE 282

Query: 281 ATAKPF-VTHHNDLNMDMFMRIAPELFLKQLVVGGMDRVYEIGRQFRNEGIDM-THNPEF 338
             A  F VT+      + ++  +P+++ ++L+    +RV+E+G  FR E  +   H  EF
Sbjct: 283 GGANVFEVTY---FKGNSYLAQSPQIYKQELIAADFERVFEVGPVFRAENSNTHRHMTEF 339

Query: 339 TTCEFYQAYADVYD-LMDMTELLFSEMVKEITGSY------VIKYHPN-----PQNPELE 386
           T  +   A+ + YD ++D+   LF  +  E+   Y      V K +P      P++ ++ 
Sbjct: 340 TGLDLEMAFEEHYDEVLDVLSELFVFIFTELKSRYSKEIALVRKQYPVEDFKLPKDGKM- 398

Query: 387 MELNFARPWKRINMIEELEKRFNVKFPAGDQLHTAETGEFLKNILTENKMECTPPLTNAR 446
           + L+F      I M+ E          AG Q+   E      ++ TEN+          +
Sbjct: 399 VRLHFK---DGIAMLRE----------AGKQVDDFE------DLSTENE----------K 429

Query: 447 MLDKLVGELEDT----------CINPTFIFGHPQMMSPLAKYSRDVPGLCERFEVFVATK 496
           +L KLV E  DT           + P +    P+     ++YS         ++ F+  +
Sbjct: 430 LLGKLVREKYDTDFYILDKFPLAVRPFYTMPDPED----SRYSNS-------YDFFMRGE 478

Query: 497 EICNAYTELNDPFDQRARFEEQARQKDQGDDEVQLIDETFCNALEYGLPPTGGWGCGVDR 556
           EI +    ++D        +E+ +  +   ++  L D  +C+A  YG PP  G G G++R
Sbjct: 479 EILSGAQRIHDS----EFLKERMKVHELSPEDPGLKD--YCDAFTYGCPPHAGGGIGLER 532

Query: 557 LAMFLTDSNTIREVLLFP 574
           + MF  D   IR   LFP
Sbjct: 533 VVMFYLDLKNIRRASLFP 550

>YLL018C (DPS1) [3401] chr12 complement(109901..111574)
           Aspartyl-tRNA synthetase, cytoplasmic [1674 bp, 557 aa]
          Length = 557

 Score = 80.5 bits (197), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 112/480 (23%), Positives = 195/480 (40%), Gaps = 62/480 (12%)

Query: 121 NEKVSIAGRIHAKRESGSKLKFYVLHGDGVEVQVMSQLQDYHS-EEAYEQDHGLLKRGDI 179
           +++V    R+H  R+ G+ L F  L      +Q + +     +  +   +  G L    I
Sbjct: 106 DKEVLFRARVHNTRQQGATLAFLTLRQQASLIQGLVKANKEGTISKNMVKWAGSLNLESI 165

Query: 180 VGVEGYVGRT-QPKKGGEGE-ISVFVSRIELLTPCLHMLP------------ADHFGFK- 224
           V V G V +  +P K    + + + +++I  ++     LP            A+  G   
Sbjct: 166 VLVRGIVKKVDEPIKSATVQNLEIHITKIYTISETPEALPILLEDASRSEAEAEAAGLPV 225

Query: 225 -DQETRYRKRYLDL--IMNKDARSRFITRSKIITFIRKFLDERSFIEVETP-MMNVIAGG 280
            + +TR   R +DL  + N+   + F  ++ +    R++L  + F EV TP ++   + G
Sbjct: 226 VNLDTRLDYRVIDLRTVTNQ---AIFRIQAGVCELFREYLATKKFTEVHTPKLLGAPSEG 282

Query: 281 ATAKPFVTHHNDLNMDMFMRIAPELFLKQLVVGGMDRVYEIGRQFRNEGIDM-THNPEFT 339
            ++   VT+        ++  +P+   +QL+V   +RVYEIG  FR E  +   H  EFT
Sbjct: 283 GSSVFEVTY---FKGKAYLAQSPQFNKQQLIVADFERVYEIGPVFRAENSNTHRHMTEFT 339

Query: 340 TCE----FYQAYADVYD-LMDMTELLFSEMVKEITGSYVIKYHPNPQNPELEMELNFARP 394
             +    F + Y +V D L ++   +FSE+ K       +      Q P  E +L     
Sbjct: 340 GLDMEMAFEEHYHEVLDTLSELFVFIFSELPKRFAHEIEL---VRKQYPVEEFKLPKDGK 396

Query: 395 WKRINMIEELEKRFNVKFPAGDQLHTAETGEFLKNILTENKMECTPPLTNARMLDKLVGE 454
             R+   E +E         GD    +   E     L  +K +     T+  +LDK   E
Sbjct: 397 MVRLTYKEGIEMLRAAGKEIGDFEDLSTENEKFLGKLVRDKYD-----TDFYILDKFPLE 451

Query: 455 LEDTCINPTFIFGHPQMMSPLAKYSRDVPGLCERFEVFVATKEICNAYTELNDPFDQRAR 514
                I P +    P             P     ++ F+  +EI +    ++D     A 
Sbjct: 452 -----IRPFYTMPDPAN-----------PKYSNSYDFFMRGEEILSGAQRIHD----HAL 491

Query: 515 FEEQARQKDQGDDEVQLIDETFCNALEYGLPPTGGWGCGVDRLAMFLTDSNTIREVLLFP 574
            +E+ +      ++  L D  +C+   YG PP  G G G++R+ MF  D   IR   LFP
Sbjct: 492 LQERMKAHGLSPEDPGLKD--YCDGFSYGCPPHAGGGIGLERVVMFYLDLKNIRRASLFP 549

>KLLA0D03839g 324274..325941 highly similar to sp|P04802
           Saccharomyces cerevisiae YLL018c DPS1 aspartyl-tRNA
           synthetase, cytosolic, start by similarity
          Length = 555

 Score = 76.6 bits (187), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 119/486 (24%), Positives = 203/486 (41%), Gaps = 78/486 (16%)

Query: 123 KVSIAGRIHAKRESGSKLKFYVLHGDGVEVQ--VMSQLQDYHSEEAYEQDHGLLKRGDIV 180
           +V    R+H  R+ G+ L F  L      +Q  V +  +   S++  +   G +    IV
Sbjct: 106 EVVFRARVHNSRQQGATLAFLTLRQQAELIQGLVKANKEGTVSKQMVKW-VGSINLESIV 164

Query: 181 GVEGYVGRTQP--KKGGEGEISVFVSRIELLTPCLHMLP------------ADHFGFK-- 224
            V G V + +   K      + V +++I  ++     LP            A+  G    
Sbjct: 165 VVHGIVKKVEEPIKSATVQNLEVHITKIYTISETPEQLPILIEDASRSEAEAEAAGLPVV 224

Query: 225 DQETRYRKRYLDL--IMNKDARSRFITRSKIITFIRKFLDERSFIEVETP-MMNVIAGGA 281
           + +TR   R +DL  + N+   + F  +S +    R+FL  + F EV TP ++   + G 
Sbjct: 225 NLDTRLDSRVIDLRTVTNQ---AIFRIQSGVCALFREFLTNKKFTEVHTPKLLGAPSEGG 281

Query: 282 TAKPFVTHHNDLNMDMFMRIAPELFLKQLVVGGMDRVYEIGRQFRNEGIDM-THNPEFTT 340
           +    VT+    +   ++  +P+L+ +QL+    +RV+E+   FR E  +   H  EFT 
Sbjct: 282 SNVFEVTYFKGKS---YLAQSPQLYKQQLIAADFERVFEVAPVFRAENSNTHRHMTEFTG 338

Query: 341 CEFYQAYADVYD-----LMDMTELLFSEM----VKEITGSYVIKYHPNPQNPELEMELNF 391
            +   A+ + YD     L ++   +FS++     KEI  + V K +P  +  +L  +   
Sbjct: 339 LDLEMAFEEHYDEVVDTLAELFVFIFSQLKTRYAKEI--ALVRKQYP-VEEFKLPKDGKM 395

Query: 392 AR-PWKR-INMIEELEKRFNVKFPAGDQLHTAETGEFLKNILTENKMECTPPLTNARMLD 449
            R P+K  I ++ E  K  +      D    +   E L   L  +K E     T+  +LD
Sbjct: 396 VRIPFKEGIALLREAGKDVD------DFEDLSTENEKLLGKLVRDKYE-----TDFYILD 444

Query: 450 KLVGELEDTCINPTFIFGHPQMMSPLAKYSRDVPGLCERFEVFVATKEICNAYTELNDPF 509
           K         I P +    P    P  +YS         ++ F+  +EI +    ++D  
Sbjct: 445 KF-----PLAIRPFYTM--PDAEDP--RYSNS-------YDFFMRGEEILSGAQRIHDAD 488

Query: 510 DQRARFE-EQARQKDQGDDEVQLIDETFCNALEYGLPPTGGWGCGVDRLAMFLTDSNTIR 568
             + R    +   +D G     L D  +C A  YG PP  G G G++R+ MF  D   IR
Sbjct: 489 LLKERMNAHEVHPEDPG-----LKD--YCEAFTYGCPPHAGGGIGLERVVMFYLDLKNIR 541

Query: 569 EVLLFP 574
              LFP
Sbjct: 542 RASLFP 547

>Kwal_27.12235
          Length = 650

 Score = 66.6 bits (161), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 53/199 (26%), Positives = 94/199 (47%), Gaps = 7/199 (3%)

Query: 178 DIVGVEGYVGRTQPKKGGEG-EISVFVSRIELLTPCLHMLPADHFGFKDQETRY-RKRYL 235
           D+V +EG +   + K+     E  + +S++  L       P+    FK+Q       RYL
Sbjct: 96  DVVQIEGQLSLKRAKQESSAPEYEIKLSKLRTLNKAGKK-PSQLLHFKEQGNYPPEHRYL 154

Query: 236 DLIMNKDARSRFITRSKIITFIRKFLDERSFIEVETPMMNVIAGGATAKPFVTHHNDL-N 294
            L + K  ++    R +I T+IRK L+ + F E+ETP++         +  V   N L +
Sbjct: 155 QLRLPK-YQTYLRKRHEIATYIRKHLNSKMFSEIETPILFKSTPEGAREFLVPARNKLSD 213

Query: 295 MDMFMRI--APELFLKQLVVGGMDRVYEIGRQFRNEGIDMTHNPEFTTCEFYQAYADVYD 352
              F  +  +P+ + + L+ GG+ R Y++ R FR+E +     PEFT  +   A+A    
Sbjct: 214 KPTFYALPQSPQQYKQLLMAGGVSRYYQLARCFRDEDLRSDRQPEFTQVDLEMAFASGSQ 273

Query: 353 LMDMTELLFSEMVKEITGS 371
           +MD+ E   +     ++ S
Sbjct: 274 VMDVVESTITNTWNSLSSS 292

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 32/111 (28%), Positives = 49/111 (44%), Gaps = 9/111 (8%)

Query: 468 HPQMMSPLAKYSR--DVPGLC--ERFEVFVATKEICNAYTELNDPFDQRARFEEQARQKD 523
           HP  M  L   S+    P LC  + ++  V   E+    T ++DP  Q   F+   +   
Sbjct: 514 HPFTMVQLKDLSKLSSNPLLCTGQHYDFVVNGTELGGGSTRIHDPELQNFIFKNILKI-- 571

Query: 524 QGDDEVQLIDETFCNALEYGLPPTGGWGCGVDRLAMFLTDSNTIREVLLFP 574
               E + + E    A E G PP  G+  G DRL   +  ++ IR+V+ FP
Sbjct: 572 ---SEPEKLFEHLLTAFESGTPPHAGFAIGFDRLCAMICGTDNIRDVIAFP 619

>YHR019C (DED81) [2305] chr8 complement(141886..143550)
           Asparaginyl-tRNA synthetase, cytoplasmic [1665 bp, 554
           aa]
          Length = 554

 Score = 65.5 bits (158), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 116/474 (24%), Positives = 184/474 (38%), Gaps = 76/474 (16%)

Query: 121 NEKVSIAGRIHAKRESGSKLKFYVLH-GDGVEVQVMSQLQDYHSEEAYEQDHGLLKRGDI 179
            ++V ++G IH  R S  K+ F VL  G G    V+S       + A  Q    L     
Sbjct: 129 GQRVKVSGWIHRLR-SNKKVIFVVLRDGSGFIQCVLS------GDLALAQQTLDLTLEST 181

Query: 180 VGVEGYVGRTQPKKGGEGEISVFVSRIELLTPCLHMLPA--DHFGFKDQETRYRKRYLD- 236
           V + G + +    K   G + + V   E++     + P   D F  K  E       LD 
Sbjct: 182 VTLYGTIVKLPEGKTAPGGVELNVDYYEVV----GLAPGGEDSFTNKIAEGSDPSLLLDQ 237

Query: 237 --LIMNKDARSRFI-TRSKIITFIRKFLDERSFIEVETPMM--NVIAGGATAKPFVTHHN 291
             L +  DA S  +  R+ ++  +R+  DE    EV  P M    + GG+T    +   N
Sbjct: 238 RHLALRGDALSAVMKVRAALLKSVRRVYDEEHLTEVTPPCMVQTQVEGGST----LFKMN 293

Query: 292 DLNMDMFMRIAPELFLKQLVVGGMDRVYEIGRQFRNEGIDM-THNPEFTTCEFYQAYADV 350
               + ++  + +L+L +  +  +  VY I   FR E      H  E+T  E   A+   
Sbjct: 294 YYGEEAYLTQSSQLYL-ETCLASLGDVYTIQESFRAEKSHTRRHLSEYTHIEAELAFLTF 352

Query: 351 YDLMDMTELLFSEMVK-----EITGSYVIKYHPN---PQNPELEMELNFARPWKRINMIE 402
            DL+   E L  + V+      I G  V + +PN   P+ P + ++   A  W   + I+
Sbjct: 353 DDLLQHIETLIVKSVQYVLEDPIAGPLVKQLNPNFKAPKAPFMRLQYKDAITWLNEHDIK 412

Query: 403 ELEKRFNVKFPAGDQLHTAETGEFLKNILTENKMECTPPLTNARMLDKLVGELEDTCINP 462
             E      F  GD +  A           E KM                    DT   P
Sbjct: 413 NEEGE---DFKFGDDIAEA----------AERKM-------------------TDTIGVP 440

Query: 463 TFIFGHP-QMMSPLAKYSRDVPGLCERFEVFVA-TKEICNAYTELNDPFDQRARFEEQAR 520
            F+   P ++ S   K   D P + E  +V +    EI      ++D  +  A F+   R
Sbjct: 441 IFLTRFPVEIKSFYMKRCSDDPRVTESVDVLMPNVGEITGGSMRIDDMDELMAGFK---R 497

Query: 521 QKDQGDDEVQLIDETFCNALEYGLPPTGGWGCGVDRLAMFLTDSNTIREVLLFP 574
           +    D     ID+      +YG  P GG+G G +R+  +L D  T+R+  L+P
Sbjct: 498 EGIDTDAYYWFIDQR-----KYGTCPHGGYGIGTERILAWLCDRFTVRDCSLYP 546

>KLLA0A08426g complement(745048..746712) similar to sp|P38707
           Saccharomyces cerevisiae YHR019c DED81
           asparaginyl-tRNA-synthetase, start by similarity
          Length = 554

 Score = 65.5 bits (158), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 108/473 (22%), Positives = 188/473 (39%), Gaps = 74/473 (15%)

Query: 121 NEKVSIAGRIHAKRESGSKLKFYVLHGDGVEVQVMSQLQDYHSEEAYEQDHGLLKRGDIV 180
           +++V ++G +H  R + S +   +  G G    V++         +Y+  +  L+    +
Sbjct: 129 DKRVKVSGWVHRLRNNKSVVFIILRDGTGFLQTVLTG----DLARSYQIVNLTLE--TTI 182

Query: 181 GVEGYVGRTQPKKGGEGEISVFVSRIELLTPCLHMLPADHFGFKD--QETRYRKRYLD-- 236
            + G +      K   G + +FV   E++ P     P+    F +  QE       LD  
Sbjct: 183 TLYGTIKVVPESKSAPGGVELFVDYFEIVGPA----PSGENAFTNRVQENADPSILLDQR 238

Query: 237 -LIMNKDARSRFI-TRSKIITFIRKFLDERSFIEVETPMM--NVIAGGATAKPFVTHHND 292
            L++  +  S  +  R+ ++  IR+  DE    EV  P M    + GG+T    +   + 
Sbjct: 239 HLMLRGETLSAVMKVRAALMKSIRRVYDEEGLTEVNPPCMVQTQVEGGST----LFKLDY 294

Query: 293 LNMDMFMRIAPELFLKQLVVGGMDRVYEIGRQFRNEGIDM-THNPEFTTCEFYQAYADVY 351
              + F+  + +L+L +  +  +  VY I   FR E      H  E+T  E    + D  
Sbjct: 295 YGEEAFLTQSSQLYL-ETCLAALGDVYCIQESFRAEKSHTRRHLSEYTHIEAELCFLDFD 353

Query: 352 DLMDMTELLFSEMVK-----EITGSYVIKYHPNPQNPEL---EMELNFARPWKRINMIEE 403
           DL+   E + ++ ++      + G  V K +PN Q P+L    ME   A  W + + I+ 
Sbjct: 354 DLLSHIERVITKTIQYVLEDPVAGPLVKKLNPNFQAPQLPFKRMEYKDAIEWLKEHGIKN 413

Query: 404 LEKRFNVKFPAGDQLHTAETGEFLKNILTENKMECTPPLTNARMLDKLVGELEDTCINPT 463
            E +   +F  GD +  A           E KM                    DT   P 
Sbjct: 414 EEDK---EFQFGDDIAEA----------AERKM-------------------TDTIGVPI 441

Query: 464 FIFGHP-QMMSPLAKYSRDVPGLCERFEVFVAT-KEICNAYTELNDPFDQRARFEEQARQ 521
            +   P ++ S   K   D   + E  +V + T  EI      ++D  +  A F      
Sbjct: 442 LLTRFPLEIKSFYMKRCDDDKRVTESVDVLMPTVGEITGGSMRIDDTEELMAGF------ 495

Query: 522 KDQGDDEVQLIDETFCNALEYGLPPTGGWGCGVDRLAMFLTDSNTIREVLLFP 574
           K +G D        F +  +YG  P GG+G G +R+  +L D  T+R+  L+P
Sbjct: 496 KREGIDPAPYY--WFIDQRKYGTCPHGGYGLGTERILAWLCDRFTVRDCSLYP 546

>Sklu_2265.3 YHR019C, Contig c2265 4970-6652
          Length = 560

 Score = 58.9 bits (141), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 116/495 (23%), Positives = 194/495 (39%), Gaps = 88/495 (17%)

Query: 107 LKKYENLK--RGETLPNEKVSIAGRIHAKRESGSKLKFYVLH-GDGVEVQVMSQLQDYHS 163
           L K E +K  +  T    ++ ++G IH  R S   L F VL  G G    V++       
Sbjct: 119 LPKAEKVKISKSYTTIGSRIKVSGWIHRLR-SNKSLCFVVLRDGTGFLQAVLAG----DL 173

Query: 164 EEAYEQDHGLLKRGDIVGVEGYVGRTQPKKGGEGEISVFVSRIELLTPCLHMLPA--DHF 221
            +AY+     L+    V + G + +    K   G + + V   E+++    + P+  D F
Sbjct: 174 AKAYQTSTLTLE--STVTLYGTISKLPEGKTAPGGVELAVDYYEIVS----LAPSGEDAF 227

Query: 222 GFKDQETRYRKRYLD---LIMNKDARSRFI-TRSKIITFIRKFLDERSFIEVETPMM--N 275
             K QE       LD   L +  +  S  +  R+ ++  IR+  +E    EV  P M   
Sbjct: 228 TNKVQEGADPSLLLDQRHLALRGETLSAVMKVRASLLRAIRRAYEEEQLTEVTPPCMVQT 287

Query: 276 VIAGGATAKPFVTHHNDLNMDMFMRIAPELFLKQLVVGGMDRVYEIGRQFRNEGIDMT-H 334
            + GG+T    +   +    + ++  + +L+L +  +  +  VY I   FR E      H
Sbjct: 288 QVEGGST----LFKLDYYGEEAYLTQSSQLYL-ETCLASLGDVYCIQESFRAEKSHTRRH 342

Query: 335 NPEFTTCEFYQAYADVYDLMDMTELLFSEMVK-----EITGSYVIKYHPNPQNPELEMEL 389
             E+T  E    + D  DL+   E + ++ V+      I G  + + +P+ Q P+L    
Sbjct: 343 LSEYTHIEAELCFLDFDDLLSHIERVITKSVQYVLEDPIAGPLIKQLNPDFQAPQL---- 398

Query: 390 NFARPWKRINMIEELE--KRFNVK------FPAGDQLHTAETGEFLKNILTENKMECTPP 441
               P+KR+   + +E  K   +K      F  GD +  A           E KM     
Sbjct: 399 ----PFKRLEYKDAIEWLKEHGIKNEDGEEFKFGDDIAEA----------AERKMT---- 440

Query: 442 LTNARMLDKLVGELEDTCINPTFIFGHP-QMMSPLAKYSRDVPGLCERFEVFVAT-KEIC 499
                          DT   P  +   P ++ S   K   D P + E  +V + T  EI 
Sbjct: 441 ---------------DTIGVPILLTRFPVEIKSFYMKRCTDDPSVTESVDVLMPTVGEIT 485

Query: 500 NAYTELNDPFDQRARFEEQARQKDQGDDEVQLIDETFCNALEYGLPPTGGWGCGVDRLAM 559
                ++   +  A F      K +G D        F +   YG  P GG+G G +R+  
Sbjct: 486 GGSMRIDSIEELMAGF------KREGIDPAAYY--WFIDQRRYGSCPHGGYGLGTERILA 537

Query: 560 FLTDSNTIREVLLFP 574
           +L D  T+R+  L+P
Sbjct: 538 WLCDRFTVRDCSLYP 552

>Kwal_14.2303
          Length = 475

 Score = 57.4 bits (137), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 60/266 (22%), Positives = 117/266 (43%), Gaps = 30/266 (11%)

Query: 124 VSIAGRIHAKRESGSKLKFYVL--HGDGVEVQVMSQLQDYHSEEAYEQDHGLLKRGDIVG 181
           V +  R+H  R+ G+ L F  L    + ++  V S  +   S++  +   G +    IV 
Sbjct: 121 VVLRARVHNSRQQGATLVFLTLRQQANLIQALVKSNAEGTISKQMVKWT-GSISPESIVL 179

Query: 182 VEGYVGRTQP--KKGGEGEISVFVSRIELLTPCLHMLP------------ADHFGFK--D 225
           V G V + +   K      + + +++I  ++     LP            A+  G    +
Sbjct: 180 VHGVVKKVEEPIKSATVQNLEIHITQIFTISEAPQQLPILIEDASRSDAEAEAAGLPVVN 239

Query: 226 QETRYRKRYLDLIMNKDARSRFITRSKIITFIRKFLDERSFIEVETPMMNVIAGGATAKP 285
            +TR   R +DL    + ++ F  +S +    R+FL +R F+E+ TP +        A  
Sbjct: 240 LDTRLDARVIDLRTATN-QAIFRIQSGVCELFREFLTQRKFVEIHTPKLLGAPSEGGANV 298

Query: 286 F-VTHHNDLNMDMFMRIAPELFLKQLVVGGMDRVYEIGRQFRNEGIDM-THNPEFTTCEF 343
           F VT+    +   ++  +P+ + ++L+    +RV+E+   FR E  +   H  EFT  + 
Sbjct: 299 FEVTYFKGKS---YLAQSPQFYKQELIAADFERVFEVAPVFRAENSNTHRHMTEFTGLDL 355

Query: 344 YQAYADVYD-----LMDMTELLFSEM 364
             A+ + YD     L D+   +F+++
Sbjct: 356 EMAFEEHYDEVIDVLSDLFVFIFTQL 381

>Sklu_1963.1 YPL104W, Contig c1963 1525-3492 reverse complement
          Length = 655

 Score = 56.2 bits (134), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 41/142 (28%), Positives = 70/142 (49%), Gaps = 4/142 (2%)

Query: 233 RYLDLIMNKDARSRFITRSKIITFIRKFLDERSFIEVETPMM-NVIAGGATAKPFVTHHN 291
           RYL L + K  ++   TR +    IRK LD   F EVETPM+      GA      T  +
Sbjct: 152 RYLQLRLPK-YQNFLRTRYEASKLIRKDLDTYRFTEVETPMLFKSTPEGAREFLVPTRRS 210

Query: 292 DLNMDMFMRI--APELFLKQLVVGGMDRVYEIGRQFRNEGIDMTHNPEFTTCEFYQAYAD 349
           +     F  +  +P+ + + L+  G+ R ++I R FR+E +     PEFT  +   A+A 
Sbjct: 211 ESKHPTFYALPQSPQQYKQLLMASGVHRYFQIARCFRDEDLRSDRQPEFTQVDLEMAFAS 270

Query: 350 VYDLMDMTELLFSEMVKEITGS 371
             ++MD+ E + ++    ++ +
Sbjct: 271 GNEVMDVVEDMVTKAWSNLSSN 292

 Score = 43.9 bits (102), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 28/111 (25%), Positives = 50/111 (45%), Gaps = 9/111 (8%)

Query: 468 HPQMMSPLAKYSR----DVPGLCERFEVFVATKEICNAYTELNDPFDQRARFEEQARQKD 523
           HP  M  L  Y +     +  L + +++ V+  E+    T ++DP  Q   F+E  +   
Sbjct: 519 HPFTMVKLDDYKKLSNEAISCLGQHYDLVVSGVELGGGSTRIHDPELQNYIFKEILKIH- 577

Query: 524 QGDDEVQLIDETFCNALEYGLPPTGGWGCGVDRLAMFLTDSNTIREVLLFP 574
               + + +      A E G PP  G+  G DR+   +  + +IR+V+ FP
Sbjct: 578 ----QPERLFGHLLTAFEMGTPPHAGFAIGFDRMCAMMCGTESIRDVIAFP 624

>Scas_700.6
          Length = 658

 Score = 53.9 bits (128), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 66/278 (23%), Positives = 115/278 (41%), Gaps = 31/278 (11%)

Query: 96  KFHVSISLPDFLKKYENLKRGETLPNEKVSIAGRIHAK-RESGSKLKFYVLHGDGVEVQV 154
           KFH S       + YE    G  +     ++ G I  K +  G  L F            
Sbjct: 32  KFHFSKETKSIKQLYETQNTGSRV---TCTVNGWIDTKPKRIGKNLTF------------ 76

Query: 155 MSQLQDYHSEEAYEQDHG----LLKRGDIVGVEGYVGRTQPKKGGEGE----ISVFVSRI 206
            SQL+D   +     D G     L R D++ V G + + + K     E      + V +I
Sbjct: 77  -SQLRDVKGDTVQLVDSGSQLKALNREDVIQVNGTLMKKKEKSVSSAENIFEYEIQVEKI 135

Query: 207 ELLTPCLHMLPADHFGFKDQETRYRKRYLDLIMNKDARSRFI-TRSKIITFIRKFLDERS 265
            +L    +  P+    FK ++  Y   Y  L +       F+  R +I   +R+ L+E  
Sbjct: 136 SVLNSS-NEKPSQLHEFK-KDGNYPPEYRFLQLRHHKYQEFLRKRYQISCKLRQLLNEEE 193

Query: 266 FIEVETPMM-NVIAGGAT--AKPFVTHHNDLNMDMFMRIAPELFLKQLVVGGMDRVYEIG 322
           F+E+ETP++      GA     P  T  N       +  +P+ + + L+  G+ + +++ 
Sbjct: 194 FLEIETPILFKPTPEGAREFLVPTRTKENSTPSFYSLTQSPQQYKQLLMASGVFKYFQVA 253

Query: 323 RQFRNEGIDMTHNPEFTTCEFYQAYADVYDLMDMTELL 360
           R FR+E +     PEFT  +   ++++  D+M + E L
Sbjct: 254 RCFRDEDLRADRQPEFTQIDMEMSFSNGEDVMALLERL 291

 Score = 46.2 bits (108), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 31/114 (27%), Positives = 51/114 (44%), Gaps = 15/114 (13%)

Query: 468 HPQMMSPLAKYSR--DVPGLC--ERFEVFVATKEICNAYTELNDPFDQRARFEEQARQKD 523
           HP  M  L  Y +    P  C  + +++ +   E+    T ++DP  Q   FE   +   
Sbjct: 522 HPFTMVQLQDYEKLNSNPSQCRGQHYDLVINGVELGGGSTRVHDPILQDYIFENILK--- 578

Query: 524 QGDDEVQLIDETF---CNALEYGLPPTGGWGCGVDRLAMFLTDSNTIREVLLFP 574
                ++  +E F     A E G PP  G+  G DR+   L+ + +IR+V+ FP
Sbjct: 579 -----IENAEELFGHLLRAFEMGTPPHAGFAIGFDRMCAMLSGTESIRDVIAFP 627

>KLLA0A11484g 992734..994158 similar to sp|P25345 Saccharomyces
           cerevisiae YCR024c asn-tRNA synthetase, mitochondrial,
           start by similarity
          Length = 474

 Score = 53.1 bits (126), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 82/354 (23%), Positives = 150/354 (42%), Gaps = 49/354 (13%)

Query: 227 ETRYRKRYLDLIMNKDARSRFITRSKIITFIRKFLDERSFIEVETPMMNVIAGGATAKPF 286
           E ++R  YL  ++      RF  R K+ + + K LD   F  V  P++  I      + F
Sbjct: 154 EFKHRTTYLSNLL------RF--RHKVESQLTKTLDGLDFTMVRPPILTSIDCEGAGEMF 205

Query: 287 VTHHNDLNMDMFMRIAPELFLKQLVVGGMDRVYEIGRQFRNEGIDMT-HNPEFTTCEFYQ 345
               +  +  + + ++ +L L+ L++G + RVY +   FR E  D   H  EF   E   
Sbjct: 206 NLKQDHWDEIVNLTVSSQLHLEVLMMG-LGRVYCLQPCFRAEKSDTNRHLCEFWMLEVEA 264

Query: 346 AYADVYD-LMDMTELLFSEMVKEITGSYVI-KYHPNPQNPELEMEL-NFARPWKRINMIE 402
           ++ D  + LMD+ EL+   +V  ++ +  + KY P   N ++        + WKRI   +
Sbjct: 265 SFVDKNESLMDLVELMVKSVVLSLSETKDLPKYFPVGCNIDITSRWAKLLQDWKRITYTD 324

Query: 403 ELEKRFN--VKFPAGDQLHTAETGEFLKNILTENKMECTPPLTNARMLDKLVGELEDTCI 460
            +E   +  VKF      H    G   K++ +E++          R L    G       
Sbjct: 325 AVEALLSSGVKFE-----HDLAWG---KDLNSEHE----------RWLCDHFG------- 359

Query: 461 NPTFIFGHPQMMSPLAKYSRDVPGLCERFEV-FVATKEICNAYTELNDPFDQRARFEEQA 519
            P F+  +P+         R      E F++ F    EI       +D +D     +++ 
Sbjct: 360 GPVFVTNYPRDCKAFYMKLRPDGTTVECFDLLFPEIGEIVGGSVREDD-YDT---LKQEI 415

Query: 520 RQKDQGDDEVQLIDETFCNALEYGLPPTGGWGCGVDRLAMFLTDSNTIREVLLF 573
            ++D   +++    + + N  + G  P GG+G G++RL  +L  +  IR+ + F
Sbjct: 416 ERRDMASNQL----DWYLNLRKEGTVPHGGFGIGIERLVSYLYGNPNIRDSIPF 465

>AGR206C [4517] [Homologous to ScYPL104W (MSD1) - SH]
           (1144536..1146491) [1956 bp, 651 aa]
          Length = 651

 Score = 53.1 bits (126), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 33/118 (27%), Positives = 59/118 (50%), Gaps = 3/118 (2%)

Query: 244 RSRFITRSKIITFIRKFLDERSFIEVETPMM-NVIAGGATAKPFVTHHNDLNMDMFMRI- 301
           ++R   R      +R  L++  F+EVETP++      GA      T H      +F  + 
Sbjct: 162 QARMKMRHNASKTVRASLEKLGFMEVETPLLFKSTPEGAREFLVPTRHKQGKDPLFYALP 221

Query: 302 -APELFLKQLVVGGMDRVYEIGRQFRNEGIDMTHNPEFTTCEFYQAYADVYDLMDMTE 358
            +P+ + + L+ GG+ + Y++ R FR+E +     PEFT  +   A+A+  D+M + E
Sbjct: 222 QSPQQYKQLLMAGGVSKYYQLARCFRDEDLRSDRQPEFTQVDLEMAFANGDDVMRVVE 279

 Score = 43.5 bits (101), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 31/114 (27%), Positives = 51/114 (44%), Gaps = 15/114 (13%)

Query: 468 HPQMMSPLAKYSR--DVPGLC--ERFEVFVATKEICNAYTELNDPFDQRARFEEQARQKD 523
           HP  M  L  Y +  + P  C  + ++  V   E+    T ++DP  QR  F +  +  +
Sbjct: 513 HPFTMVRLQDYQKLSEKPLSCLGQHYDFVVNGVELGGGSTRVHDPVLQRYIFNQILKINN 572

Query: 524 QGDDEVQLIDETFCNALE---YGLPPTGGWGCGVDRLAMFLTDSNTIREVLLFP 574
           +        D+ F + LE    G PP  G+  G DR+   +    +IR+V+ FP
Sbjct: 573 E--------DQVFGHLLEAFSMGTPPHAGFAIGFDRMVAMMCAKESIRDVIAFP 618

>AEL020W [2486] [Homologous to ScYHR019C (DED81) - SH]
           complement(598366..600024) [1659 bp, 552 aa]
          Length = 552

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 74/339 (21%), Positives = 132/339 (38%), Gaps = 58/339 (17%)

Query: 249 TRSKIITFIRKFLDERSFIEVETPMM--NVIAGGATAKPFVTHHNDLNMDMFMRIAPELF 306
            R+  +  IR+  ++   +EV  P M    + GG+T    +   +    + F+  + +L+
Sbjct: 251 VRAAFLRAIRRVYEDEGLLEVTPPCMVQTQVEGGST----LFKLDYYGEEAFLTQSSQLY 306

Query: 307 LKQLVVGGMDRVYEIGRQFRNEGIDMT-HNPEFTTCEFYQAYADVYDLMDMTELLFSEMV 365
           L +  +  +  V+ I   FR E      H  E+T  E    + D   L+  TE + + +V
Sbjct: 307 L-ETCLPALGDVFCIQESFRAEKSHTRRHLSEYTHIEAELGFVDFDQLLRHTERVITSLV 365

Query: 366 K-----EITGSYVIKYHPN---PQNPELEMELNFARPWKRINMIEELEKRFNVKFPAGDQ 417
           +      + G  V + +P+   PQ P + +E   A  W   + I+  E     +F  GD 
Sbjct: 366 RYVLEDPVAGPLVKQLNPDFVPPQMPFMRLEYKDAITWLNEHGIKNEEGE---EFKFGDD 422

Query: 418 LHTAETGEFLKNILTENKMECTPPLTNARMLDKLVGELEDTCINPTFIFGHP-QMMSPLA 476
           +  A           E KM                    DT   P F+   P ++ S   
Sbjct: 423 IAEA----------AERKMT-------------------DTIGKPIFLTRFPLELKSFYM 453

Query: 477 KYSRDVPGLCERFEVFVAT-KEICNAYTELNDPFDQRARFEEQARQKDQGDDEVQLIDET 535
           K   D P + E F+V + T  E+      ++   +  A F+ +    +            
Sbjct: 454 KRCADDPRVTESFDVLMPTVGEVTGGSMRIDSLDELMAGFKREGVNPEP--------YYW 505

Query: 536 FCNALEYGLPPTGGWGCGVDRLAMFLTDSNTIREVLLFP 574
           F +   YG  P GG+G G +R+  +L +   +R+  L+P
Sbjct: 506 FSDQRRYGSCPHGGYGLGTERILAWLCNRYPVRDCSLYP 544

>YPL104W (MSD1) [5340] chr16 (355695..357671) Aspartyl-tRNA
           synthetase, mitochondrial [1977 bp, 658 aa]
          Length = 658

 Score = 50.8 bits (120), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 39/131 (29%), Positives = 64/131 (48%), Gaps = 7/131 (5%)

Query: 233 RYLDLIMNKDARSRFITRSKIITFIRKFLDERSFIEVETPMMNVIAGGATAKPFV----T 288
           RYL L  N   +     RS I   IR   +   F EVETPM+   A    A+ F+    T
Sbjct: 152 RYLQL-RNPKYQDFLKKRSSISKEIRNSFNNFDFTEVETPML-FKATPEGAREFLVPTRT 209

Query: 289 HHNDLNMDMF-MRIAPELFLKQLVVGGMDRVYEIGRQFRNEGIDMTHNPEFTTCEFYQAY 347
             +D     + +  +P+ + + L+  G+++ Y++ R FR+E +     PEFT  +   A+
Sbjct: 210 KRSDGKPSFYALDQSPQQYKQLLMASGVNKYYQMARCFRDEDLRADRQPEFTQVDMEMAF 269

Query: 348 ADVYDLMDMTE 358
           A+  D+M + E
Sbjct: 270 ANSEDVMKIIE 280

 Score = 47.0 bits (110), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 31/111 (27%), Positives = 51/111 (45%), Gaps = 9/111 (8%)

Query: 468 HPQMMSPLAKYSR--DVPGLC--ERFEVFVATKEICNAYTELNDPFDQRARFEEQARQKD 523
           HP  M  L  Y +    P  C    +++ V   E+    T ++DP  Q   FE+  +   
Sbjct: 520 HPFTMVKLKDYEKLEKTPEKCLGRHYDLVVNGVELGGGSTRIHDPRLQDYIFEDILKI-- 577

Query: 524 QGDDEVQLIDETFCNALEYGLPPTGGWGCGVDRLAMFLTDSNTIREVLLFP 574
             D+  +L      NA + G PP  G+  G DR+   + ++ +IR+V+ FP
Sbjct: 578 --DNAYELFGH-LLNAFDMGTPPHAGFAIGFDRMCAMICETESIRDVIAFP 625

>CAGL0A02112g 216596..218242 highly similar to sp|P38707
           Saccharomyces cerevisiae YHR019c DED81
           asparaginyl-tRNA-synthetase, hypothetical start
          Length = 548

 Score = 49.3 bits (116), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 103/475 (21%), Positives = 187/475 (39%), Gaps = 74/475 (15%)

Query: 119 LPNEKVSIAGRIHAKRESGSKLKFYVLH-GDGVEVQVMSQLQDYHSEEAYEQDHGLLKRG 177
           L  ++V I+G IH  R S  K+ F VL  G G    V++       + A  Q    L   
Sbjct: 121 LVGQRVKISGWIHRLR-SNKKVMFIVLRDGYGYLQSVLT------GDLAIAQQSLDLTIE 173

Query: 178 DIVGVEGYVGRTQPKKGGEGEISVFVSRIELLTPCLHMLPADHFGF-------KDQETRY 230
             V + G + +    K   G + + V   E++     + P+    F        D     
Sbjct: 174 STVTLYGTITKVPEGKSAPGGVELLVDYYEVV----GLAPSGDEAFTNKIAEGADPSLLL 229

Query: 231 RKRYLDLIMNKDARSRFITRSKIITFIRKFLDERSFIEVETPMM--NVIAGGATAKPFVT 288
            +R+L L   +   +    R+ ++  IR+   E S  EV  P M    + GG+T    + 
Sbjct: 230 DQRHLAL-RGETLSAVMKVRAALMKSIRRVYTEESLTEVTPPCMVQTQVEGGST----LF 284

Query: 289 HHNDLNMDMFMRIAPELFLKQLVVGGMDRVYEIGRQFRNEGIDMT-HNPEFTTCEFYQAY 347
             +      ++  + +L+L +  +  +  VY +   FR E      H  E+T  E   A+
Sbjct: 285 KLDYYGEQAYLTQSSQLYL-ETCLPSLGDVYCVQESFRAEKSHTRRHLSEYTHIEAELAF 343

Query: 348 ADVYDLMDMTELLFSEMVK-----EITGSYVIKYHPNPQNPELEMELNFARPWKRINMIE 402
               +L+D  E +  + V+      I G  V + +P+ Q P++        P+ R+   +
Sbjct: 344 LTFEELLDHIERVLCKTVQYILEDPIAGPLVKQLNPDFQAPKM--------PFMRLEYKD 395

Query: 403 ELE--KRFNVKFPAGDQLHTAETGEFLKNILTENKMECTPPLTNARMLDKLVGELEDTCI 460
            +E  K  ++K   G++       +F  +I    + + T  +    +L K   E++    
Sbjct: 396 AIEWLKEHDIKNEDGEEF------KFGDDIAEAAERKMTDTIGVPILLTKFPAEIKS--- 446

Query: 461 NPTFIFGHPQMMSPLAKYSRDVPGLCERFEVFVAT-KEICNAYTELNDPFDQRARFEEQA 519
                F  P+         +D   + E  +V + T  EI      +N   +  A F+   
Sbjct: 447 -----FYMPR--------CKDDNRVTESVDVLMPTVGEITGGSMRINTEEELLAGFK--- 490

Query: 520 RQKDQGDDEVQLIDETFCNALEYGLPPTGGWGCGVDRLAMFLTDSNTIREVLLFP 574
           R+          ID+      +YG  P GG+G G +R+  +L +  T+R+  L+P
Sbjct: 491 RENIDPKAYYWFIDQR-----KYGTCPHGGYGLGTERILAWLCNRFTVRDCSLYP 540

>Scas_607.14
          Length = 555

 Score = 49.3 bits (116), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 77/339 (22%), Positives = 137/339 (40%), Gaps = 58/339 (17%)

Query: 249 TRSKIITFIRKFLDERSFIEVETPMM--NVIAGGATAKPFVTHHNDLNMDMFMRIAPELF 306
            R+ ++  +R+  +E   +EV  P M    + GG+T    +   +    + F+  + +L+
Sbjct: 254 VRAALLRAVRRVYEEEGLLEVTPPCMVQTQVEGGST----LFKLDYYGEEAFLTQSSQLY 309

Query: 307 LKQLVVGGMDRVYEIGRQFRNEGIDM-THNPEFTTCEFYQAYADVYDLMDMTELLFSEMV 365
           L +  +  +  V+ +   FR E      H  E+T  E   A+    +L++  E L  + V
Sbjct: 310 L-ETCLPALGDVFCVQESFRAEKSHTRRHLSEYTHIEAELAFLTFEELLEHIETLIVKSV 368

Query: 366 K-----EITGSYVIKYHPN---PQNPELEMELNFARPWKRINMIEELEKRFNVKFPAGDQ 417
           +      + G  V + HP+   P+ P + +E   A  W + + I+  E   + KF  GD 
Sbjct: 369 QYVMEDPVAGPIVNQLHPHFVPPKGPFMRLEYKDAITWLQEHNIKN-EDGEDFKF--GDD 425

Query: 418 LHTAETGEFLKNILTENKMECTPPLTNARMLDKLVGELEDTCINPTFIFGHP-QMMSPLA 476
           +  A           E KM                    DT   P  +   P ++ S   
Sbjct: 426 IAEA----------AERKM-------------------TDTLNVPILLTRFPVEIKSFYM 456

Query: 477 KYSRDVPGLCERFEVFVAT-KEICNAYTELNDPFDQRARFEEQARQKDQGDDEVQLIDET 535
              +D P + E  +V + T  EI      ++D  +  A F      K +G D        
Sbjct: 457 PKCKDDPRVTESVDVLMPTVGEITGGSMRISDIDELMAGF------KREGIDPKPYY--W 508

Query: 536 FCNALEYGLPPTGGWGCGVDRLAMFLTDSNTIREVLLFP 574
           F +  +YG  P GG+G G +R+  +L +  T+R+  L+P
Sbjct: 509 FIDQRKYGTCPHGGYGLGTERILAWLCNRFTVRDCSLYP 547

>KLLA0E24486g complement(2173560..2175497) similar to sp|P15179
           Saccharomyces cerevisiae YPL104w MSD1 aspartate--tRNA
           ligase, mitochondrial, start by similarity
          Length = 645

 Score = 48.9 bits (115), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 35/111 (31%), Positives = 51/111 (45%), Gaps = 9/111 (8%)

Query: 468 HPQMMSPLAKYSR--DVPGLC--ERFEVFVATKEICNAYTELNDPFDQRARFEEQARQKD 523
           HP  M  L  Y++    P  C  E +++ V   E+    T ++DP  Q   F E    K+
Sbjct: 511 HPFTMVNLRDYNKLESDPLSCHGEHYDLVVNGVELGGGSTRIHDPELQNYIFHEILNIKN 570

Query: 524 QGDDEVQLIDETFCNALEYGLPPTGGWGCGVDRLAMFLTDSNTIREVLLFP 574
             D    L+     NA + G PP  G+  G DR+   L  S +IR+V+ FP
Sbjct: 571 PEDLFGHLL-----NAFKMGTPPHAGFAIGFDRMCAMLCGSESIRDVIAFP 616

 Score = 47.0 bits (110), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 62/265 (23%), Positives = 113/265 (42%), Gaps = 30/265 (11%)

Query: 120 PNEKVSIAGRIHAK-RESGSKLKFYVLHG-DGVEVQVMSQLQDYHSEEAYEQDHGLLKRG 177
           PN KV + G I AK ++ G  L F  L   +G ++Q++   Q +  E   E         
Sbjct: 44  PN-KVVLNGWIDAKPKKVGKNLIFGTLRDPNGEKIQLVDS-QSFLKESQVE--------- 92

Query: 178 DIVGVEGYVGRTQPKKGGEGEISVFVSRIELLT--------PCLHMLPADHFGFKDQETR 229
           D+V + G +   +  +     I   +  IEL            L  L AD   F  +   
Sbjct: 93  DVVQIIGELSEKKQTQQSTVNIEYELKIIELQKLNQANKKPSQLQDLKADDGAFPPE--- 149

Query: 230 YRKRYLDLIMNKDARSRFITRSKIITFIRKFLDERSFIEVETPMMNVIAGGATAKPFVTH 289
              RYL L + K  ++    R +    +R  LD  +F EVETP++         +  V  
Sbjct: 150 --YRYLQLRLPK-YQNNLKLRYEASKNVRTVLDSLNFTEVETPLLFKSTPEGAREFLVPT 206

Query: 290 HNDLNMDM-FMRI--APELFLKQLVVGGMDRVYEIGRQFRNEGIDMTHNPEFTTCEFYQA 346
              ++ +  F  +  +P+ + + L+  G++R +++ R FR+E +     PEFT  +   A
Sbjct: 207 RGKIDGEASFYALPQSPQQYKQLLIASGVNRYFQVARCFRDEDLRSDRQPEFTQVDLEMA 266

Query: 347 YADVYDLMDMTELLFSEMVKEITGS 371
           ++   D+ ++ E + +    ++  S
Sbjct: 267 FSSGKDVREVVEKVITSTWNKLHAS 291

>CAGL0H05907g complement(579444..581423) similar to sp|P15179
           Saccharomyces cerevisiae YPL104w MSD1, hypothetical
           start
          Length = 659

 Score = 47.0 bits (110), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 33/134 (24%), Positives = 59/134 (44%), Gaps = 18/134 (13%)

Query: 468 HPQMMSPLAKYSR----DVPGLCERFEVFVATKEICNAYTELNDPFDQRARFEEQARQKD 523
           HP  M  L  Y +     +  L + +++ +   E+    T ++DP  Q+  FE   +  +
Sbjct: 520 HPFTMVQLQDYDKLTTNPIDCLGQHYDLVMNGIELGGGSTRIHDPELQKFMFENVLKISN 579

Query: 524 QGDDEVQLIDETFCNALEYGLPPTGGWGCGVDRLAMFLTDSNTIREVLLFP--------- 574
                 Q++     +A E G PP  G+  G DR+   L  +++IR+V+ FP         
Sbjct: 580 -----YQILFGHLLSAFETGTPPHAGFAIGYDRMCAMLCGTDSIRDVIPFPKSITGSDLV 634

Query: 575 TLKPDVLKEEIKKD 588
              P  + E+I +D
Sbjct: 635 VQSPSTIAEDILRD 648

 Score = 45.1 bits (105), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 31/129 (24%), Positives = 62/129 (48%), Gaps = 11/129 (8%)

Query: 249 TRSKIITFIRKFLDERSFIEVETPMMNVIAGGATAKPFVT--------HHNDLNMDMFMR 300
           TR ++   +R+ LD+  F E+ETP +   A    A+ F+            D  + MF  
Sbjct: 166 TRYEVSKTLRQILDQDGFTEIETPTL-FKATPEGAREFMVPTRVSAKIKQVDKIVPMFYA 224

Query: 301 I--APELFLKQLVVGGMDRVYEIGRQFRNEGIDMTHNPEFTTCEFYQAYADVYDLMDMTE 358
           +  +P+ + + L+  G+ + ++  R +R+E +     PEFT  +   ++A   D+M + E
Sbjct: 225 LTQSPQQYKQLLMASGVPKYFQFARCYRDEDLRADRQPEFTQLDMEMSFASQKDVMSVIE 284

Query: 359 LLFSEMVKE 367
              + + K+
Sbjct: 285 KCITSVWKK 293

>Kwal_0.375
          Length = 428

 Score = 43.1 bits (100), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 71/313 (22%), Positives = 132/313 (42%), Gaps = 38/313 (12%)

Query: 102 SLPDFLKKYENLKRGETLPNEKVSIAGRIHAKRESGSKLKFYVLH-GDG-VEVQVMSQLQ 159
           SLPD   KY+ +K  + + +++V ++G IH +R S S L F VL  G G ++  +   L 
Sbjct: 112 SLPD-ATKYKIIKSYDAI-DQRVKVSGWIHRQRSSKS-LVFIVLRDGTGYLQAVLTGDLA 168

Query: 160 DYHSEEAYEQDHGLLKRGDIVGVEGYVGRTQPKKGGEGEISVFVSRIELLTPCLHMLPA- 218
             H       +  +   G +  +    G+T P     G + + V   E+++    + P+ 
Sbjct: 169 RAHQTSTLTLESSITLYGKVCKLPE--GKTAP-----GGVELLVDYYEIIS----LAPSG 217

Query: 219 -DHFGFKDQETRYRKRYLD---LIMNKDARSRFI-TRSKIITFIRKFLDERSFIEVETPM 273
            D F  K  E       LD   L +  +  S  +  R+ ++  +R+F D+    EV  P 
Sbjct: 218 DDAFTNKIAEGADPSLLLDQRHLALRGETLSAVMKVRAALLRSVRRFYDQEGLTEVTPPC 277

Query: 274 M--NVIAGGATAKPFVTHHNDLNMDMFMRIAPELFLKQLVVGGMDRVYEIGRQFRNEGID 331
           M    + GG+T      +      + ++  + +L+L +  +  +  VY I   FR E   
Sbjct: 278 MVQTQVEGGSTLFKLGYYGE----EAYLTQSSQLYL-ETCLASLGDVYSIQESFRAEKSH 332

Query: 332 M-THNPEFTTCEFYQAYADVYDLMDMTELLFSEMVKE-----ITGSYVIKYHPN---PQN 382
              H  E+T  E    +    +++   E L +++V+      + G  V + +P    P  
Sbjct: 333 TRRHLSEYTHIEAELCFLSFDEMLVHIEKLITQVVQSVLDDPVAGPLVQQLNPGFKAPTM 392

Query: 383 PELEMELNFARPW 395
           P + ++   A  W
Sbjct: 393 PFMRLDYKDAIEW 405

>CAGL0K07656g 761388..762881 highly similar to sp|P15625
           Saccharomyces cerevisiae YFL022c Phenylalanyl-tRNA
           synthetase alpha chain, start by similarity
          Length = 497

 Score = 35.8 bits (81), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 27/76 (35%), Positives = 40/76 (52%), Gaps = 10/76 (13%)

Query: 317 RVYEIGRQFRNEGIDMTHNPEFTTCEFYQAYADVY--DLMDMTELLFSEMVKEITGSYVI 374
           R++ I R FRNE +D TH  EF   E   A  ++   DL+   E  F++M   +TG   +
Sbjct: 345 RLFSIDRVFRNEAVDATHLAEFHQVEGVLADYNITLGDLIKFMEDFFAKM--GVTG---L 399

Query: 375 KYHP--NPQN-PELEM 387
           K+ P  NP   P +E+
Sbjct: 400 KFKPTYNPYTEPSMEI 415

>KLLA0F25234g complement(2349192..2350691) highly similar to
           sp|P15625 Saccharomyces cerevisiae YFL022c FRS2
           phenylalanine--tRNA ligase beta chain, cytosolic
           singleton, start by similarity
          Length = 499

 Score = 35.4 bits (80), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 27/76 (35%), Positives = 40/76 (52%), Gaps = 10/76 (13%)

Query: 317 RVYEIGRQFRNEGIDMTHNPEFTTCEFYQAYADVY--DLMDMTELLFSEMVKEITGSYVI 374
           R++ I R FRNE +D TH  EF   E   A  ++   DL+   E  F++M   +TG   +
Sbjct: 347 RLFSIDRVFRNEAVDATHLAEFHQVEGVLADYNITLGDLIQFMEDFFAKM--GVTG---L 401

Query: 375 KYHP--NP-QNPELEM 387
           ++ P  NP   P LE+
Sbjct: 402 RFKPTYNPYTEPSLEI 417

>AFR516W [3708] [Homologous to ScYFL022C (FRS2) - SH]
           complement(1358569..1360068) [1500 bp, 499 aa]
          Length = 499

 Score = 34.7 bits (78), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 26/76 (34%), Positives = 40/76 (52%), Gaps = 10/76 (13%)

Query: 317 RVYEIGRQFRNEGIDMTHNPEFTTCEFYQAYADVY--DLMDMTELLFSEMVKEITGSYVI 374
           R++ I R FRNE +D TH  EF   E   A  ++   DL+   E  F++M   +TG   +
Sbjct: 347 RLFSIDRVFRNEAVDATHLAEFHQVEGVLADYNITLGDLIQFMEDFFAKM--GVTG---L 401

Query: 375 KYHP--NPQN-PELEM 387
           ++ P  NP   P +E+
Sbjct: 402 RFKPTYNPYTEPSMEI 417

>Scas_707.14
          Length = 499

 Score = 34.7 bits (78), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 26/76 (34%), Positives = 40/76 (52%), Gaps = 10/76 (13%)

Query: 317 RVYEIGRQFRNEGIDMTHNPEFTTCEFYQAYADVY--DLMDMTELLFSEMVKEITGSYVI 374
           R++ I R FRNE +D TH  EF   E   A  ++   DL+   E  F++M   +TG   +
Sbjct: 347 RLFSIDRVFRNEAVDATHLAEFHQVEGVLADYNITLGDLIKFMEEFFAKM--GVTG---L 401

Query: 375 KYHP--NPQN-PELEM 387
           ++ P  NP   P +E+
Sbjct: 402 RFKPTYNPYTEPSMEI 417

>Kwal_47.17998
          Length = 499

 Score = 33.9 bits (76), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 26/76 (34%), Positives = 39/76 (51%), Gaps = 10/76 (13%)

Query: 317 RVYEIGRQFRNEGIDMTHNPEFTTCEFYQAYADVY--DLMDMTELLFSEMVKEITGSYVI 374
           R++ I R FRNE +D TH  EF   E   A  ++   DL+   E  F +M   +TG   +
Sbjct: 347 RLFSIDRVFRNEAVDATHLAEFHQVEGVLADYNITLGDLIQFMEGFFEKM--GVTG---L 401

Query: 375 KYHP--NPQN-PELEM 387
           ++ P  NP   P +E+
Sbjct: 402 RFKPTYNPYTEPSMEI 417

>YFL022C (FRS2) [1661] chr6 complement(93497..95008)
           Phenylalanyl-tRNA synthetase, beta subunit, cytoplasmic
           [1512 bp, 503 aa]
          Length = 503

 Score = 33.5 bits (75), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 26/76 (34%), Positives = 38/76 (50%), Gaps = 10/76 (13%)

Query: 317 RVYEIGRQFRNEGIDMTHNPEFTTCEFYQAYADVY--DLMDMTELLFSEMVKEITGSYVI 374
           R++ I R FRNE +D TH  EF   E   A  ++   DL+   E  F  M   +TG   +
Sbjct: 351 RLFSIDRVFRNEAVDATHLAEFHQVEGVLADYNITLGDLIKFMEEFFERM--GVTG---L 405

Query: 375 KYHP--NPQN-PELEM 387
           ++ P  NP   P +E+
Sbjct: 406 RFKPTYNPYTEPSMEI 421

>Kwal_34.15989
          Length = 506

 Score = 32.0 bits (71), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 26/51 (50%), Gaps = 5/51 (9%)

Query: 390 NFARPWKRINMIEELEKRFNVKFPAGDQLH-----TAETGEFLKNILTENK 435
           N A+PW  +N   +L+++ +  FP  DQL         T   L N+LT+ K
Sbjct: 95  NLAQPWVYLNATNDLQRKISSLFPFSDQLEKHHHFMRRTRSPLCNLLTKEK 145

>CAGL0L08030g 875106..876509 similar to sp|P25345 Saccharomyces
           cerevisiae YCR024c asn-tRNA synthetase, hypothetical
           start
          Length = 467

 Score = 30.8 bits (68), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 12/41 (29%), Positives = 22/41 (53%)

Query: 534 ETFCNALEYGLPPTGGWGCGVDRLAMFLTDSNTIREVLLFP 574
           + + N  + G+ P GG+G G +R   +L     I++ + FP
Sbjct: 418 DWYVNLRKQGVAPHGGFGLGFERFISYLLGIQNIKDTIPFP 458

>Scas_628.24
          Length = 487

 Score = 30.4 bits (67), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 12/32 (37%), Positives = 21/32 (65%)

Query: 543 GLPPTGGWGCGVDRLAMFLTDSNTIREVLLFP 574
           G  P GG+G G++RL  +L  ++ I++ + FP
Sbjct: 447 GSVPHGGFGLGLERLISYLFGNHNIKDAIPFP 478

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.319    0.136    0.399 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 19,653,345
Number of extensions: 889898
Number of successful extensions: 2500
Number of sequences better than 10.0: 50
Number of HSP's gapped: 2513
Number of HSP's successfully gapped: 59
Length of query: 588
Length of database: 16,596,109
Length adjustment: 107
Effective length of query: 481
Effective length of database: 12,891,983
Effective search space: 6201043823
Effective search space used: 6201043823
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 64 (29.3 bits)