Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Sklu_2334.128628615310.0
Kwal_47.1821929328612371e-173
YJR096W28228111521e-160
CAGL0C04543g28728411521e-160
KLLA0F03256g28528211171e-155
Scas_691.528428210961e-152
Kwal_47.188932892666824e-89
ABL209C3102656444e-83
Kwal_33.132763022886043e-77
Scas_714.73222874246e-50
CAGL0I01100g3102774202e-49
YOR120W (GCY1)3122804175e-49
KLLA0B14707g3102994123e-48
KLLA0D10109g3092714105e-48
Sklu_1828.23122854105e-48
CAGL0A02816g3102974062e-47
CAGL0I01122g3263164011e-46
Sklu_1971.33292944002e-46
YDR368W (YPR1)3122773905e-45
Kwal_47.180843092773862e-44
Kwal_55.215363292883845e-44
ACL107C3542983762e-42
Sklu_2408.83222923671e-41
Scas_688.123263283654e-41
YHR104W (GRE3)3273013575e-40
Scas_676.43132843531e-39
KLLA0E21714g3292983523e-39
Sklu_1571.23223033497e-39
Kwal_55.214263082753479e-39
AER401W3132913425e-38
Kwal_56.226113212953374e-37
YBR149W (ARA1)3442953113e-33
Scas_319.11951952952e-32
Scas_518.43382932948e-31
Sklu_2324.33152952841e-29
KLLA0F02728g3302962772e-28
Kwal_33.13274108982463e-26
Kwal_47.192783142952571e-25
KLLA0F05775g3092912552e-25
YDL124W3122842342e-22
CAGL0J09394g3112832314e-22
Scas_704.93092812254e-21
Sklu_2438.123122902001e-17
KLLA0B05291g127701277e-09
Sklu_2405.13423481267e-08
Scas_524.12802041213e-07
Sklu_2082.33383371213e-07
Scas_687.33443131204e-07
Scas_568.73433091187e-07
YPL088W3422971125e-06
Scas_719.393453081091e-05
Scas_664.53432951081e-05
Scas_633.213442971053e-05
CAGL0E05236g3443371011e-04
CAGL0E05214g346300920.001
CAGL0E05192g345297890.003
Kwal_26.8377338130870.006
ABR094W359142840.011
KLLA0F19360g344304820.021
Scas_705.10348220790.057
KLLA0B05302g5145680.15
CAGL0F06061g336136750.18
Scas_709.28323136730.28
Scas_665.18399116720.44
Kwal_26.932233182671.8
KLLA0B09658g34282662.4
YMR041C335130643.7
Sklu_2274.6339124635.0
Scas_717.4722038625.7
Scas_704.2515499606.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Sklu_2334.1
         (286 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Sklu_2334.1 YJR096W, Contig c2334 2610-3470 reverse complement        594   0.0  
Kwal_47.18219                                                         481   e-173
YJR096W (YJR096W) [2988] chr10 (611112..611960) NADPH-specific a...   448   e-160
CAGL0C04543g 434137..435000 highly similar to sp|P47137 Saccharo...   448   e-160
KLLA0F03256g 306731..307588 similar to sp|P47137 Saccharomyces c...   434   e-155
Scas_691.5                                                            426   e-152
Kwal_47.18893                                                         267   4e-89
ABL209C [383] [Homologous to ScYJR096W - SH] (11410..12342) [933...   252   4e-83
Kwal_33.13276                                                         237   3e-77
Scas_714.7                                                            167   6e-50
CAGL0I01100g complement(91693..92625) highly similar to sp|P1406...   166   2e-49
YOR120W (GCY1) [4923] chr15 (551114..552052) Aldo-keto reductase...   165   5e-49
KLLA0B14707g complement(1291951..1292883) similar to sp|P14065 S...   163   3e-48
KLLA0D10109g 854495..855424 similar to sp|P14065 Saccharomyces c...   162   5e-48
Sklu_1828.2 YDR368W, Contig c1828 3683-4621 reverse complement        162   5e-48
CAGL0A02816g 292159..293091 highly similar to tr|Q12458 Saccharo...   160   2e-47
CAGL0I01122g 93934..94914 highly similar to sp|P38715 Saccharomy...   159   1e-46
Sklu_1971.3 YHR104W, Contig c1971 5146-6135                           158   2e-46
YDR368W (YPR1) [1194] chr4 (1213892..1214830) 2-methylbutyraldeh...   154   5e-45
Kwal_47.18084                                                         153   2e-44
Kwal_55.21536                                                         152   5e-44
ACL107C [942] [Homologous to ScYHR104W (GRE3) - SH] (152564..153...   149   2e-42
Sklu_2408.8 , Contig c2408 19753-20721 reverse complement             145   1e-41
Scas_688.12                                                           145   4e-41
YHR104W (GRE3) [2392] chr8 (323411..324394) Aldo/keto reductase ...   142   5e-40
Scas_676.4                                                            140   1e-39
KLLA0E21714g complement(1929294..1930283) gi|1351442|sp|P49378|X...   140   3e-39
Sklu_1571.2 YBR149W, Contig c1571 1437-2405                           139   7e-39
Kwal_55.21426                                                         138   9e-39
AER401W [2901] [Homologous to ScYDR368W (YPR1) - SH; ScYOR120W (...   136   5e-38
Kwal_56.22611                                                         134   4e-37
YBR149W (ARA1) [334] chr2 (539943..540977) Subunit of NADP+-depe...   124   3e-33
Scas_319.1                                                            118   2e-32
Scas_518.4                                                            117   8e-31
Sklu_2324.3 , Contig c2324 5024-5971 reverse complement               114   1e-29
KLLA0F02728g 249240..250232 similar to sp|P38115 Saccharomyces c...   111   2e-28
Kwal_33.13274                                                          99   3e-26
Kwal_47.19278                                                         103   1e-25
KLLA0F05775g 560270..561199 similar to sgd|S0002282 Saccharomyce...   102   2e-25
YDL124W (YDL124W) [746] chr4 (240259..241197) NAD(P)H-dependent ...    95   2e-22
CAGL0J09394g 923715..924650 similar to tr|Q07551 Saccharomyces c...    94   4e-22
Scas_704.9                                                             91   4e-21
Sklu_2438.12 YDL124W, Contig c2438 25491-26429 reverse complement      82   1e-17
KLLA0B05291g 478251..478634 some similarities with sp|Q12458 Sac...    54   7e-09
Sklu_2405.1 YPL088W, Contig c2405 371-1399 reverse complement          53   7e-08
Scas_524.1                                                             51   3e-07
Sklu_2082.3 , Contig c2082 6775-7791                                   51   3e-07
Scas_687.3                                                             51   4e-07
Scas_568.7                                                             50   7e-07
YPL088W (YPL088W) [5356] chr16 (381960..382988) Putative aryl al...    48   5e-06
Scas_719.39                                                            47   1e-05
Scas_664.5                                                             46   1e-05
Scas_633.21                                                            45   3e-05
CAGL0E05236g complement(509478..510512) highly similar to tr|Q02...    44   1e-04
CAGL0E05214g complement(508038..509078) highly similar to tr|Q02...    40   0.001
CAGL0E05192g complement(506594..507631) highly similar to tr|Q02...    39   0.003
Kwal_26.8377                                                           38   0.006
ABR094W [685] [Homologous to ScYMR041C - SH] complement(555931.....    37   0.011
KLLA0F19360g 1792778..1793812 similar to sgd|S0006009 Saccharomy...    36   0.021
Scas_705.10                                                            35   0.057
KLLA0B05302g 478541..478696 similar to sp|P14065 Saccharomyces c...    31   0.15 
CAGL0F06061g complement(604063..605073) similar to sp|Q04212 Sac...    33   0.18 
Scas_709.28                                                            33   0.28 
Scas_665.18                                                            32   0.44 
Kwal_26.9322                                                           30   1.8  
KLLA0B09658g complement(837873..838901) similar to sgd|S0006331 ...    30   2.4  
YMR041C (YMR041C) [4005] chr13 complement(350965..351972) Member...    29   3.7  
Sklu_2274.6 YMR041C, Contig c2274 7634-8653                            29   5.0  
Scas_717.47                                                            28   5.7  
Scas_704.25                                                            28   6.8  

>Sklu_2334.1 YJR096W, Contig c2334 2610-3470 reverse complement
          Length = 286

 Score =  594 bits (1531), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 286/286 (100%), Positives = 286/286 (100%)

Query: 1   MNTKAIPKAYKLSSGYTLPSIGLGTYDLPSNATSEIVYEALKCGYRHLDTAVLYGNEREV 60
           MNTKAIPKAYKLSSGYTLPSIGLGTYDLPSNATSEIVYEALKCGYRHLDTAVLYGNEREV
Sbjct: 1   MNTKAIPKAYKLSSGYTLPSIGLGTYDLPSNATSEIVYEALKCGYRHLDTAVLYGNEREV 60

Query: 61  GEGILKWLKENPSSNKREDVFYATKLWNSQNGYNNAKRAIQECFEKVEGLGYIDLLLIHS 120
           GEGILKWLKENPSSNKREDVFYATKLWNSQNGYNNAKRAIQECFEKVEGLGYIDLLLIHS
Sbjct: 61  GEGILKWLKENPSSNKREDVFYATKLWNSQNGYNNAKRAIQECFEKVEGLGYIDLLLIHS 120

Query: 121 PLSGSRKRLETYKAMQEAVDKGIVRSIGVSNYGVHHIDELLNWNELKYKPFVNQIEISPW 180
           PLSGSRKRLETYKAMQEAVDKGIVRSIGVSNYGVHHIDELLNWNELKYKPFVNQIEISPW
Sbjct: 121 PLSGSRKRLETYKAMQEAVDKGIVRSIGVSNYGVHHIDELLNWNELKYKPFVNQIEISPW 180

Query: 181 LMRQELADYCKSRGLIVEAYAPLTHGYKINHPNVLRVAKEAGCNSGQVLIRWSLQHGYVP 240
           LMRQELADYCKSRGLIVEAYAPLTHGYKINHPNVLRVAKEAGCNSGQVLIRWSLQHGYVP
Sbjct: 181 LMRQELADYCKSRGLIVEAYAPLTHGYKINHPNVLRVAKEAGCNSGQVLIRWSLQHGYVP 240

Query: 241 LPKTKSVKRLPSNLDVYNIELTQEQMDFLDQPDAYEPTDWECTDAP 286
           LPKTKSVKRLPSNLDVYNIELTQEQMDFLDQPDAYEPTDWECTDAP
Sbjct: 241 LPKTKSVKRLPSNLDVYNIELTQEQMDFLDQPDAYEPTDWECTDAP 286

>Kwal_47.18219
          Length = 293

 Score =  481 bits (1237), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 221/286 (77%), Positives = 254/286 (88%)

Query: 1   MNTKAIPKAYKLSSGYTLPSIGLGTYDLPSNATSEIVYEALKCGYRHLDTAVLYGNEREV 60
           M+   +PKAYKLSSGY LPSIGLGTYD+P   TSE+VY+ALK GYRHLDTAVLYGNE EV
Sbjct: 8   MSKTTVPKAYKLSSGYILPSIGLGTYDIPRAETSEVVYQALKSGYRHLDTAVLYGNEHEV 67

Query: 61  GEGILKWLKENPSSNKREDVFYATKLWNSQNGYNNAKRAIQECFEKVEGLGYIDLLLIHS 120
           G+GI KWL+E+P  NKR+DVFY TKLWNSQNGY+NAKRAI+EC EKV  LGYIDLLLIHS
Sbjct: 68  GQGIQKWLEEDPEHNKRQDVFYTTKLWNSQNGYSNAKRAIKECMEKVSPLGYIDLLLIHS 127

Query: 121 PLSGSRKRLETYKAMQEAVDKGIVRSIGVSNYGVHHIDELLNWNELKYKPFVNQIEISPW 180
           PLSG+R+RLETYKAMQEAVD+GIVRSIGVSNYG HHIDELL W ELK+KP VNQIEISPW
Sbjct: 128 PLSGTRRRLETYKAMQEAVDEGIVRSIGVSNYGKHHIDELLTWKELKHKPVVNQIEISPW 187

Query: 181 LMRQELADYCKSRGLIVEAYAPLTHGYKINHPNVLRVAKEAGCNSGQVLIRWSLQHGYVP 240
           +MRQ+LADYCKS+GL+VEA++PLTHGYK+ HP+VL VAKE G ++G+VLIRWSLQHGYVP
Sbjct: 188 IMRQDLADYCKSKGLVVEAFSPLTHGYKLKHPDVLLVAKETGTDAGRVLIRWSLQHGYVP 247

Query: 241 LPKTKSVKRLPSNLDVYNIELTQEQMDFLDQPDAYEPTDWECTDAP 286
           LPK++SV+RL  N+  Y+ EL+ EQ+ FLDQP AYEPTDWECTDAP
Sbjct: 248 LPKSRSVERLKGNVKAYDFELSPEQVSFLDQPQAYEPTDWECTDAP 293

>YJR096W (YJR096W) [2988] chr10 (611112..611960) NADPH-specific
           aldo/keto reductase, may play a general role in reducing
           pentose sugars [849 bp, 282 aa]
          Length = 282

 Score =  448 bits (1152), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 205/281 (72%), Positives = 243/281 (86%)

Query: 6   IPKAYKLSSGYTLPSIGLGTYDLPSNATSEIVYEALKCGYRHLDTAVLYGNEREVGEGIL 65
           +PK YKLS+G+ +PSI LGTYD+P + T+EIVYE +KCGYRH DTAVLYGNE+EVG+GI+
Sbjct: 2   VPKFYKLSNGFKIPSIALGTYDIPRSQTAEIVYEGVKCGYRHFDTAVLYGNEKEVGDGII 61

Query: 66  KWLKENPSSNKREDVFYATKLWNSQNGYNNAKRAIQECFEKVEGLGYIDLLLIHSPLSGS 125
           KWL E+P ++KRE++FY TKLWNSQNGY  AK AI++C  +V GL YIDLLLIHSPL GS
Sbjct: 62  KWLNEDPGNHKREEIFYTTKLWNSQNGYKRAKAAIRQCLNEVSGLQYIDLLLIHSPLEGS 121

Query: 126 RKRLETYKAMQEAVDKGIVRSIGVSNYGVHHIDELLNWNELKYKPFVNQIEISPWLMRQE 185
           + RLET++AMQEAVD+G+V+SIGVSNYG  HIDELLNW ELK+KP VNQIEISPW+MRQE
Sbjct: 122 KLRLETWRAMQEAVDEGLVKSIGVSNYGKKHIDELLNWPELKHKPVVNQIEISPWIMRQE 181

Query: 186 LADYCKSRGLIVEAYAPLTHGYKINHPNVLRVAKEAGCNSGQVLIRWSLQHGYVPLPKTK 245
           LADYCKS+GL+VEA+APL HGYK+ +P++L+V KE   N GQVLIRWSLQHGY+PLPKTK
Sbjct: 182 LADYCKSKGLVVEAFAPLCHGYKMTNPDLLKVCKEVDRNPGQVLIRWSLQHGYLPLPKTK 241

Query: 246 SVKRLPSNLDVYNIELTQEQMDFLDQPDAYEPTDWECTDAP 286
           +VKRL  NL  YN EL+ EQM FLD PDAYEPTDWECTDAP
Sbjct: 242 TVKRLEGNLAAYNFELSDEQMKFLDHPDAYEPTDWECTDAP 282

>CAGL0C04543g 434137..435000 highly similar to sp|P47137
           Saccharomyces cerevisiae YJR096w, hypothetical start
          Length = 287

 Score =  448 bits (1152), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 204/284 (71%), Positives = 244/284 (85%)

Query: 3   TKAIPKAYKLSSGYTLPSIGLGTYDLPSNATSEIVYEALKCGYRHLDTAVLYGNEREVGE 62
           T  +PK Y+L  G  +PS+ LGTYD+P++ T+++V EALKCGYRH DTAVLYGNEREVG+
Sbjct: 4   TVDVPKYYELQDGRKIPSLALGTYDIPNSVTAKVVTEALKCGYRHFDTAVLYGNEREVGQ 63

Query: 63  GILKWLKENPSSNKREDVFYATKLWNSQNGYNNAKRAIQECFEKVEGLGYIDLLLIHSPL 122
           GI+ W+ E+ + NKREDVFY TKLWNSQNGYN AKRAI+EC +KV GLGYID+LLIHSPL
Sbjct: 64  GIVNWINEDKAHNKREDVFYTTKLWNSQNGYNEAKRAIKECMQKVSGLGYIDMLLIHSPL 123

Query: 123 SGSRKRLETYKAMQEAVDKGIVRSIGVSNYGVHHIDELLNWNELKYKPFVNQIEISPWLM 182
           SG R+RLET+KAMQEAVD+GIV+SIGVSNYG HHI+ELL W+ELKYKP VNQIEISPW+M
Sbjct: 124 SGQRRRLETWKAMQEAVDEGIVKSIGVSNYGKHHIEELLGWDELKYKPVVNQIEISPWVM 183

Query: 183 RQELADYCKSRGLIVEAYAPLTHGYKINHPNVLRVAKEAGCNSGQVLIRWSLQHGYVPLP 242
           RQELADYCKS  L+VEAYAP+ HGYK+N P +  ++KE G N GQ+LIRWSLQHGY+PLP
Sbjct: 184 RQELADYCKSVNLVVEAYAPMAHGYKMNDPGLREISKETGMNPGQLLIRWSLQHGYLPLP 243

Query: 243 KTKSVKRLPSNLDVYNIELTQEQMDFLDQPDAYEPTDWECTDAP 286
           KTK+V RL SNLDVYN +LT +Q+  +D P+AY+PTDWECTDAP
Sbjct: 244 KTKTVARLASNLDVYNHKLTLDQVKRMDHPEAYDPTDWECTDAP 287

>KLLA0F03256g 306731..307588 similar to sp|P47137 Saccharomyces
           cerevisiae YJR096w, start by similarity
          Length = 285

 Score =  434 bits (1117), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 200/282 (70%), Positives = 239/282 (84%)

Query: 5   AIPKAYKLSSGYTLPSIGLGTYDLPSNATSEIVYEALKCGYRHLDTAVLYGNEREVGEGI 64
           ++PK+YKLSSGYT+PS+GLGTY+LP N T+ +V++AL+ GYRH DTAVLYGNE EVG+GI
Sbjct: 4   SVPKSYKLSSGYTIPSVGLGTYELPPNKTAYLVHQALEVGYRHFDTAVLYGNEYEVGQGI 63

Query: 65  LKWLKENPSSNKREDVFYATKLWNSQNGYNNAKRAIQECFEKVEGLGYIDLLLIHSPLSG 124
            KWL ENP+ NKR DVFY TKLW+SQ+GY  AK+AI  C ++VE LGYIDLLLIHSPL G
Sbjct: 64  KKWLNENPAENKRGDVFYTTKLWDSQHGYEKAKKAIDHCLQEVEDLGYIDLLLIHSPLGG 123

Query: 125 SRKRLETYKAMQEAVDKGIVRSIGVSNYGVHHIDELLNWNELKYKPFVNQIEISPWLMRQ 184
            + RLETY+AMQEAVD G VRSIGVSNYG  HI+ELLNW +LKYKP VNQIEISPW MRQ
Sbjct: 124 KKLRLETYEAMQEAVDAGKVRSIGVSNYGFQHIEELLNWEKLKYKPVVNQIEISPWCMRQ 183

Query: 185 ELADYCKSRGLIVEAYAPLTHGYKINHPNVLRVAKEAGCNSGQVLIRWSLQHGYVPLPKT 244
           ELAD+CK +G++VEAYAPLTHG K+  P++++VA E GC+ GQ LIRWSLQ GY+PLPKT
Sbjct: 184 ELADFCKKKGILVEAYAPLTHGTKLKDPDLVKVANEVGCDVGQALIRWSLQKGYIPLPKT 243

Query: 245 KSVKRLPSNLDVYNIELTQEQMDFLDQPDAYEPTDWECTDAP 286
           +SV RL SNLDV++ E T +QMD LD+P AYEPTDWECT+AP
Sbjct: 244 QSVSRLASNLDVFSFEWTTDQMDQLDKPYAYEPTDWECTNAP 285

>Scas_691.5
          Length = 284

 Score =  426 bits (1096), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 192/282 (68%), Positives = 234/282 (82%)

Query: 5   AIPKAYKLSSGYTLPSIGLGTYDLPSNATSEIVYEALKCGYRHLDTAVLYGNEREVGEGI 64
           ++PK Y  ++G  +PSI LGTYD+P + T++IVYEALK GYRH DTAVLYGNE +VGEGI
Sbjct: 3   SVPKYYTFNNGNQIPSIALGTYDIPQSITAKIVYEALKAGYRHFDTAVLYGNEHQVGEGI 62

Query: 65  LKWLKENPSSNKREDVFYATKLWNSQNGYNNAKRAIQECFEKVEGLGYIDLLLIHSPLSG 124
           L+W++E+P  NKR DVFY TKLWNSQNGY+ A+ AI+EC  KV GL YID+LLIHSPL G
Sbjct: 63  LQWIQEDPQQNKRSDVFYTTKLWNSQNGYHQAQTAIKECLAKVHGLQYIDMLLIHSPLEG 122

Query: 125 SRKRLETYKAMQEAVDKGIVRSIGVSNYGVHHIDELLNWNELKYKPFVNQIEISPWLMRQ 184
             KRLET++AMQEAV+ G+V++IGVSNYG  H++ELL W  L  KP VNQIEISPW+MR 
Sbjct: 123 RTKRLETWRAMQEAVESGLVKNIGVSNYGRQHVEELLQWERLTIKPVVNQIEISPWVMRS 182

Query: 185 ELADYCKSRGLIVEAYAPLTHGYKINHPNVLRVAKEAGCNSGQVLIRWSLQHGYVPLPKT 244
           ELADYCKS GL+VEA+APLTHGYK++  +++RV+KE G ++ QVLIRWSLQHGY+PLPKT
Sbjct: 183 ELADYCKSVGLVVEAFAPLTHGYKLHDADLVRVSKEVGRSTVQVLIRWSLQHGYLPLPKT 242

Query: 245 KSVKRLPSNLDVYNIELTQEQMDFLDQPDAYEPTDWECTDAP 286
           K+VKRL  NL+ YN +LT EQM  +D PDAYEPTDWECTDAP
Sbjct: 243 KTVKRLEENLEAYNFQLTTEQMQLIDHPDAYEPTDWECTDAP 284

>Kwal_47.18893
          Length = 289

 Score =  267 bits (682), Expect = 4e-89,   Method: Compositional matrix adjust.
 Identities = 126/266 (47%), Positives = 182/266 (68%), Gaps = 3/266 (1%)

Query: 12  LSSGYTLPSIGLGTYDLPSNATSEIVYEALKCGYRHLDTAVLYGNEREVGEGILKWLKEN 71
           L++G  +P + LG Y+ P   T   V+ ALK GYRH+D A LYGNEREVG GI K+LKE 
Sbjct: 11  LTNGVKIPVLALGVYEAPKEETEHTVFTALKSGYRHVDCAQLYGNEREVGLGIAKFLKET 70

Query: 72  PSSNKREDVFYATKLWNSQNGYNNAKRAIQECFEKVEGLGYIDLLLIHSPLSGSRKRLET 131
           P+ + R ++FY TK+    +GY  AK++I +  E V+ + YIDLLLIH+P++ + +RL T
Sbjct: 71  PNVS-RSEIFYTTKVSGDNHGYEKAKKSIIKSLEDVKEIEYIDLLLIHNPIAATEERLGT 129

Query: 132 YKAMQEAVDKGIVRSIGVSNYGVHHIDELLNWNELKYKPFVNQIEISPWLMRQELADYCK 191
           +KA+QEA  +G VR+IGVSNY + H++EL NW  LK +P VNQ E++PWL R+EL +YC+
Sbjct: 130 WKALQEAYAEGKVRAIGVSNYSIKHLEELYNWEGLKVEPMVNQFELNPWLTRKELCEYCE 189

Query: 192 SRGLIVEAYAPLTHGYKINHPNVLRVAKEAGCNS--GQVLIRWSLQHGYVPLPKTKSVKR 249
            +G+++EA++PLT G K + P +  + K +  N    Q+LIRWSLQ G++PLPK+ + KR
Sbjct: 190 KKGMVLEAFSPLTRGQKFSDPQLQELIKTSYPNQTPAQILIRWSLQMGFIPLPKSSNSKR 249

Query: 250 LPSNLDVYNIELTQEQMDFLDQPDAY 275
             SNL   + E++ + M  L   D Y
Sbjct: 250 QISNLQALDFEISDKDMKALTHDDTY 275

>ABL209C [383] [Homologous to ScYJR096W - SH] (11410..12342) [933
           bp, 310 aa]
          Length = 310

 Score =  252 bits (644), Expect = 4e-83,   Method: Compositional matrix adjust.
 Identities = 117/265 (44%), Positives = 170/265 (64%), Gaps = 1/265 (0%)

Query: 11  KLSSGYTLPSIGLGTYDLPSNATSEIVYEALKCGYRHLDTAVLYGNEREVGEGILKWLKE 70
           +LS G  +PS+GLG Y +      ++VYEAL+ GYR  D+A  Y NE  V  GI  WLK 
Sbjct: 14  RLSDGTQIPSVGLGVYQVSEQTVQDLVYEALEVGYRLFDSAQAYHNEDGVARGIAAWLKH 73

Query: 71  NPSSNKREDVFYATKLWNSQNGYNNAKRAIQECFEKVEGLGYIDLLLIHSPLSGSRKRLE 130
            P   +REDV++ TK+    +GY   K+++++       LGYIDL+L+H+P+S   +RL 
Sbjct: 74  APG-RRREDVYFTTKINTQNHGYEATKKSLEKSLHAAGPLGYIDLVLVHAPMSDRTRRLG 132

Query: 131 TYKAMQEAVDKGIVRSIGVSNYGVHHIDELLNWNELKYKPFVNQIEISPWLMRQELADYC 190
           T++A++EAV +G VRSIGVSNYG  H+ ELL W  LK +P VNQ+EI+PWL RQEL  YC
Sbjct: 133 TWQALEEAVVEGQVRSIGVSNYGQQHLSELLGWEGLKIRPVVNQVEINPWLCRQELVQYC 192

Query: 191 KSRGLIVEAYAPLTHGYKINHPNVLRVAKEAGCNSGQVLIRWSLQHGYVPLPKTKSVKRL 250
           +   + V+A++PL  G +++ P + +VA +      Q+L+RWS+Q G++ LPK    +RL
Sbjct: 193 RENNIAVQAFSPLMRGKRLDDPILQKVAHQYDKGVAQILVRWSIQMGFIVLPKAAKKERL 252

Query: 251 PSNLDVYNIELTQEQMDFLDQPDAY 275
             N D+++ EL+ E M  L   D Y
Sbjct: 253 APNFDIWDFELSAETMSELTHSDDY 277

>Kwal_33.13276
          Length = 302

 Score =  237 bits (604), Expect = 3e-77,   Method: Compositional matrix adjust.
 Identities = 120/288 (41%), Positives = 185/288 (64%), Gaps = 17/288 (5%)

Query: 10  YKLSSGYTLPSIGLGTYDLPSNATSEIVYEALKCGYRHLDTAVLYGNEREVGEGILKWLK 69
           YKL++G  +P IG G Y++P   T+++VY ALK GYRH+DTAVLY N++E  +G+ K+L 
Sbjct: 13  YKLNNGQQIPVIGFGVYEIPKEDTADLVYSALKDGYRHIDTAVLYKNQKEAAQGVRKYLD 72

Query: 70  ENPSSNKREDVFYATKLWNSQNGYNNAKRAIQECFEKV-EGLGYIDLLLIHSPLSGSRKR 128
           E  +   RE++++ TKLW+SQ G    ++A+QE    V E +GY+DLLL+HSP  G+++R
Sbjct: 73  E--TGEARENIWFTTKLWDSQFGREETEKALQEVAADVKEYIGYVDLLLLHSPRGGAKRR 130

Query: 129 LETYKAMQEAVD----KGI-VRSIGVSNYGVHHIDELLNWNELKYKPFVNQIEISPWLMR 183
           LET+  +++AV     K + ++SIGVSN+GV H++ELL     K KP ++Q+E+ PWL R
Sbjct: 131 LETWAILEQAVQEPGSKALEIKSIGVSNFGVDHLEELLK--VAKVKPVLDQLELHPWLPR 188

Query: 184 QELADYCKSRGLIVEAYAPLTHGYKINHPNVLRVAKEAGCNSGQVLIRWSLQHGYVPLPK 243
            EL  Y K + +  EAY+PLT GY++  P +L +  + G N   +L+RWS   G+V L K
Sbjct: 189 VELRKYLKEKDIFAEAYSPLTQGYRLQDPELLALEAKTGINKAVILLRWSFLQGFVVLVK 248

Query: 244 TKSVKR-------LPSNLDVYNIELTQEQMDFLDQPDAYEPTDWECTD 284
           + + +R       LPS  D + +E+ ++    LD+P+A +   W   D
Sbjct: 249 SSNPERIRQNLAVLPSENDSWKVEIDEQLWKTLDKPEAKDVATWGQKD 296

>Scas_714.7
          Length = 322

 Score =  167 bits (424), Expect = 6e-50,   Method: Compositional matrix adjust.
 Identities = 97/287 (33%), Positives = 168/287 (58%), Gaps = 40/287 (13%)

Query: 9   AYKLSSGYTLPSIGLGTYDLPS-NATSEIVYEALKCGYRHLDTAVLYGNEREVGEGILKW 67
            +KL++G T+ ++GLGT+   + N   E V  ALK GYRH+DTA +YGNE +VG+ I   
Sbjct: 20  TFKLNTGATISAVGLGTWQSTNENEGYEAVIAALKAGYRHIDTAAIYGNEGQVGKAI--- 76

Query: 68  LKENPSSNKREDVFYATKLWNSQNGYNNAKRAIQECFEKVEGLGYIDLLLIHSPLS---- 123
              N S   RE++F  TKLW++Q  +++    + +  +++ GL Y+DL L+H P++    
Sbjct: 77  ---NDSGVPREEIFVTTKLWSTQ--HHDPAAGLNDSLKRL-GLDYVDLYLMHWPVTLNPR 130

Query: 124 ---------------GSRKR-------LETYKAMQEAVDKGIVRSIGVSNYGVHHIDELL 161
                          G R         ++T++ MQE    G  R++GVSN+ ++++ ++L
Sbjct: 131 SIKDGNFLSIPLLPDGKRDVEIDTWDYVKTWELMQELPKTGKTRAVGVSNFSINNLKKVL 190

Query: 162 NWNELKYKPFVNQIEISPWLMRQELADYCKSRGLIVEAYAPL--THGYKINHPNVLRVAK 219
           +    K  P VNQ+EI P L ++EL ++C S+G+++EAY+PL  T+   +  P ++ +AK
Sbjct: 191 SSPGNKVVPAVNQVEIHPLLPQEELLEWCHSKGILLEAYSPLGSTNAPILTEPVLINLAK 250

Query: 220 EAGCNSGQVLIRWSLQHGYVPLPKTKSVKRLPSNLDVYNIELTQEQM 266
           + G  + Q++I W +Q GY+ LPK+   +R+ +N     ++L+ E+M
Sbjct: 251 KHGVQTAQIVISWHVQRGYIVLPKSVHAERIQANFKT--LKLSDEEM 295

>CAGL0I01100g complement(91693..92625) highly similar to sp|P14065
           Saccharomyces cerevisiae YOR120w GCY1 or sp|Q12458
           Saccharomyces cerevisiae YDR368w YPR1, start by
           similarity
          Length = 310

 Score =  166 bits (420), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 100/277 (36%), Positives = 153/277 (55%), Gaps = 38/277 (13%)

Query: 11  KLSSGYTLPSIGLGTYDLPSNATSEIVYEALKCGYRHLDTAVLYGNEREVGEGILKWLKE 70
           KL++G  +P IGLGT+    N       EALK GYRH+DTA +Y NE E+G  I      
Sbjct: 12  KLNTGAHIPVIGLGTWQSSENEGYNATLEALKAGYRHIDTAAIYKNEEEIGRAI------ 65

Query: 71  NPSSNKREDVFYATKLWNSQNGYNNAKRAIQECFEKVEGLGYIDLLLIHSPLS------- 123
             S+  R ++F  TKLW +Q  + N   A+ +  +++ GL Y+DL L+H P++       
Sbjct: 66  RDSNIPRNELFVTTKLWGTQ--HRNPTEALDQSLKRL-GLDYVDLYLMHWPVALKTDLIK 122

Query: 124 ------------GSR-------KRLETYKAMQEAVDKGIVRSIGVSNYGVHHIDELLNWN 164
                       GSR         ++T++ MQE + K   R+IGVSN+ ++++ ELLN  
Sbjct: 123 DGNLLQIPEREDGSRDVDLEDWNFVKTWELMQE-LPKEKARAIGVSNFSINNLKELLNSK 181

Query: 165 ELKYKPFVNQIEISPWLMRQELADYCKSRGLIVEAYAPL--THGYKINHPNVLRVAKEAG 222
             K  P  NQIEI P L + EL ++CK +G+++EAY+PL  T    +    +  +AK+ G
Sbjct: 182 GNKVVPAANQIEIHPLLPQDELINFCKEKGIVLEAYSPLGSTDAPILKEEEITEIAKKNG 241

Query: 223 CNSGQVLIRWSLQHGYVPLPKTKSVKRLPSNLDVYNI 259
            N+GQ++I W  Q GYV LPK+   +R+  N + + +
Sbjct: 242 VNAGQLVISWHAQRGYVVLPKSVKPERIHGNQETFKL 278

>YOR120W (GCY1) [4923] chr15 (551114..552052) Aldo-keto reductase,
           induced by galactose, has strong similarity to
           crystallin protein of vertebrate eye lens [939 bp, 312
           aa]
          Length = 312

 Score =  165 bits (417), Expect = 5e-49,   Method: Compositional matrix adjust.
 Identities = 97/280 (34%), Positives = 153/280 (54%), Gaps = 37/280 (13%)

Query: 8   KAYKLSSGYTLPSIGLGTYDLPSNATSEIVYEALKCGYRHLDTAVLYGNEREVGEGILKW 67
           K   L++G  +P IGLGT+    N   + V  ALK GYRH+DTA +Y NE +VG+ I   
Sbjct: 10  KILSLNTGAQIPQIGLGTWQSKENDAYKAVLTALKDGYRHIDTAAIYRNEDQVGQAI--- 66

Query: 68  LKENPSSNKREDVFYATKLWNSQNGYNNAKRAIQECFEKVEGLGYIDLLLIHSPL----- 122
                S   RE++F  TKLW +Q  ++  + A+ +  +++ GL Y+DL L+H P      
Sbjct: 67  ---KDSGVPREEIFVTTKLWCTQ--HHEPEVALDQSLKRL-GLDYVDLYLMHWPARLDPA 120

Query: 123 --------------SGSR-------KRLETYKAMQEAVDKGIVRSIGVSNYGVHHIDELL 161
                          GSR         ++T++ MQE    G  +++GVSN+ ++++ +LL
Sbjct: 121 YIKNEDILSVPTKKDGSRAVDITNWNFIKTWELMQELPKTGKTKAVGVSNFSINNLKDLL 180

Query: 162 NWNELKYKPFVNQIEISPWLMRQELADYCKSRGLIVEAYAPL--THGYKINHPNVLRVAK 219
                K  P  NQ+EI P L + EL ++CKS+G++VEAY+PL  T    +  P +L +AK
Sbjct: 181 ASQGNKLTPAANQVEIHPLLPQDELINFCKSKGIVVEAYSPLGSTDAPLLKEPVILEIAK 240

Query: 220 EAGCNSGQVLIRWSLQHGYVPLPKTKSVKRLPSNLDVYNI 259
           +     G V+I W +Q GYV LPK+ +  R+ +N  ++ +
Sbjct: 241 KNNVQPGHVVISWHVQRGYVVLPKSVNPDRIKTNRKIFTL 280

>KLLA0B14707g complement(1291951..1292883) similar to sp|P14065
           Saccharomyces cerevisiae YOR120w GCY1 galactose-induced
           protein of aldo/keto reductase family, start by
           similarity
          Length = 310

 Score =  163 bits (412), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 100/299 (33%), Positives = 159/299 (53%), Gaps = 39/299 (13%)

Query: 1   MNTKAIPKAYKLSSGYTLPSIGLGTYDLPSNATSEIVYEALKCGYRHLDTAVLYGNEREV 60
           M+T     + KL++G ++P +GLGT+  P       V  AL+ GYRH+DTA +YGNE  V
Sbjct: 1   MSTSNESPSLKLNTGASIPVVGLGTWKSPEEDAYNAVVSALQNGYRHIDTAAIYGNEEAV 60

Query: 61  GEGILKWLKENPSSNKREDVFYATKLWNSQNGYNNAKRAIQECFEKVEGLGYIDLLLIH- 119
           G+GI        S   RE++F  TKLW +Q    + + A+    +++ GL Y+DL LIH 
Sbjct: 61  GKGI------RDSGVPREEIFVTTKLWGTQQ--RDPEAALDLSLQRL-GLDYVDLYLIHW 111

Query: 120 -SPLSGSR------------------------KRLETYKAMQEAVDKGIVRSIGVSNYGV 154
             PL+ S                           ++T++ MQ     G  ++IGVSN+ +
Sbjct: 112 PVPLNASSITDGNYLTFPRTADGKIDIDIEEWNFIKTWEKMQHLPKSGKTKAIGVSNFSI 171

Query: 155 HHIDELLNWNELKYKPFVNQIEISPWLMRQELADYCKSRGLIVEAYAPL--THGYKINHP 212
            +I+ LL  N     P  NQIEI P L + EL DYCKS+G+++EAY+PL  +    +  P
Sbjct: 172 KNIEALLAANPDFIVPAANQIEIHPQLPQTELIDYCKSKGILIEAYSPLGSSSSTILTDP 231

Query: 213 NVLRVAKEAGCNSGQVLIRWSLQHGYVPLPKTKSVKRLPSNLDVYNIELTQEQMDFLDQ 271
            +  +A +       +LI W    GYV LPK+ + +R+ +NL +  ++L+ E ++ +++
Sbjct: 232 TIEGIASKYNAEPANILISWGASRGYVVLPKSVNPQRIKTNLKL--LDLSTEDLEKINK 288

>KLLA0D10109g 854495..855424 similar to sp|P14065 Saccharomyces
           cerevisiae YOR120w GCY1 galactose-induced protein of
           aldo/keto reductase family, start by similarity
          Length = 309

 Score =  162 bits (410), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 96/271 (35%), Positives = 142/271 (52%), Gaps = 35/271 (12%)

Query: 9   AYKLSSGYTLPSIGLGTYDLPSNATSEIVYEALKCGYRHLDTAVLYGNEREVGEGILKWL 68
           + KL++G ++P +G GT+          V  ALK GYRH+D A +YGNE  VG+GI    
Sbjct: 10  SLKLNTGASIPQLGFGTWPSSHADAYTAVITALKTGYRHIDAAAMYGNEAAVGKGIRD-- 67

Query: 69  KENPSSNKREDVFYATKLWNSQNGYNNAKRAIQECFEKVEGLGYIDLLLIH-----SPLS 123
               S   RE++F  TKLWN+Q    +   A+ E  E++ GL Y+DL LIH      P+ 
Sbjct: 68  ----SGIPREEIFVTTKLWNTQQ--RDPASALDESLERL-GLDYVDLFLIHWPVPLKPVG 120

Query: 124 GSRKRLE-------------------TYKAMQEAVDKGIVRSIGVSNYGVHHIDELLNWN 164
           G    L+                   T++ MQ     G  R++GVSN+ + ++++LLN +
Sbjct: 121 GPENLLKYPTPGIKPQIDTEDWSFIKTWELMQTLPKTGKTRAVGVSNFSIKNLEDLLNSS 180

Query: 165 ELKYKPFVNQIEISPWLMRQELADYCKSRGLIVEAYAPL--THGYKINHPNVLRVAKEAG 222
                P VNQ EI P L + EL +YCKS+G++VEAY PL  +    ++ P +  +A +  
Sbjct: 181 PDVLVPAVNQFEIHPQLPQTELINYCKSKGIVVEAYCPLGSSSSAMLSDPTIAEIADKYH 240

Query: 223 CNSGQVLIRWSLQHGYVPLPKTKSVKRLPSN 253
                VLI W +  GY  LPK+ +  R+ SN
Sbjct: 241 VKPANVLINWGISRGYCVLPKSFTPARIASN 271

>Sklu_1828.2 YDR368W, Contig c1828 3683-4621 reverse complement
          Length = 312

 Score =  162 bits (410), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 98/285 (34%), Positives = 157/285 (55%), Gaps = 39/285 (13%)

Query: 11  KLSSGYTLPSIGLGTYDLPSNATSEIVYEALKCGYRHLDTAVLYGNEREVGEGILKWLKE 70
           KL++G  +P +GLGT+          V  A+K GYRH+D+A +YGNE  VG+ I      
Sbjct: 13  KLNTGAIIPQLGLGTWRSSDEEAYNSVLSAIKLGYRHIDSAAIYGNEEPVGKAI------ 66

Query: 71  NPSSNKREDVFYATKLWNSQNGYNNAKRAIQECFEKVEGLGYIDLLLIHSPLSGSRKRLE 130
             S   R ++F  TKLW +Q    N ++A+    +++ GL Y+DL LIH P++     ++
Sbjct: 67  RDSGVPRNELFVTTKLWGTQQ--RNPEKALDASLKRL-GLDYVDLYLIHWPIAFKTDNIK 123

Query: 131 --------------------------TYKAMQEAVDKGIVRSIGVSNYGVHHIDELLNWN 164
                                     T++ +QE    G  +++GVSN+ V+++ ELL   
Sbjct: 124 DDDYLTVPTGKDGKADVDVKDWNFVKTWELVQELPATGKAKAVGVSNFSVNNLKELLASP 183

Query: 165 ELKYKPFVNQIEISPWLMRQELADYCKSRGLIVEAYAPL-THGYK-INHPNVLRVAKEAG 222
             K  P  NQ+E+ P L + EL ++ KS+G+++EAY+PL ++G   +  P ++ VAK+ G
Sbjct: 184 GNKLVPACNQVELHPLLPQDELIEFSKSKGIVIEAYSPLGSNGSPLLKEPVIIEVAKKYG 243

Query: 223 CNSGQVLIRWSLQHGYVPLPKTKSVKRLPSNLDVYNIELTQEQMD 267
               QVLI W +Q GYV LPK+ + KR+ SN  V+  +L++E +D
Sbjct: 244 VEPAQVLINWGIQRGYVILPKSVNPKRVESNFKVF--DLSKEDVD 286

>CAGL0A02816g 292159..293091 highly similar to tr|Q12458
           Saccharomyces cerevisiae YDR368w YPR1, hypothetical
           start
          Length = 310

 Score =  160 bits (406), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 95/297 (31%), Positives = 160/297 (53%), Gaps = 39/297 (13%)

Query: 1   MNTKAIPKAYKLSSGYTLPSIGLGTYDLPSNATSEIVYEALKCGYRHLDTAVLYGNEREV 60
           M+ K      KL++G  +P +GLGT+   +N   + V  ALK GYRH+D A +YGNE +V
Sbjct: 1   MSLKNSTATLKLNTGAEIPVVGLGTWRSAANDGYDSVLAALKLGYRHIDAAAIYGNEDQV 60

Query: 61  GEGILKWLKENPSSNKREDVFYATKLWNSQNGYNNAKRAIQECFEKVEGLGYIDLLLIHS 120
           G  I        S   R+++F  TKLW ++  + N  +A+    +++ GL Y+DL L+H 
Sbjct: 61  GRAI------KDSGVPRQEIFITTKLWGTE--HRNPAKALDSSLKRL-GLDYVDLYLMHW 111

Query: 121 PLS----GSRKR----------------------LETYKAMQEAVDKGIVRSIGVSNYGV 154
           P++    GS ++                      ++T++ MQE    G  ++IGVSN+ +
Sbjct: 112 PVALKAHGSEEKDLLNIPKKPDGKTDIDIEDWDFIKTWELMQELPKTGKTKAIGVSNFSI 171

Query: 155 HHIDELLNWNELKYKPFVNQIEISPWLMRQELADYCKSRGLIVEAYAPL--THGYKINHP 212
           +++  L N  +    P  NQ+EI P   + EL +YCKS  +++EAY+P        +  P
Sbjct: 172 NNLKALKNSPKFNTVPAANQVEIHPLFPQTELIEYCKSENILIEAYSPFGSADAPVLKEP 231

Query: 213 NVLRVAKEAGCNSGQVLIRWSLQHGYVPLPKTKSVKRLPSNLDVYNIELTQEQMDFL 269
            + ++A++   ++ Q++I WS+Q GYV LPK+   +R+ +NL V  + L  E M+ +
Sbjct: 232 ELHKLAEKYNISTAQLIISWSVQRGYVVLPKSVHAERIEANLKV--LTLKDEDMETI 286

>CAGL0I01122g 93934..94914 highly similar to sp|P38715 Saccharomyces
           cerevisiae YHR104w GRE3 aldose reductase, start by
           similarity
          Length = 326

 Score =  159 bits (401), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 100/316 (31%), Positives = 167/316 (52%), Gaps = 52/316 (16%)

Query: 12  LSSGYTLPSIGLGTYDLPSNATSEIVYEALKCGYRHLDTAVLYGNEREVGEGILKWLKEN 71
           L++G  +P +GLG + +P++  ++ VY+A+K GYR  D A  YGNE+EVG+GI K + E 
Sbjct: 7   LNNGLKMPLVGLGCWKIPNDVCAQQVYDAIKIGYRLFDGAEDYGNEKEVGQGIRKAIDEG 66

Query: 72  PSSNKREDVFYATKLWNSQNGYNNAKRAIQECFEKVEGLGYIDLLLIHSPL--------- 122
               KREDVF  +KLWNS +  ++ K A++     + GL Y+DL  IH P+         
Sbjct: 67  VV--KREDVFVVSKLWNSFHHPDHVKMALKRTLSDM-GLDYLDLFYIHFPIAFKYVPFEE 123

Query: 123 -------SGSRKR------------LETYKAMQEAVDKGIVRSIGVSNYGVHHIDELLNW 163
                  +G                ++TY+A+++ V++G+++SIG+SN+    + +LL  
Sbjct: 124 KYPPGFYTGKEDEKNGHITEAHVPIIDTYRALEQCVEEGLIKSIGISNFSGSLVQDLL-- 181

Query: 164 NELKYKPFVNQIEISPWLMRQELADYCKSRGLIVEAYAP--------LTHGYKINHPNVL 215
            + K KP   Q+E  P+L ++ L +YCK  G+ V AY+         L H    N PN+ 
Sbjct: 182 RQCKIKPVALQVEHHPYLTQEHLVEYCKDNGIQVVAYSSFGPQSYIELNHPLAKNTPNLF 241

Query: 216 ------RVAKEAGCNSGQVLIRWSLQHGYVPLPKTKSVKRLPSNLDV-YNIELTQEQMDF 268
                 ++A      + QVL+RW+ Q G   +PK+   +RL  NL +   + LT ++++ 
Sbjct: 242 HHDTIKQIANNHNVATSQVLLRWATQRGIAIIPKSSKKERLQDNLMIDEKLTLTHKELEA 301

Query: 269 LDQPDA----YEPTDW 280
           + + +      +P DW
Sbjct: 302 ISKLNKNLRLNDPWDW 317

>Sklu_1971.3 YHR104W, Contig c1971 5146-6135
          Length = 329

 Score =  158 bits (400), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 99/294 (33%), Positives = 155/294 (52%), Gaps = 47/294 (15%)

Query: 5   AIPKAYKLSSGYTLPSIGLGTYDLPSNATSEIVYEALKCGYRHLDTAVLYGNEREVGEGI 64
           A+ K   L++G  +P IGLG + +P++  +  VYEA+K GYR  D A  YGNE+EVG+GI
Sbjct: 3   ALSKTVTLNNGLEMPLIGLGCWKIPNDVCASQVYEAIKLGYRLFDGAQDYGNEKEVGQGI 62

Query: 65  LKWLKENPSSNKREDVFYATKLWNSQNGYNNAKRAIQECFEKVEGLGYIDLLLIHSPL-- 122
            K + E     KRED+F  +KLWNS +  +N K A+++  + + GL Y+DL  IH PL  
Sbjct: 63  KKAIAEGIV--KREDLFVVSKLWNSFHHPDNVKLALKKTLDDI-GLDYLDLFYIHFPLAF 119

Query: 123 --------------SGSRKR------------LETYKAMQEAVDKGIVRSIGVSNYGVHH 156
                         +G+               ++TY+A+++ VD+G+++SIG+SN+    
Sbjct: 120 KFVPFEEKYPPGFYTGAEDEKNGVISQEDVPLIDTYRALEKCVDEGLIKSIGISNFNGSL 179

Query: 157 IDELLNWNELKYKPFVNQIEISPWLMRQELADYCKSRGLIVEAYAP--------LTHGYK 208
           + +LL    +  KP   QIE  P+L ++ L  YCK+ G+ V AY+         L     
Sbjct: 180 VQDLLRGARI--KPVALQIEHHPYLTQENLVKYCKNVGIQVVAYSSFGPQSFIELDSELA 237

Query: 209 INHPNVLR------VAKEAGCNSGQVLIRWSLQHGYVPLPKTKSVKRLPSNLDV 256
              P + R      +A     ++ QVL+RW+ Q G   +PK+   +RL  NL +
Sbjct: 238 KTTPTLFRNDTVKLIANNHKVSTSQVLLRWATQRGVAVIPKSSKKERLLENLTI 291

>YDR368W (YPR1) [1194] chr4 (1213892..1214830) 2-methylbutyraldehyde
           reductase induced by osmotic and oxidative stress,
           member of the aldo/keto reductase family, plays a role
           in arabinose catabolism and may play a general role in
           reducing pentose sugars [939 bp, 312 aa]
          Length = 312

 Score =  154 bits (390), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 91/277 (32%), Positives = 146/277 (52%), Gaps = 37/277 (13%)

Query: 11  KLSSGYTLPSIGLGTYDLPSNATSEIVYEALKCGYRHLDTAVLYGNEREVGEGILKWLKE 70
           KL++G ++P +G GT+    N     V  ALK GYRH+D A +Y NE EVG  I      
Sbjct: 13  KLNTGASIPVLGFGTWRSVDNNGYHSVIAALKAGYRHIDAAAIYLNEEEVGRAI------ 66

Query: 71  NPSSNKREDVFYATKLWNSQNGYNNAKRAIQECFEKVEGLGYIDLLLIHSPLSGSRKR-- 128
             S   RE++F  TKLW ++    + + A+ +  +++ GL Y+DL L+H P+     R  
Sbjct: 67  KDSGVPREEIFITTKLWGTEQ--RDPEAALNKSLKRL-GLDYVDLYLMHWPVPLKTDRVT 123

Query: 129 ------------------------LETYKAMQEAVDKGIVRSIGVSNYGVHHIDELLNWN 164
                                   ++T++ MQE    G  +++GVSN+ +++I ELL   
Sbjct: 124 DGNVLCIPTLEDGTVDIDTKEWNFIKTWELMQELPKTGKTKAVGVSNFSINNIKELLESP 183

Query: 165 ELKYKPFVNQIEISPWLMRQELADYCKSRGLIVEAYAPL--THGYKINHPNVLRVAKEAG 222
             K  P  NQIEI P L + EL  +CK +G++VEAY+P    +   +    ++ +AK+ G
Sbjct: 184 NNKVVPATNQIEIHPLLPQDELIAFCKEKGIVVEAYSPFGSANAPLLKEQAIIDMAKKHG 243

Query: 223 CNSGQVLIRWSLQHGYVPLPKTKSVKRLPSNLDVYNI 259
               Q++I WS+Q GYV L K+ + +R+ SN  ++ +
Sbjct: 244 VEPAQLIISWSIQRGYVVLAKSVNPERIVSNFKIFTL 280

>Kwal_47.18084
          Length = 309

 Score =  153 bits (386), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 93/277 (33%), Positives = 144/277 (51%), Gaps = 36/277 (12%)

Query: 11  KLSSGYTLPSIGLGTYDLPSNATSEIVYEALKCGYRHLDTAVLYGNEREVGEGILKWLKE 70
           KL++G T+P +G GT+          V  A+K GYRH+D+A +YGNE  VG  I      
Sbjct: 12  KLNTGATIPLLGFGTWRSTEEEGYNAVLSAIKDGYRHIDSAAVYGNEAAVGRAI------ 65

Query: 71  NPSSNKREDVFYATKLWNSQNGYNNAKRAIQECFEKVEGLGYIDLLLIHSPLSGSRKRL- 129
             S   RE++F  TKLWN+Q       +A+ +  +++ GL Y+DL LIH PL     R+ 
Sbjct: 66  RDSGVPREELFVTTKLWNTQQ--REPAKALDQSLQRL-GLDYVDLYLIHWPLPIKTDRIT 122

Query: 130 ------------------------ETYKAMQEAVDKGIVRSIGVSNYGVHHIDELLNWNE 165
                                   +T++ MQE    G  R++GVSN  V  +++LL    
Sbjct: 123 DGNLFSIPTKEDGKPDVDTEWDYIKTWQLMQELPSTGKTRAVGVSNVSVSQLEKLLADKG 182

Query: 166 LKYKPFVNQIEISPWLMRQELADYCKSRGLIVEAYAPL-THGYK-INHPNVLRVAKEAGC 223
            K  P V Q+E  P L + +L D+C    +++EAY+PL + G   I+ P +  +AK+   
Sbjct: 183 NKVVPAVCQVETHPLLPQNKLLDFCTKHDILLEAYSPLGSQGSPLIDEPVIKEIAKKYNA 242

Query: 224 NSGQVLIRWSLQHGYVPLPKTKSVKRLPSNLDVYNIE 260
           +  Q++I W ++ GYV LPK+ +  R+ SNL   ++E
Sbjct: 243 DPAQIIISWDIKRGYVVLPKSVTPSRIKSNLQTLDLE 279

>Kwal_55.21536
          Length = 329

 Score =  152 bits (384), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 96/288 (33%), Positives = 149/288 (51%), Gaps = 47/288 (16%)

Query: 11  KLSSGYTLPSIGLGTYDLPSNATSEIVYEALKCGYRHLDTAVLYGNEREVGEGILKWLKE 70
           KL++G  +P +GLG + +P+   +  VYEA+K GYR  D A  YGNE+EVG+GI K + E
Sbjct: 9   KLNNGLQMPLVGLGCWKIPNEVCASQVYEAIKLGYRLFDGAQDYGNEKEVGQGIHKAIDE 68

Query: 71  NPSSNKREDVFYATKLWNSQNGYNNAKRAIQECFEKVEGLGYIDLLLIHSPL-------- 122
                KRED+F  +KLWNS +   N K+A++   E +E L Y+DL  IH PL        
Sbjct: 69  GIV--KREDLFVVSKLWNSYHDPKNVKKALKRTLEDME-LEYLDLFYIHFPLAFKYVPFE 125

Query: 123 --------SGSRKR------------LETYKAMQEAVDKGIVRSIGVSNYGVHHIDELLN 162
                   +G+               ++TY+A++E V +G+++SIG+SN+    I +LL 
Sbjct: 126 EKYPPGFYTGAEDAKKGVISLEQVPIIDTYRALEECVKEGLIKSIGISNFRGILIHDLLA 185

Query: 163 WNELKYKPFVNQIEISPWLMRQELADYCKSRGLIVEAYAPL--------------THGYK 208
              +  KP   QIE  P+L +++L +YC    + V AY+                +    
Sbjct: 186 GATI--KPVCLQIEHHPYLTQEKLIEYCAQEQIQVVAYSSFGPQSFLELDSELAKSTPTL 243

Query: 209 INHPNVLRVAKEAGCNSGQVLIRWSLQHGYVPLPKTKSVKRLPSNLDV 256
             H  + ++A   G +S QVL+RW+ Q     +PK+   +RL  NL +
Sbjct: 244 FEHEGIQKIATNHGVSSSQVLLRWATQRRIAIIPKSSKKERLLDNLQI 291

>ACL107C [942] [Homologous to ScYHR104W (GRE3) - SH]
           (152564..153628) [1065 bp, 354 aa]
          Length = 354

 Score =  149 bits (376), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 97/298 (32%), Positives = 151/298 (50%), Gaps = 51/298 (17%)

Query: 1   MNTKAIPKAYKLSSGYTLPSIGLGTYDLPSNATSEIVYEALKCGYRHLDTAVLYGNEREV 60
           MN + I    KL++G  +P +GLG + +P+   +E VYEA+K GYR LD A  Y NEREV
Sbjct: 28  MNVRTI----KLNNGADMPLVGLGCWKIPNEVAAEQVYEAIKLGYRLLDGAEDYANEREV 83

Query: 61  GEGILKWLKENPSSNKREDVFYATKLWNSQNGYNNAKRAIQECFEKVEGLGYIDLLLIHS 120
           G+GI + + E     +RE++F  +KLWN+ +   +  +A+Q     + GL Y+DL  IH 
Sbjct: 84  GQGIRRAIDEGLV--RREELFVVSKLWNNYHRPEDVGKALQRTLSDL-GLDYLDLFYIHF 140

Query: 121 PL----------------SGSRKR------------LETYKAMQEAVDKGIVRSIGVSNY 152
           PL                +G+               +ETY+A+++ VD+G +R+IG+SN+
Sbjct: 141 PLAFKFVPLEERYPAGLYTGAADEQAGRLAQEPVPLIETYRALEQLVDEGRIRAIGLSNF 200

Query: 153 GVHHIDELLNWNELKYKPFVNQIEISPWLMRQELADYCKSRGLIVEAYAPL--------- 203
               + +LL     + +P   QIE  P+L ++ L  Y KS GL V  Y+ L         
Sbjct: 201 QGCLVQDLLRG--CRIRPAALQIEHHPYLTQERLVQYAKSEGLAVVGYSSLGPQSFLELG 258

Query: 204 -----THGYKINHPNVLRVAKEAGCNSGQVLIRWSLQHGYVPLPKTKSVKRLPSNLDV 256
                     + H  V R+A+       +VL+RW+ Q     +PK+   +RL +NL V
Sbjct: 259 NTAAQNAAPLLQHEVVCRIAERHTATPAEVLLRWATQRDIAVIPKSSRKERLATNLRV 316

>Sklu_2408.8 , Contig c2408 19753-20721 reverse complement
          Length = 322

 Score =  145 bits (367), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 96/292 (32%), Positives = 160/292 (54%), Gaps = 41/292 (14%)

Query: 10  YKLSSGYTLPSIGLGTYDLPSNA--TSEIVYEALKCGYRHLDTAVLYGNEREVGEGILKW 67
           + L++G  +PS+GLGT + P     T + V  A+K GYR +DTA +YG+E  +GE + + 
Sbjct: 11  FNLNTGAKIPSLGLGTVNPPEKMPQTKDAVKHAVKNGYRLIDTAWMYGSEPYIGEALQEL 70

Query: 68  LKENPSSNKREDVFYATKLWNSQNGYNNAKRAIQECFEKVEGLGYIDLLLIHSPLSGSRK 127
            +E     KRED+F  TK+W     YN  ++++QE  ++++ L Y+DLLL H PL   ++
Sbjct: 71  FEE--GVVKREDLFITTKVWPCH--YNTVEQSLQESLKQLK-LDYVDLLLQHWPLCFVKQ 125

Query: 128 RLETYKAMQEAVD----------------------------KGIVRSIGVSNYGVHHIDE 159
             E  K     VD                             G VR+IGVSNY V +++ 
Sbjct: 126 YDEHGKLKSHPVDPKSGDIVLDEKGDYLTTWKQLEKVYKDGSGRVRNIGVSNYPVEYLER 185

Query: 160 LLNWNELKYKPFVNQIEISPWLMRQELADYCKSRGLIVEAYAPL--THGYKINHPNVLRV 217
           LL   E+   P +NQ+E+ P L ++EL++YC S G+++E+++PL  +    + HP V  +
Sbjct: 186 LLKETEVV--PVLNQVELHPLLPQEELSEYCNSHGILMESFSPLGSSGTPHLEHPLVKEL 243

Query: 218 AKEAGCNSGQVLIRWSLQHGYVPLPKTKSVKRLPSNLDVYNIELTQEQMDFL 269
           +K+  C  G VL+ + ++ G V +P++ +  R+  N D   + L++E +D L
Sbjct: 244 SKKYDCEPGSVLLNYHVRKGNVVVPRSLNHGRIIKNADF--VALSEEDLDKL 293

>Scas_688.12
          Length = 326

 Score =  145 bits (365), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 97/328 (29%), Positives = 172/328 (52%), Gaps = 52/328 (15%)

Query: 6   IPKAYKLSSGYTLPSIGLGTYDLPSNATSEIVYEALKCGYRHLDTAVLYGNEREVGEGIL 65
           +PK   L++G  +P +GLG + +P++  ++ VYEA+K GYR  D A  Y NE EVG+G+ 
Sbjct: 1   MPKLLTLNNGMKMPQVGLGCWKIPNDICADQVYEAIKAGYRLFDGATDYANEVEVGKGLK 60

Query: 66  KWLKENPSSNKREDVFYATKLWNSQNGYNNAKRAIQECFEKVEGLGYIDLLLIHSPL--- 122
           + + +     KR+D+F  +KLWN+ +  ++ K  ++   + + GL Y+DL  IH P+   
Sbjct: 61  RAMDDGIV--KRQDLFVVSKLWNNFHHPDHVKLNLKRNLKDL-GLDYLDLYYIHFPIAFK 117

Query: 123 -------------SGSRKR------------LETYKAMQEAVDKGIVRSIGVSNYGVHHI 157
                        +G                L+TY+A++E   +G+++SIG+SN+    +
Sbjct: 118 FVPMEERYPPQMYTGKADEAKGILTEENVPLLDTYRALEECQREGLIKSIGISNFNGGLV 177

Query: 158 DELLNWNELKYKPFVNQIEISPWLMRQELADYCKSRGLIVEAYAPL------THGYKI-- 209
            ++L    +  KP   QIE  P+L +++L +YCK   + V  Y+          G  +  
Sbjct: 178 ADILRGCSI--KPVALQIEHHPYLTQEKLLEYCKIHDVQVVGYSSFGPQSFADCGMDLAK 235

Query: 210 ------NHPNVLRVAKEAGCNSGQVLIRWSLQHGYVPLPKTKSVKRLPSNLDV-YNIELT 262
                 +HP + ++A++   ++ +VL+RW+ Q G   +PK+   KRL SNL++  N+ LT
Sbjct: 236 NTPPLFDHPVIKKIAEKHNVSTAEVLLRWATQRGVAIIPKSSHKKRLLSNLNIDDNVTLT 295

Query: 263 QEQMDF---LDQPDAY-EPTDWECTDAP 286
           +E +     L+Q   + +P DW  +  P
Sbjct: 296 EEDLKSISGLNQNLRFNDPWDWNNSKFP 323

>YHR104W (GRE3) [2392] chr8 (323411..324394) Aldo/keto reductase
           with NADPH specificity, induced by osmotic stress, plays
           roles in methylglyoxal and arabinose catabolism and may
           play a general role in reducing pentose sugars [984 bp,
           327 aa]
          Length = 327

 Score =  142 bits (357), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 95/301 (31%), Positives = 154/301 (51%), Gaps = 53/301 (17%)

Query: 12  LSSGYTLPSIGLGTYDLPSNATSEIVYEALKCGYRHLDTAVLYGNEREVGEGILKWLKEN 71
           L++G  +P +GLG + +     +  +YEA+K GYR  D A  YGNE+EVGEGI K + E 
Sbjct: 7   LNNGLKMPLVGLGCWKIDKKVCANQIYEAIKLGYRLFDGACDYGNEKEVGEGIRKAISEG 66

Query: 72  PSSNKREDVFYATKLWNSQNGYNNAKRAIQECFEKVEGLGYIDLLLIHSPL--------- 122
             S  R+D+F  +KLWN+ +  ++ K A+++    + GL Y+DL  IH P+         
Sbjct: 67  LVS--RKDIFVVSKLWNNFHHPDHVKLALKKTLSDM-GLDYLDLYYIHFPIAFKYVPFEE 123

Query: 123 -------SGSRKR------------LETYKAMQEAVDKGIVRSIGVSNYGVHHIDELLNW 163
                  +G+               ++TY+A++E VD+G+++SIGVSN+    I +LL  
Sbjct: 124 KYPPGFYTGADDEKKGHITEAHVPIIDTYRALEECVDEGLIKSIGVSNFQGSLIQDLL-- 181

Query: 164 NELKYKPFVNQIEISPWLMRQELADYCKSRGLIVEAYAPLTHGYKINHPNVLRVAKEA-- 221
              + KP   QIE  P+L ++ L ++CK   + V AY+       I     L++AK    
Sbjct: 182 RGCRIKPVALQIEHHPYLTQEHLVEFCKLHDIQVVAYSSFGPQSFIEMD--LQLAKTTPT 239

Query: 222 ---------------GCNSGQVLIRWSLQHGYVPLPKTKSVKRLPSNLDV-YNIELTQEQ 265
                          G  + QVL+RW+ Q G   +PK+   +RL  NL++     LT+++
Sbjct: 240 LFENDVIKKVSQNHPGSTTSQVLLRWATQRGIAVIPKSSKKERLLGNLEIEKKFTLTEQE 299

Query: 266 M 266
           +
Sbjct: 300 L 300

>Scas_676.4
          Length = 313

 Score =  140 bits (353), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 86/284 (30%), Positives = 147/284 (51%), Gaps = 36/284 (12%)

Query: 4   KAIPKAYKLSSGYTLPSIGLGTY-DLPSNATSEIVYEALKCGYRHLDTAVLYGNEREVGE 62
           KA     KL++G  +P I LGT+  L +    + V  ALK GYRH+DTA +YGNE +VG+
Sbjct: 6   KASTATLKLNTGANIPEISLGTWRSLGATDGYDSVIAALKAGYRHIDTAAIYGNEDQVGK 65

Query: 63  GILKWLKENPSSNKREDVFYATKLWNSQNGYNNAKRAIQECFEK---------------- 106
            I        S   RE++F  +KLWN+Q   +N   A+++   +                
Sbjct: 66  AI------RDSGIPREEIFVTSKLWNTQQ--HNPAGALKDTLSRLGLDYLDLYLMHWPVT 117

Query: 107 --VEGLGYIDLLLIHSPLSG-------SRKRLETYKAMQEAVDKGIVRSIGVSNYGVHHI 157
                +   D ++I    +G       +   ++T++ MQE    G+ +++GVSN+ ++++
Sbjct: 118 FNTRNVKGTDFMVIPKNENGKPDIEMDTWNFVKTWELMQELPATGMTKAVGVSNFSINNL 177

Query: 158 DELLNWNELKYKPFVNQIEISPWLMRQELADYCKSRGLIVEAYAPL--THGYKINHPNVL 215
            ELL     K  P  NQIEI P L   +L  +C+ +G+++EAY+PL   +   +  P ++
Sbjct: 178 KELLTSPGNKLTPAANQIEIHPLLPEHDLIKFCREKGIMIEAYSPLGSINAPILKEPKII 237

Query: 216 RVAKEAGCNSGQVLIRWSLQHGYVPLPKTKSVKRLPSNLDVYNI 259
            ++K+      Q++I W +Q GYV L K+   +R+ +N  V+ +
Sbjct: 238 EISKKLDVPPAQLIISWHVQRGYVVLVKSTHEERIIANRKVFTL 281

>KLLA0E21714g complement(1929294..1930283)
           gi|1351442|sp|P49378|XYL1_KLULA Kluyveromyces lactis
           NAD(P)H-dependent xylose reductase, start by similarity
          Length = 329

 Score =  140 bits (352), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 91/298 (30%), Positives = 156/298 (52%), Gaps = 48/298 (16%)

Query: 12  LSSGYTLPSIGLGTYDLPSNATSEIVYEALKCGYRHLDTAVLYGNEREVGEGILKWLKEN 71
           L++G  +P +GLG + +P++  ++ +YEA+K GYR  D A  Y NE+EVG+G+ + +KE 
Sbjct: 10  LNNGEKMPLVGLGCWKMPNDVCADQIYEAIKIGYRLFDGAQDYANEKEVGQGVNRAIKEG 69

Query: 72  PSSNKREDVFYATKLWNSQNGYNNAKRAIQECFEKVEGLGYIDLLLIHSPL--------- 122
               KRED+   +KLWNS +  +N  RA++     ++ L Y+D+  IH PL         
Sbjct: 70  LV--KREDLVVVSKLWNSFHHPDNVPRALERTLSDLQ-LDYVDIFYIHFPLAFKPVPFDE 126

Query: 123 -------SGSRKR------------LETYKAMQEAVDKGIVRSIGVSNYGVHHIDELLNW 163
                  +G                L+T++A+++ VD+G ++S+G+SN+    I +LL  
Sbjct: 127 KYPPGFYTGKEDEAKGHIEEEQVPLLDTWRALEKLVDQGKIKSLGISNFSGALIQDLLRG 186

Query: 164 NELKYKPFVNQIEISPWLMRQELADYCKSRGLIVEAYAP--------LTHGYKINHPNVL 215
             +  KP   QIE  P+L ++ L  Y K+ G+ V AY+         L +   +N P + 
Sbjct: 187 ARI--KPVALQIEHHPYLTQERLIKYVKNAGIQVVAYSSFGPVSFLELENKKALNTPTLF 244

Query: 216 R------VAKEAGCNSGQVLIRWSLQHGYVPLPKTKSVKRLPSNLDVYN-IELTQEQM 266
                  +A +      QVL+RW+ Q+G   +PK+   +RL  NL + + + LT +++
Sbjct: 245 EHDTIKSIASKHKVTPQQVLLRWATQNGIAIIPKSSKKERLLDNLRINDALTLTDDEL 302

>Sklu_1571.2 YBR149W, Contig c1571 1437-2405
          Length = 322

 Score =  139 bits (349), Expect = 7e-39,   Method: Compositional matrix adjust.
 Identities = 95/303 (31%), Positives = 162/303 (53%), Gaps = 45/303 (14%)

Query: 4   KAIPKAYKLSSGYTLPSIGLGTYDLPSN---ATSEIVYEALKCGYRHLDTAVLYGNEREV 60
           KA    + L++G  +P++GLGT + P +    T E V  A+K G+R +DTA  YG E  +
Sbjct: 5   KATEIYFNLNNGTRIPAVGLGTAN-PKDKWPQTKEAVKAAVKAGFRQIDTAWAYGTEEYI 63

Query: 61  GEGILKWLKENPSSNKREDVFYATKLWNSQNGYNNAKRAIQECFEKVEGLGYIDLLLIHS 120
           GE + +   E     KRED+F  TK+W   N ++ A++++ E  ++++ L Y+DLLL H 
Sbjct: 64  GEALQELFAE--GVVKREDLFITTKVW--PNYWDQAEKSLNESLKRLQ-LDYVDLLLQHW 118

Query: 121 PLSGSRKR---------------------------LETYKAMQE---AVDKGIVRSIGVS 150
           P    +K+                           LETYK ++    A +   VR+IGVS
Sbjct: 119 PFCFVKKQDPEGSGQLVNHPQHEDGSPFYDTAGDWLETYKQIEAIYLAENDTRVRAIGVS 178

Query: 151 NYGVHHIDELLNWNELKYKPFVNQIEISPWLMRQELADYCKSRGLIVEAYAPLTHGYKIN 210
           NY + +++ L  + E K  P +NQ+E+ P L ++EL DYC   G+++ +Y+PL      N
Sbjct: 179 NYPIEYLERL--FKECKTVPAINQVELHPRLPQRELCDYCNKHGILMTSYSPLGSNGAPN 236

Query: 211 H--PNVLRVAKEAGCNSGQVLIRWSLQHGYVPLPKTKSVKRLPSNLDVYNIELTQEQMDF 268
              P V  +A +   N   VL+ + ++ G + +P++ +++R+   L    + LT+E++D 
Sbjct: 237 LRIPLVQELASKYNANGNDVLVSYHIRQGTIVIPRSLNLERISKGLGF--VPLTKEELDK 294

Query: 269 LDQ 271
           L+Q
Sbjct: 295 LNQ 297

>Kwal_55.21426
          Length = 308

 Score =  138 bits (347), Expect = 9e-39,   Method: Compositional matrix adjust.
 Identities = 82/275 (29%), Positives = 148/275 (53%), Gaps = 37/275 (13%)

Query: 12  LSSGYTLPSIGLGTYDLPSNATSEIVYEALKCGYRHLDTAVLYGNEREVGEGILKWLKEN 71
           L++G  +P +GLGT+ L      + +  ALK GYRH+D+A +  NE+ +G+ I       
Sbjct: 14  LNTGAKIPLLGLGTWRLTKEGGYKAILAALKAGYRHIDSAAVCMNEQVIGKAI------R 67

Query: 72  PSSNKREDVFYATKLWNSQNGYNNAKRAIQECFEKVEGLGYIDLLLIHSPLSGSRKRLE- 130
            S  +R+++F  TKLW++Q  + +   A+ +  +++ GL Y+DL ++H PL+    +++ 
Sbjct: 68  DSGVRRDELFVTTKLWSTQ--HRDPSAALDQSLKRL-GLEYVDLYMMHWPLAFRVDQIKA 124

Query: 131 ------------------------TYKAMQEAVDKGIVRSIGVSNYGVHHIDELLNWNEL 166
                                   T++ MQ+   +   R+IGV+N+ V  +  LL     
Sbjct: 125 KNFMLIPRNSEGKPYVDTDWDYVKTWELMQKLPTEK-TRAIGVANFSVPQLTSLLKSPNN 183

Query: 167 KYKPFVNQIEISPWLMRQELADYCKSRGLIVEAYAPL--THGYKINHPNVLRVAKEAGCN 224
           K  P  +Q+E  P+L   E+  +C+ +G+++EAY+PL    G  I+ P +  ++K+    
Sbjct: 184 KIIPAASQLETHPFLPHDEMLAFCREKGILMEAYSPLGGDGGPLIDEPVIREISKKLHVE 243

Query: 225 SGQVLIRWSLQHGYVPLPKTKSVKRLPSNLDVYNI 259
             Q+LI W L+ G   LPK+K+  R+ SNL+V+++
Sbjct: 244 PAQLLISWGLKRGCAVLPKSKTQTRIESNLEVFDL 278

>AER401W [2901] [Homologous to ScYDR368W (YPR1) - SH; ScYOR120W
           (GCY1) - SH] complement(1406905..1407846) [942 bp, 313
           aa]
          Length = 313

 Score =  136 bits (342), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 97/291 (33%), Positives = 152/291 (52%), Gaps = 40/291 (13%)

Query: 1   MNTKAIPKA----YKLSSGYTLPSIGLGTYDLPSNATSEIVYEALKCGYRHLDTAVLYGN 56
           M+TKA  KA      L++G  +P  GLGT+    +  S  V  ALK GY+H+DTA  Y N
Sbjct: 1   MSTKATLKASTDTVTLNTGAKIPLFGLGTWQSTDDDASSAVAAALKHGYKHIDTASFYKN 60

Query: 57  EREVGEGILKWLKENPSSNKREDVFYATKLWNSQNGYNNAKRAIQECFEKVEGLGYIDLL 116
           E  VG+ +    KE  S   RE++F  TK+WN Q    +   A+    +K+ G  Y+DLL
Sbjct: 61  EELVGKAV----KE--SGIPREELFITTKVWNDQQ--RDPAGALDLSLKKL-GTEYVDLL 111

Query: 117 LIHSPL-------------------SGSRKR------LETYKAMQEAVDKGIVRSIGVSN 151
           L+H P+                    G   R      ++T+  MQ+ +  G V++IGVSN
Sbjct: 112 LMHWPVPFKEPENSTLDAYKVPRGPDGKVTRDEEWDFVKTWHLMQKLLGTGKVKAIGVSN 171

Query: 152 YGVHHIDELLNWNELKYKPFVNQIEISPWLMRQELADYCKSRGLIVEAYAPL--THGYKI 209
           + +++++ELLN       P VNQ+E+   L + EL +YC+ +G++VEAY+PL  +    +
Sbjct: 172 FSINNLEELLNAEGTTVVPAVNQVELHIRLPQLELVEYCQKKGIVVEAYSPLGSSSAPLL 231

Query: 210 NHPNVLRVAKEAGCNSGQVLIRWSLQHGYVPLPKTKSVKRLPSNLDVYNIE 260
               V +VA++ G     VL+ +    G V LPK+    R+ SN + + ++
Sbjct: 232 KDATVNKVAEKYGVTPAHVLLNYVANRGIVVLPKSVKESRIISNFEYFKMD 282

>Kwal_56.22611
          Length = 321

 Score =  134 bits (337), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 92/295 (31%), Positives = 155/295 (52%), Gaps = 42/295 (14%)

Query: 10  YKLSSGYTLPSIGLGTYDLPSN--ATSEIVYEALKCGYRHLDTAVLYGNEREVGEGILKW 67
           + L++G  +P++GLGT ++      T + V  A+K GYRH+DTA  Y  E  +GE + + 
Sbjct: 11  FTLNNGVKMPALGLGTANVIEQIPQTKQAVKAAIKSGYRHIDTAWAYRCEDRIGEALKEL 70

Query: 68  LKENPSSNKREDVFYATKLWNSQNGYNNAKRAIQECFEKVEGLGYIDLLLIHSPLSGSRK 127
            +E     KRED+F  TK+W +   ++ A  +I    E + G+ Y+DL+L H PL  +R 
Sbjct: 71  FEE--GVIKREDIFITTKVWPT--NWDRADESISRSLENL-GVDYVDLVLQHWPLCFNRL 125

Query: 128 R---------------------------LETYKAMQEA--VDKGIVRSIGVSNYGVHHID 158
           +                           L+T+K++++         RSIGVSNY V +++
Sbjct: 126 QDPEGIDGICRNPTHEDGSPHYNEKGDYLQTFKSLEKMYLSKDPRFRSIGVSNYPVEYLE 185

Query: 159 ELLNWNELKYKPFVNQIEISPWLMRQELADYCKSRGLIVEAYAPL--THGYKINHPNVLR 216
            LL   E K  P VNQ+E+ P L + EL D+C    + +EA++P   T    + +  V +
Sbjct: 186 RLLK--ECKVVPAVNQVEMHPHLPQMELRDFCTKHNIRLEAFSPFGATGSPMVKNELVQK 243

Query: 217 VAKEAGCNSGQVLIRWSLQHGYVPLPKTKSVKRLPSNLDVYNIELTQEQMDFLDQ 271
           VA++  C    VLI + L+ G V +P++ + K + SN+    + L++E +D L++
Sbjct: 244 VAQKYSCTPNDVLIAYHLRQGVVTVPRSVNPKNIASNVQF--VPLSKEDIDELNK 296

>YBR149W (ARA1) [334] chr2 (539943..540977) Subunit of
           NADP+-dependent D-arabinose dehydrogenase [1035 bp, 344
           aa]
          Length = 344

 Score =  124 bits (311), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 91/295 (30%), Positives = 154/295 (52%), Gaps = 43/295 (14%)

Query: 10  YKLSSGYTLPSIGLGTYDLPSN--ATSEIVYEALKCGYRHLDTAVLYGNEREVGEGILKW 67
           + L++G  +P++GLGT +       T + V  A+K GYRH+DTA  Y  E  VGE I + 
Sbjct: 25  FSLNNGVRIPALGLGTANPHEKLAETKQAVKAAIKAGYRHIDTAWAYETEPFVGEAIKEL 84

Query: 68  LKENPSSNKREDVFYATKLWNSQNGYNNAKRAIQECFEKVEGLGYIDLLLIHSPLSGSRK 127
           L++   S KRED+F  TK+W     ++   R++ E   K  GL Y+DLLL H PL   + 
Sbjct: 85  LED--GSIKREDLFITTKVWPVL--WDEVDRSLNESL-KALGLEYVDLLLQHWPLCFEKI 139

Query: 128 R---------------------------LETYKAMQEAV---DKGIVRSIGVSNYGVHHI 157
           +                           LETYK +++     +   VR+IGVSN+ + ++
Sbjct: 140 KDPKGISGLVKTPVDDSGKTMYAADGDYLETYKQLEKIYLDPNDHRVRAIGVSNFSIEYL 199

Query: 158 DELLNWNELKYKPFVNQIEISPWLMRQELADYCKSRGLIVEAYAPL-THGY-KINHPNVL 215
           + L+   E + KP VNQ+E  P L + EL  +C    +++ AY+PL +HG   +  P V 
Sbjct: 200 ERLIK--ECRVKPTVNQVETHPHLPQMELRKFCFMHDILLTAYSPLGSHGAPNLKIPLVK 257

Query: 216 RVAKEAGCNSGQVLIRWSLQHGYVPLPKTKSVKRLPSNLDVYNI--ELTQEQMDF 268
           ++A++       +LI + ++ G + +P++ +  R+ S+++  ++  +  QE  DF
Sbjct: 258 KLAEKYNVTGNDLLISYHIRQGTIVIPRSLNPVRISSSIEFASLTKDELQELNDF 312

>Scas_319.1
          Length = 195

 Score =  118 bits (295), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 68/195 (34%), Positives = 110/195 (56%), Gaps = 31/195 (15%)

Query: 1   MNTKAIPKAYKLSSGYTLPSIGLGTYDLPSNATSEIVYEALKCGYRHLDTAVLYGNEREV 60
           ++  A+ K   L++G  +P IGLG + +P++  +  VYEA+K GYR  D A  YGNE+EV
Sbjct: 3   VSMSALSKTVTLNNGLEMPLIGLGCWKIPNDVCASQVYEAIKLGYRLFDGAQDYGNEKEV 62

Query: 61  GEGILKWLKENPSSNKREDVFYATKLWNSQNGYNNAKRAIQECFEKVEGLGYIDLLLIHS 120
           G+GI K + E     KRED+F  +KLWNS +  +N K A+++  + + GL Y+DL  IH 
Sbjct: 63  GQGIKKAIAEGIV--KREDLFVVSKLWNSFHHPDNVKLALKKTLDDI-GLDYLDLFYIHF 119

Query: 121 PL----------------SGSRKR------------LETYKAMQEAVDKGIVRSIGVSNY 152
           PL                +G+               ++TY+A+++ VD+G+++SIG+SN+
Sbjct: 120 PLAFKFVPFEEKYPPGFYTGAEDEKNGVISQEDVPLIDTYRALEKCVDEGLIKSIGISNF 179

Query: 153 GVHHIDELLNWNELK 167
               + +LL    +K
Sbjct: 180 NGSLVQDLLRGARIK 194

>Scas_518.4
          Length = 338

 Score =  117 bits (294), Expect = 8e-31,   Method: Compositional matrix adjust.
 Identities = 85/293 (29%), Positives = 145/293 (49%), Gaps = 41/293 (13%)

Query: 10  YKLSSGYTLPSIGLGTYDLPSN--ATSEIVYEALKCGYRHLDTAVLYGNEREVGEGILKW 67
           + L++G  +P+IGLGT         T + V  A++ GYR +DTA  Y  E  +GE + + 
Sbjct: 11  FNLNNGGRIPAIGLGTASPKGRYPETKKAVKAAIRAGYRQIDTAWYYKTEPYIGEALKEL 70

Query: 68  LKENPSSNKREDVFYATKLWNSQNGYNNAKRAIQECFEKVEGLGYIDLLLIHSPLSGSRK 127
            ++     KRED+F  TK+W     +++   +I E  + + G+ Y+D++L H PL   + 
Sbjct: 71  FRD--GEIKREDLFITTKVWPCY--WDDPSTSINESLKSL-GIDYVDMVLQHWPLCYKKT 125

Query: 128 RLETYKAMQEAVDKG----------------------------IVRSIGVSNYGVHHIDE 159
             E    + + +DK                              VR+IGVSNY + +++ 
Sbjct: 126 YDENGTIIGKPLDKDGKVIFAEGADWITTYQLMEKIYLDPKDTRVRAIGVSNYPIEYLER 185

Query: 160 LLNWNELKYKPFVNQIEISPWLMRQELADYCKSRGLIVEAYAPLTHGYKINH--PNVLRV 217
           ++   E K  P +NQ+E+ P L + EL D+C   G+++ AY+PL  G   N   P V   
Sbjct: 186 VIK--ECKVTPVINQVELHPHLPQLELNDFCHKNGILLTAYSPLGSGGAPNTKIPLVQEY 243

Query: 218 AKEAGCNSGQVLIRWSLQHGYVPLPKTKSVKRLPSNLDVYNIELTQEQMDFLD 270
           AK+       +L  + ++ G V +P++ + +R+ SN  +Y   LT+ +M  LD
Sbjct: 244 AKKHEVAPADILTSYHVRKGNVVIPRSLNPERVASN--IYFAPLTKNEMKSLD 294

>Sklu_2324.3 , Contig c2324 5024-5971 reverse complement
          Length = 315

 Score =  114 bits (284), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 88/295 (29%), Positives = 142/295 (48%), Gaps = 39/295 (13%)

Query: 1   MNTKAIPKAYKLSSGYTLPSIGLG-------------TYDLPSNATSEIVYEALKCGYRH 47
           M+   IP      SG  LPSIG G             T  +  +A ++ V  A++CG+ H
Sbjct: 1   MDMTNIPGITLKGSGDLLPSIGFGSGTKWRIAKSSGKTKGVYIDALADQVTNAIQCGFNH 60

Query: 48  LDTAVLYGNEREVGEGILKWLKENPSSNKREDVFYATKL----WNSQNGYNNAKRAIQEC 103
           +DTA  Y   +EVG GI      + +   RE ++   K     W  + G    +      
Sbjct: 61  IDTAEAYKTYKEVGTGI------SNAQVPRETLWITDKYTPWSWEWRKGSGPLESLTLSL 114

Query: 104 FEKVEGLGYIDLLLIHSPLSGSRKR----LETYKAMQEAVDKGIVRSIGVSNYGVHHIDE 159
            E    L Y+DL +IH P   ++       E +  M+E   + + R+IGVSN+ V  ++ 
Sbjct: 115 KEM--NLDYVDLYMIHVPNITTKTAGIDLKEAWLQMEEIYTRKMARNIGVSNFDVESLEY 172

Query: 160 LLNWNELKYKPFVNQIEISPWLMRQE--LADYCKSRGLIVEAYAPLTHGYKINHPNVLR- 216
           + ++   KY+P VNQIE S ++ +Q   +  YC+   ++VE Y+PL    K   P  L  
Sbjct: 173 IKSF--AKYQPVVNQIEFSAYMQQQSPGILKYCRENNIVVEGYSPLVPLTK-GKPGPLDE 229

Query: 217 ----VAKEAGCNSGQVLIRWSLQHGYVPLPKTKSVKRLPSNLDVYNIELTQEQMD 267
               +A + G +  QVL+RW  Q+G V +  T   +RL  +L++++ EL++E  D
Sbjct: 230 ILPGIAAKYGKSQLQVLLRWVTQNGIVVITTTGKKERLNESLNIFDFELSKEDFD 284

>KLLA0F02728g 249240..250232 similar to sp|P38115 Saccharomyces
           cerevisiae YBR149w ARA1 D-arabinose dehydrogenase, large
           subunit, start by similarity
          Length = 330

 Score =  111 bits (277), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 81/296 (27%), Positives = 154/296 (52%), Gaps = 43/296 (14%)

Query: 10  YKLSSGYTLPSIGLGTYDLPSNA--TSEIVYEALKCGYRHLDTAVLYGNEREVGEGILKW 67
           +  ++G  +P+ GLGT         T + V  A+K GYRH+DTA  YG E  VGE + + 
Sbjct: 11  FTFNNGNKVPAFGLGTAAQHERVAETKQAVKAAIKAGYRHIDTAWAYGVEEYVGEALQEL 70

Query: 68  LKENPSSNKREDVFYATKLWNSQNGYNNAKRAIQECFEKVEGLGYIDLLLIHSPLSGSR- 126
            +E     KRED+   +K+W++   +N+  +++ E   +++ + Y+DL L H PL   + 
Sbjct: 71  FEERVV--KREDLHITSKVWHTM--WNDVDKSLNESLARLK-VDYVDLFLQHWPLCTQKV 125

Query: 127 --------------------------KRLETYKAMQEA-VDKG--IVRSIGVSNYGVHHI 157
                                       +ETYK +++  +DK    VR+IGVSN+ + ++
Sbjct: 126 PDPHGVDKIAKEPVDDQGNPLYDEKGDWIETYKQIEKIYLDKNDKRVRAIGVSNFPIEYL 185

Query: 158 DELLNWNELKYKPFVNQIEISPWLMRQELADYCKSRGLIVEAYAPL-THGYKINHPNVLR 216
             +L   E +  P  NQ+E+ P L ++EL ++C    ++V AY+PL  +G  +    +L+
Sbjct: 186 KRVLK--ECRTVPACNQVELHPHLPQRELCEFCSEHKILVTAYSPLGGNGAPLLELPILK 243

Query: 217 -VAKEAGCNSGQVLIRWSLQHGYVPLPKTKSVKRLPSNLDVYNIELTQEQMDFLDQ 271
            + ++   +   +L  + L+ G + +P++ +  R+ SNL+   + L++E ++ L++
Sbjct: 244 GLCEKYNASPNDILTSYHLRQGTIVIPRSLNSTRIASNLEF--VPLSEEDVNKLNE 297

>Kwal_33.13274
          Length = 108

 Score = 99.4 bits (246), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 46/98 (46%), Positives = 67/98 (68%), Gaps = 2/98 (2%)

Query: 10  YKLSSGYTLPSIGLGTYDLPSNATSEIVYEALKCGYRHLDTAVLYGNEREVGEGILKWLK 69
           YKL++G  +P IG G Y++P   T++ VY ALK GYRH+DTAVLY N++E  +G+ K+L 
Sbjct: 13  YKLNNGQQIPVIGFGVYEIPKEDTADRVYSALKDGYRHIDTAVLYRNQKEAAQGVRKYLD 72

Query: 70  ENPSSNKREDVFYATKLWNSQNGYNNAKRAIQECFEKV 107
           E  +   RE++++ TKLW+SQ G    K+A+QE    V
Sbjct: 73  E--TGEARENIWFTTKLWDSQFGREETKKALQEVAADV 108

>Kwal_47.19278
          Length = 314

 Score =  103 bits (257), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 82/295 (27%), Positives = 138/295 (46%), Gaps = 40/295 (13%)

Query: 1   MNTKAIPKAYKLSSGYTLPSIGLGT-------------YDLPSNATSEIVYEALKCGYRH 47
           MN+K IP      SG  +P IG G+              D      ++ V  A+  G+ H
Sbjct: 1   MNSK-IPTLRLKGSGDEIPIIGFGSGTKWRIAKASGEKKDQFITELADQVTSAINAGFNH 59

Query: 48  LDTAVLYGNEREVGEGILKWLKENPSSNKREDVFYATKL----WNSQNGYNNAKRAIQEC 103
           +D A  Y    EVG G+        S   R+ ++   K     W+ + G      ++   
Sbjct: 60  IDAAEAYKTHPEVGRGV------KNSGVPRDKLWITDKYTPWSWDWRKG-TGPLESLSLS 112

Query: 104 FEKVEGLGYIDLLLIHSPL----SGSRKRLETYKAMQEAVDKGIVRSIGVSNYGVHHIDE 159
            EK++ + Y+DL L+H P     +      E ++ M+E  D+G+ ++IGVSN+ V  ++ 
Sbjct: 113 LEKMQ-MSYVDLYLLHVPFITVQTAGIDLKEAWRQMEEIYDRGLAKNIGVSNFDVESLEY 171

Query: 160 LLNWNELKYKPFVNQIEISPWLMRQE--LADYCKSRGLIVEAYAPLTHGYKINHPNVL-- 215
           +      KY P VNQIE + +L +Q   +  YCK   ++VE Y+PL    K   P  L  
Sbjct: 172 ITKIG--KYLPVVNQIEFNAYLQQQSPGIIAYCKDHDIVVEGYSPLVPLTK-GRPGPLDK 228

Query: 216 ---RVAKEAGCNSGQVLIRWSLQHGYVPLPKTKSVKRLPSNLDVYNIELTQEQMD 267
               +A++   +  Q+L+RW  Q+G V +  +    R+  ++++++ ELT E  D
Sbjct: 229 LLPALAEKYHKSELQILLRWVTQNGVVVITTSAQQARVKESVNIFDFELTAEDFD 283

>KLLA0F05775g 560270..561199 similar to sgd|S0002282 Saccharomyces
           cerevisiae YDL124w, start by similarity
          Length = 309

 Score =  102 bits (255), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 79/291 (27%), Positives = 144/291 (49%), Gaps = 38/291 (13%)

Query: 8   KAYKLSSGYTLPSI---GLGTYDLPSNATS--------EIVYEALKC--GYRHLDTAVLY 54
           K + LS+G  +P++   G GT    S  T         +IV + L    G  H+D A +Y
Sbjct: 5   KFFTLSNGNKIPAVAIVGTGTAWYKSEETDATFSQPLVDIVKKTLDTVPGVVHIDAAEIY 64

Query: 55  GNEREVGEGILKWLKENPSSNKREDVFYATKLWNSQNGYNNAKRAIQECFEKVEGLGYID 114
               E+G  +        +   R+++F   K    +    N K A++   +K+ G+ Y+D
Sbjct: 65  RTYPELGAAL------KDTKKPRDEIFITDKYSTLKQLSENPKVALETSLKKL-GVDYVD 117

Query: 115 LLLIHSPL-SGSRKRLET-YKAMQEAVDKGIVRSIGVSNYGVHHIDELLNWNELKYKPFV 172
           L L+HSP+   S+  +E  +K ++E    G  ++IGVSN+ V  +++LL   E+K  P V
Sbjct: 118 LYLLHSPIIKESKLDVEANWKYLEELYKSGKAKNIGVSNFAVKDLEKLLAVAEVK--PQV 175

Query: 173 NQIEISPWLMRQE--LADYCKSRGLIVEAYAPLTHGYKINHPN----------VLRVAKE 220
           NQIE SP+L  Q   + ++ +  G+++EAY+PL  G     P           +  ++K+
Sbjct: 176 NQIEFSPFLQNQTPGIVEFSQKNGILLEAYSPL--GPLQRRPEDADKLPFYQYIAELSKK 233

Query: 221 AGCNSGQVLIRWSLQHGYVPLPKTKSVKRLPSNLDVYNIELTQEQMDFLDQ 271
              +  Q+L+ W  + G +P+  +  ++R+    D+++  L  E++  + Q
Sbjct: 234 YNKSEAQILLSWVYERGILPVTTSSKIERIQQAQDIFSFSLANEEVQKITQ 284

>YDL124W (YDL124W) [746] chr4 (240259..241197) NAD(P)H-dependent
           reductase, has similarity to putative aldose reductases
           [939 bp, 312 aa]
          Length = 312

 Score = 94.7 bits (234), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 75/284 (26%), Positives = 133/284 (46%), Gaps = 35/284 (12%)

Query: 10  YKLSSGYTLPSI---GLGTY---------DLPSNATSEIVYEALKCGYRHLDTAVLYGNE 57
           + L++G  +P+I   G GT             ++   +IVY     G  H+D A +Y   
Sbjct: 8   FTLNNGNKIPAIAIIGTGTRWYKNEETDATFSNSLVEQIVYALKLPGIIHIDAAEIYRTY 67

Query: 58  REVGEGILKWLKENPSSNKREDVFYATKLWNSQNGYNNAKRAIQECFEKVEGLGYIDLLL 117
            EVG+ +   L E P    R  +F   K        ++    +    +K+ G  Y+DL L
Sbjct: 68  PEVGKAL--SLTEKP----RNAIFLTDKYSPQIKMSDSPADGLDLALKKM-GTDYVDLYL 120

Query: 118 IHSPLSGSR----KRLETYKAMQEAVDKGIVRSIGVSNYGVHHIDELLNWNELKYKPFVN 173
           +HSP            E +K M++    G  ++IGVSN+ V  +  +L   E+K  P VN
Sbjct: 121 LHSPFVSKEVNGLSLEEAWKDMEQLYKSGKAKNIGVSNFAVEDLQRILKVAEVK--PQVN 178

Query: 174 QIEISPWLMRQE--LADYCKSRGLIVEAYAPLTHGYKINHPN--------VLRVAKEAGC 223
           QIE SP+L  Q   +  +C+   ++VEAY+PL    K    +        V  ++++   
Sbjct: 179 QIEFSPFLQNQTPGIYKFCQEHDILVEAYSPLGPLQKKTAQDDSQPFFEYVKELSEKYIK 238

Query: 224 NSGQVLIRWSLQHGYVPLPKTKSVKRLPSNLDVYNIELTQEQMD 267
           +  Q+++RW  + G +P+  +   +R+    ++++ +LT E++D
Sbjct: 239 SEAQIILRWVTKRGVLPVTTSSKPQRISDAQNLFSFDLTAEEVD 282

>CAGL0J09394g 923715..924650 similar to tr|Q07551 Saccharomyces
           cerevisiae YDL124w, start by similarity
          Length = 311

 Score = 93.6 bits (231), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 74/283 (26%), Positives = 133/283 (46%), Gaps = 35/283 (12%)

Query: 10  YKLSSGYTLPSI---GLGTYDLPSNAT----SEIVYEALKC-----GYRHLDTAVLYGNE 57
           +KL++G+ +P +   G GT     N T    S+ + + LK      G  HLD A  Y   
Sbjct: 7   FKLNNGHEMPGVAIVGTGTKWHKVNETDENFSQTLVDQLKYALSLPGVVHLDAAEFYMTY 66

Query: 58  REVGEGILKWLKENPSSNKREDVFYATKLWNSQNGYNNAKRAIQECFEKVEGLGYIDLLL 117
           REVG  + +      +S  R+++F   K W       N    ++   +++ GL Y+DL L
Sbjct: 67  REVGRALAE------TSKPRDEIFITDKYWTLSKVTENPIVGLETGLKRL-GLEYVDLYL 119

Query: 118 IHSPL----SGSRKRLETYKAMQEAVDKGIVRSIGVSNYGVHHIDELLNWNELKYKPFVN 173
           +HSP     +      E +  M+E    G  ++IGVSN+    ++ +L     K KP VN
Sbjct: 120 LHSPFISKETNGFSLEEAWGMMEELYHSGKAKNIGVSNFAKEDLERVLKV--CKVKPQVN 177

Query: 174 QIEISPWLMRQE--LADYCKSRGLIVEAYAPL--------THGYKINHPNVLRVAKEAGC 223
           QIE + +L  Q   + ++CK   + + AY+PL            +  +  + ++A+    
Sbjct: 178 QIEFNAFLQNQTPGIYNFCKQNDIQLAAYSPLGPLQKKPADGNSQPFYSYINKLAQHYNK 237

Query: 224 NSGQVLIRWSLQHGYVPLPKTKSVKRLPSNLDVYNIELTQEQM 266
             GQVL+RW  + G V +  ++  +R+    +++  +L  +++
Sbjct: 238 TPGQVLLRWVTKRGVVAVTTSEKKERIKQAQEIFEFDLKDDEV 280

>Scas_704.9
          Length = 309

 Score = 91.3 bits (225), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 75/281 (26%), Positives = 134/281 (47%), Gaps = 32/281 (11%)

Query: 10  YKLSSGYTLPSI---GLGTYDLPSNAT----SEIVYEALKC-----GYRHLDTAVLYGNE 57
           + L++G  +P+I   G GT    +  T    S+ + + LK      G  H+D A +Y   
Sbjct: 8   FTLNNGNKIPAIAVIGTGTRWFKTEETDATFSQQLVDELKVALTLPGIVHIDAAEIYRTY 67

Query: 58  REVGEGILKWLKENPSSNKREDVFYATKLWNSQNGYNNAKRAIQECFEKVEGLGYIDLLL 117
            EV       L+E   SN+  D  + T  +++Q   ++   A      K  GL Y+DL L
Sbjct: 68  PEVAAA----LRE---SNRPRDEIFITDKYSTQLKLSDDPIAGLNISLKTLGLDYVDLYL 120

Query: 118 IHSPLSGSRKRLE-TYKAMQEAVDKGIVRSIGVSNYGVHHIDELLNWNELKYKPFVNQIE 176
           +HSP   +   LE  +K M++    G  ++IGVSN+ V  ++++L    +K  P +NQIE
Sbjct: 121 LHSPFIKNGSTLEECWKQMEKLYKSGKAKNIGVSNFRVEDLEKILKIATIK--PQINQIE 178

Query: 177 ISPWLMRQE--LADYCKSRGLIVEAYAPLTHGYKIN--------HPNVLRVAKEAGCNSG 226
            +  L  Q   +  +CK   + +EAY PL    +I         +  +  ++K+      
Sbjct: 179 FNAALQNQSPGIVKFCKENNIQLEAYTPLGPFQRIQDTPEAKPFYDYIAELSKKYNKTEA 238

Query: 227 QVLIRWSLQHGYVPLPKTKSVKRLPSNLDVYNIELTQEQMD 267
           Q+L+RW  + G +P+  +   +RL    ++++ +L   ++D
Sbjct: 239 QILLRWVTKRGILPVTTSSKPQRLHDAQNLFSFDLESSEVD 279

>Sklu_2438.12 YDL124W, Contig c2438 25491-26429 reverse complement
          Length = 312

 Score = 81.6 bits (200), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 77/290 (26%), Positives = 138/290 (47%), Gaps = 47/290 (16%)

Query: 10  YKLSSGYTLPS---IGLGT--YDLPSNAT-------SEIVYEALKCGYRHLDTAVLYGNE 57
           + L++G  +P+   IG GT  +    NA+        ++ Y     G  H+D A +Y   
Sbjct: 8   FTLNNGNKIPAVAVIGTGTKWFKTEENASKFSDELVDQVKYALTLPGVVHIDAAEIYRTY 67

Query: 58  REVGEGILKWLKENPSSNKREDVF----YATKLWNSQNGYNNAKRAIQECFEKVEGLGYI 113
            E+G    K L+E  +   R +++    Y+T L  S N     +  ++E      G+ YI
Sbjct: 68  PELG----KALRE--TKKPRNEIWITDKYSTSLKLSDNPIVGFENGLKEL-----GVDYI 116

Query: 114 DLLLIHSP-LSGSRKRL---ETYKAMQEAVDKGIVRSIGVSNYGVHHIDELLNWNELKYK 169
           DL L+HSP ++  R      + +K ++E    G  ++IGVSN+    ++ +L   E+K  
Sbjct: 117 DLYLLHSPFITEGRNGFTLEQAWKYLEELYKSGKAKNIGVSNFAKEDLERILKIAEIK-- 174

Query: 170 PFVNQIEISPWLMRQE--LADYCKSRGLIVEAYAPLTHGYKINHPN----------VLRV 217
           P VNQIE S +L  Q   + ++ K   +++EAY+PL  G     P           +  +
Sbjct: 175 PQVNQIEYSAFLQNQTPGIYNFAKENDILLEAYSPL--GPLQRRPEEADSLPFYKYINEL 232

Query: 218 AKEAGCNSGQVLIRWSLQHGYVPLPKTKSVKRLPSNLDVYNIELTQEQMD 267
           A++ G +  QVL+RW  + G +P+  +    R+     ++  +LT  +++
Sbjct: 233 AEKYGKSEAQVLLRWVSKRGVLPVTTSSKPHRVHDAQHIFTFDLTSTEVE 282

>KLLA0B05291g 478251..478634 some similarities with sp|Q12458
           Saccharomyces cerevisiae YDR368w YPR1, hypothetical
           start
          Length = 127

 Score = 53.5 bits (127), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 30/70 (42%), Positives = 41/70 (58%), Gaps = 9/70 (12%)

Query: 53  LYGNEREVGEGILKWLKENPSSNKREDVFYATKLWNSQNGYNNAKRAIQECFEKVEGLGY 112
           +YGNE  VG+GI        S   RE++F  TKLWN+Q    +   A+ E  E++ GL Y
Sbjct: 1   MYGNETAVGKGI------RDSGIPREEIFVTTKLWNTQQ--RDPASALNESLERL-GLDY 51

Query: 113 IDLLLIHSPL 122
           +DL LIH P+
Sbjct: 52  VDLFLIHWPV 61

>Sklu_2405.1 YPL088W, Contig c2405 371-1399 reverse complement
          Length = 342

 Score = 53.1 bits (126), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 88/348 (25%), Positives = 135/348 (38%), Gaps = 87/348 (25%)

Query: 5   AIPKAYKL-SSGYTLPSIGLGTYDLPSNA-------TSEIVYEALK-C---GYRHLDTAV 52
            +PK  +L SSG  +  I +G     S A         E +++ LK C   G R  DTA 
Sbjct: 2   TLPKPVRLGSSGLKISPIIVGCMSYGSKAWAPWVLDNEEEIFKVLKHCYDNGLRTFDTAD 61

Query: 53  LYGN---EREVGEGILKWLKENPSSNKREDVFY----------------ATKLWNSQNGY 93
            Y N   ER VG+ + ++     +      VF+                AT+L  +    
Sbjct: 62  FYSNGLSERLVGKFLKRYNINRETVVILTKVFFPVDETLDLSHSKGMDEATQLTVANQRG 121

Query: 94  NNAKRAIQECFEKVEGLG-YIDLLLIH-----SPLSGSRKRLETYKAMQEAVDKGIVRSI 147
            + K  +    + VE LG YID+L IH     +P++      ET KA+ + V KG  R I
Sbjct: 122 LSRKHILDGVAKSVERLGTYIDVLQIHRFDTETPVN------ETMKALNDVVSKGYARYI 175

Query: 148 GVSNYGVHHIDELL------NW----------------NELKYKPFV--NQIEISPW--- 180
           G S+       EL       +W                +E +  PF   + I + PW   
Sbjct: 176 GASSMLATQFAELQFVAEKHDWFKFISSQSCYNLLYREDERELIPFAKRHHIGLIPWSPN 235

Query: 181 --------LMRQEL---ADYCKSRGLIVEAYAPLTHGYKINHPNVLRVAKEAGCNSGQVL 229
                   L  Q L    D+   R   + A+    H  +I    V  +A++ G     V 
Sbjct: 236 ARGVLTRPLGTQTLRHSTDFGLKR---ISAFDLQPHEEEIVR-RVGEIAEKRGVTMAVVS 291

Query: 230 IRWSLQHGYVPLPKTKSVKRLPSNLDVYNIELTQEQMDFLDQPDAYEP 277
           I W L  G  P+    S +R+   +     +LT+E+  +L++P  Y P
Sbjct: 292 IAWVLSKGCYPIVGLSSTERVDETIKAVEFKLTEEEATYLEEP--YRP 337

>Scas_524.1
          Length = 280

 Score = 51.2 bits (121), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 50/204 (24%), Positives = 89/204 (43%), Gaps = 38/204 (18%)

Query: 107 VEGLG-YIDLLLIHSPLSGSRKRLETYKAMQEAVDKGIVRSIGVSNY-GVHHID------ 158
           VE LG YID+L IH          ET +A+ + V+ G VR +G S   G    +      
Sbjct: 78  VERLGTYIDVLQIHR-FDAETPMEETMRALNDVVELGQVRYLGASRMLGTQFAEYQFVAQ 136

Query: 159 -----ELLNWNE---LKYKPFVNQIEISPWLMRQELA---DYCKSRGLIVEAYAPLTHGY 207
                + +NW     L Y+   ++ E+ P+  R  +A    Y  + GL+      ++   
Sbjct: 137 LNGWHQFINWQSQYNLLYRE--DEREVIPFAKRHNIALTPFYPNAGGLLARPLGQVSART 194

Query: 208 KINHPNVLRVAK--------------EAGCNSGQVLIRWSLQHGYVPLPKTKSVKRLPSN 253
           K + P V ++                E G +  Q+ + W L  G  P+    S++R   +
Sbjct: 195 KSDDPKVKKLTARDKEIINRVEQLSVEKGVSMAQISLAWLLHKGCYPIVGVNSIQRAQES 254

Query: 254 LDVYNIELTQEQMDFLDQPDAYEP 277
           +D  +++L+++ + FL+  + YEP
Sbjct: 255 IDALSLQLSEQDLLFLE--EMYEP 276

>Sklu_2082.3 , Contig c2082 6775-7791
          Length = 338

 Score = 51.2 bits (121), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 91/337 (27%), Positives = 129/337 (38%), Gaps = 68/337 (20%)

Query: 5   AIPKAYKLS-SGYTLPSIGLGTYDLPSNA-------TSEIVYEALK-C---GYRHLDTAV 52
            +PK   L  SG  + SI +G     S           E +++ LK C   G R  DTA 
Sbjct: 2   TLPKQVNLGPSGLKISSIIVGCTSYGSKKWTPWVIEDKEEIFKILKHCYDNGLRTFDTAD 61

Query: 53  LYGN---EREVGEGILKWLKEN------------PSSNKRE---DVFYAT----KLWNSQ 90
           +Y N   ER +GE  LK  K N            P     E      Y T     L  + 
Sbjct: 62  VYSNGLSERLLGE-FLKRYKINRETVVILSKVRFPVDESLELPLSTIYGTDEVTALTLAN 120

Query: 91  NGYNNAKRAIQECFEKVEGLG-YIDLLLIHSPLSGSRKRLETYKAMQEAVDKGIVRSIGV 149
            G  + K  +    + VE LG YID+L IH          ET KA+ + V+KG  R IG 
Sbjct: 121 QGGLSRKHIMDGVAKSVERLGTYIDVLQIHR-FDHETPMEETMKALNDVVEKGYTRYIGA 179

Query: 150 SNYGVHHIDELLNWNEL-KYKPFVNQIEISPWLMRQ---ELADYCK------------SR 193
           S+       EL    E   +  F++       L R+   EL  + K            SR
Sbjct: 180 SSMLATEFAELQFVAEKHSWFKFISSQSCYNLLYREDERELIPFAKRHRIGLIPWSPNSR 239

Query: 194 GLIVEAYAPLTHGYKIN---------HPNVLR----VAKEAGCNSGQVLIRWSLQHGYVP 240
           GL+       T  Y+ +            ++R    VAK+       V   W L  G  P
Sbjct: 240 GLLTRPLGLTTARYEADSRLHNIAPDEQEIIRRVEEVAKKRDTTMAIVSTAWVLSKGCYP 299

Query: 241 LPKTKSVKRLPSNLDVYNIELTQEQMDFLDQPDAYEP 277
           +    S +R+   L   + ELT+E+  +L++P  Y+P
Sbjct: 300 IVGLSSTERVDEALKAIDFELTEEESKYLEEP--YKP 334

>Scas_687.3
          Length = 344

 Score = 50.8 bits (120), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 75/313 (23%), Positives = 123/313 (39%), Gaps = 78/313 (24%)

Query: 35  EIVYEALK-C---GYRHLDTAVLYGN---EREVGEGILKWLKENPSSNKREDVFYATKLW 87
           E V+E LK C   G R  DTA +Y N   ER +GE + K+      + KRE V   TK +
Sbjct: 41  EKVFEILKHCYDRGLRTFDTADVYSNGISERLLGEFLKKF------NIKRETVVILTKTF 94

Query: 88  ------------------------NSQNGYNNAKRAIQECFEKVEGLG-YIDLLLIHSPL 122
                                    +Q G +  K  +Q     VE LG YID+L IH   
Sbjct: 95  FPVDESLSLALGEMSFSESDTLDLTNQRGLSR-KHILQSVKNSVERLGTYIDVLQIHR-F 152

Query: 123 SGSRKRLETYKAMQEAVDKGIVRSIGVSNYGVHHIDELLN-WNELKYKPFVNQIEISPWL 181
             +    ET KA+ + V+ G VR IG S+       E+ +  ++  +  FVN       L
Sbjct: 153 DPTTPIKETMKALNDVVESGDVRYIGASSMLPTQFVEMQSVADKHDWFQFVNVQSCYNLL 212

Query: 182 MRQE---LADYCKSRGLIVEAYAPLTHGYKINHP-------------------------- 212
            R++   L  YC+   + +  ++P  H   +  P                          
Sbjct: 213 YREDERDLMQYCEKHNIALTPWSP-NHQGLLTRPIGVESERSTTDKIINGWNMKDLKPSE 271

Query: 213 -----NVLRVAKEAGCNSGQVLIRWSLQHGYVPLPKTKSVKRLPSNLDVYNIELTQEQMD 267
                 V  ++K+   +   +   W L  G  P+    S+ R+   +   +++ T+E+  
Sbjct: 272 IEIINRVEELSKKKNVSMAVISTAWVLSKGCAPIVGMSSISRVDEVITALDVKFTEEETK 331

Query: 268 FLDQPDAYEPTDW 280
            L++P  Y+P ++
Sbjct: 332 QLEEP--YKPRNF 342

>Scas_568.7
          Length = 343

 Score = 50.1 bits (118), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 72/309 (23%), Positives = 123/309 (39%), Gaps = 76/309 (24%)

Query: 35  EIVYEALK-C---GYRHLDTAVLYGN---EREVGEGILKWLKENPSSNKREDVFYATKLW 87
           E +++ LK C   G R  DTA +Y N   ER +GE + ++      + KRE V   +K++
Sbjct: 40  EEIFKILKHCYDNGLRTFDTADVYSNGTSERILGEFLKRF------NIKRETVVIMSKIF 93

Query: 88  ------------------------NSQNGYNNAKRAIQECFEKVEGLG-YIDLLLIHSPL 122
                                   + Q G N  K  +      VE LG YID+L IH  L
Sbjct: 94  FPVDESLDLHQGSKVDQEYIDLQLSFQQGLNR-KHIMAGVANSVERLGTYIDILQIHR-L 151

Query: 123 SGSRKRLETYKAMQEAVDKGIVRSIGVSNYGVHHIDEL-LNWNELKYKPFVNQIEISPWL 181
                  E  +++ + V  G VR IG S+       EL     +  +  F+N       L
Sbjct: 152 DKEASMEEIMRSLNDVVVSGQVRYIGASSMLATEFAELQFIAKQNGWFQFINVQSYYNVL 211

Query: 182 MRQ---ELADYCKSRGLIVEAYAPLTHGY-----------KINHPNVLR----------- 216
            R+   EL  +CK  G+ +  ++P   G             ++ P  ++           
Sbjct: 212 NREDENELIPFCKKHGVGLTVWSPNARGVLTRPADKTGTRMLSDPTFIKMGLDKLDESDK 271

Query: 217 --------VAKEAGCNSGQVLIRWSLQHGYVPLPKTKSVKRLPSNLDVYNIELTQEQMDF 268
                   +AK+ G +   V + W L  G   +    S++R+   +   +++ T E+++ 
Sbjct: 272 EIIGVVEAIAKKKGISMAMVSMAWILNKGANAIAGLNSIERVDEAIRAIDVKFTVEELEL 331

Query: 269 LDQPDAYEP 277
           L++P  Y+P
Sbjct: 332 LEKP--YKP 338

>YPL088W (YPL088W) [5356] chr16 (381960..382988) Putative aryl
           alcohol dehydrogenase, may participate in late steps of
           degradation of aromatic compounds that arise from the
           degradation of lignocellulose [1029 bp, 342 aa]
          Length = 342

 Score = 47.8 bits (112), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 72/297 (24%), Positives = 114/297 (38%), Gaps = 65/297 (21%)

Query: 44  GYRHLDTAVLYGNEREVGEGILKWLKENPSSNKREDVFYATKLW---------------- 87
           G R  DTA  Y N   + E I+K   E   S KRE V   TK++                
Sbjct: 53  GLRTFDTADFYSNG--LSERIIKEFLEY-YSIKRETVVIMTKIYFPVDETLDLHHNFTLN 109

Query: 88  -------NSQNGYNNAKRAIQECFEKVEGLG-YIDLLLIHSPLSGSRKRLETYKAMQEAV 139
                  ++Q G +  K  I      V+ LG YIDLL IH  L       E  KA+ + V
Sbjct: 110 EFEELDLSNQRGLSR-KHIIAGVENSVKRLGTYIDLLQIHR-LDHETPMKEIMKALNDVV 167

Query: 140 DKGIVRSIGVSNYGVHHIDEL-LNWNELKYKPFVNQIEISPWLMRQ---ELADYCKSRGL 195
           + G VR IG S+       EL    ++  +  F++       L R+   EL  + K   +
Sbjct: 168 EAGHVRYIGASSMLATEFAELQFTADKYGWFQFISSQSYYNLLYREDERELIPFAKRHNI 227

Query: 196 IVEAYAPLTHG------------------YKINHPN------------VLRVAKEAGCNS 225
            +  ++P   G                  +K  H +            V +V+K+   + 
Sbjct: 228 GLLPWSPNARGMLTRPLNQSTDRIKSDPTFKSLHLDNLEEEQKEIINRVEKVSKDKKVSM 287

Query: 226 GQVLIRWSLQHGYVPLPKTKSVKRLPSNLDVYNIELTQEQMDFLDQPDAYEPTDWEC 282
             + I W L  G  P+    +  R+   +    + LT+E++ +L++P  Y+P    C
Sbjct: 288 AMLSIAWVLHKGCHPIVGLNTTARVDEAIAALQVTLTEEEIKYLEEP--YKPQRQRC 342

>Scas_719.39
          Length = 345

 Score = 46.6 bits (109), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 73/308 (23%), Positives = 120/308 (38%), Gaps = 69/308 (22%)

Query: 35  EIVYEALK----CGYRHLDTAVLYGN---EREVGEGILKWLKENPSSNKREDVFYATKLW 87
           E V+  LK     G R  DTA +Y N   E  +GE + K+      + +RE V   TK++
Sbjct: 41  EKVFALLKHCYDVGLRTFDTADVYNNGQSEVLLGEFLKKY------NIRRETVVILTKIY 94

Query: 88  NSQN-----GYNNA------------------KRAIQECFEKVEGLG-YIDLLLIHSPLS 123
              +     G N A                  K  IQ     V  LG YID+L IH  L 
Sbjct: 95  FDSDDSMEVGSNFASINESTKLDLVNQRGLSRKHIIQGVKNSVRRLGTYIDVLQIHR-LD 153

Query: 124 GSRKRLETYKAMQEAVDKGIVRSIGVSNY------------GVHHIDELLNW-------- 163
            +       K++ + V  G VR IG S+               H   + +NW        
Sbjct: 154 DNVPMKSIMKSLNDVVLSGDVRYIGASSMLATEFADLQAIADKHDWFQFVNWQSQYNLLY 213

Query: 164 --NELKYKPFVNQ--IEISPWL-----MRQELADYCKSRGLIVEAYAPLTHGYKINHPNV 214
             +E +  P+  +  I ++PW      +  + A+    R       A ++   K     V
Sbjct: 214 REDEREVIPYAKRHNIAVTPWSPNARGLLAKPANVTSERKNFDPRLASISDDDKEIIGRV 273

Query: 215 LRVAKEAGCNSGQVLIRWSLQHGYVPLPKTKSVKRLPSNLDVYNIELTQEQMDFLDQPDA 274
            ++AK+   +   V   W L   ++P+     ++R+   +    + LTQE++ +L++  A
Sbjct: 274 EKIAKDKDISMAMVSTAWVLSKRFLPIVGMSKMERIDEAVKAIKVTLTQEEIKYLEE--A 331

Query: 275 YEPTDWEC 282
           Y+P   E 
Sbjct: 332 YKPKPLET 339

>Scas_664.5
          Length = 343

 Score = 46.2 bits (108), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 72/295 (24%), Positives = 114/295 (38%), Gaps = 70/295 (23%)

Query: 44  GYRHLDTAVLYGN---EREVGEGILKWLKENPSSNKREDVFYATKLW-------NSQNGY 93
           G R  DTA +Y N   ER VGE + K+      + KRE V   TK++       +  +G 
Sbjct: 53  GLRTFDTADVYSNGISERLVGEFLKKY------NIKRETVVIMTKIFFPVDESLDLHHGS 106

Query: 94  N----------------NAKRAIQECFEKVEGLG-YIDLLLIHSPLSGSRKRLETYKAMQ 136
           N                + K  I      VE LG YID+L IH  L       E  +++ 
Sbjct: 107 NVNQEAMELQLTLQRGLSRKHIIDGVANSVERLGTYIDVLQIHR-LDEETSMEEIMRSLN 165

Query: 137 EAVDKGIVRSIGVSNYGVHHIDELLNWNELK-YKPFVNQIEISPWLMRQ---ELADYCKS 192
           + V  G VR IG S+       EL    E   +  F++       + R+   EL  +CK 
Sbjct: 166 DVVMSGQVRYIGASSMLATEFAELQFIAEKNGWFKFISAQSYYNLINREDERELIPFCKK 225

Query: 193 RGLIVEAYAP-----LTHGYKINHPNVL-------------------------RVAKEAG 222
            G+ +  ++P     LT   + N   +L                          VA+   
Sbjct: 226 HGVGLIPWSPNARGVLTRPVEKNTERMLTDPTFNRMRLNELGDDEKEIVRRIQMVAERRS 285

Query: 223 CNSGQVLIRWSLQHGYVPLPKTKSVKRLPSNLDVYNIELTQEQMDFLDQPDAYEP 277
                + + W+L  G  P+    SV+R+   +      LT++++  L++P  Y+P
Sbjct: 286 VTMAIISMAWTLHKGCNPIVGLNSVERVDEAVKAIEFTLTEDEIKLLEEP--YKP 338

>Scas_633.21
          Length = 344

 Score = 45.1 bits (105), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 69/297 (23%), Positives = 114/297 (38%), Gaps = 73/297 (24%)

Query: 44  GYRHLDTAVLYGN---EREVGEGILKWLKENPSSNKREDVFYATKLW------------- 87
           G R  DTA +Y N   ER +GE + ++        KRE V   TK++             
Sbjct: 53  GLRTYDTADVYSNGLSERLLGEFLKRY------KIKRETVVIFTKVFCPVDETLPLTHGR 106

Query: 88  ------------NSQNGYNNAKRAIQECFEKVEGLG-YIDLLLIHSPLSGSRKRLETYKA 134
                        +Q G +  K  +      VE LG Y+D+L IH  L       E  ++
Sbjct: 107 QAIYDESVNLDLTNQKGLSR-KHIVAGVANSVERLGTYVDVLQIHR-LDHETSMEEIMRS 164

Query: 135 MQEAVDKGIVRSIGVSNYGVHHIDELLNWNELK-YKPFVNQIEISPWLMRQ---ELADYC 190
           + + +  G VR IG S+       EL    E   +  FV+       L R+   EL  + 
Sbjct: 165 LNDVILSGQVRYIGASSMRATEFAELQFIAEKNGWFKFVSSQSYYNLLNREDERELIPFA 224

Query: 191 KSRGLIVEAYAPLTHG------------------YKINHPNVL------------RVAKE 220
           K  G+ +  ++P   G                   K  H N L            ++A++
Sbjct: 225 KKHGIGLVPWSPNARGILTRPLDESTPTGRSDNIVKKLHLNALMEDEKEIVKRVQKIAQK 284

Query: 221 AGCNSGQVLIRWSLQHGYVPLPKTKSVKRLPSNLDVYNIELTQEQMDFLDQPDAYEP 277
              +   V I WS++ G  P+    S+ R    +   ++ LT+E++ +L++   Y+P
Sbjct: 285 KSVSMAMVSIAWSIKKGCNPIVGLSSISRAAEAIGALDVHLTEEEVTYLEE--TYQP 339

>CAGL0E05236g complement(509478..510512) highly similar to tr|Q02895
           Saccharomyces cerevisiae YPL088w, start by similarity
          Length = 344

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 81/337 (24%), Positives = 126/337 (37%), Gaps = 66/337 (19%)

Query: 1   MNTKAIPKAYKLSSGYTLPSIGLGTYDLPSNATSEIVYE-----------ALKCGYRHLD 49
           M TK + +    +SG  +  I +G     S   ++ V E           A   G R  D
Sbjct: 1   MTTKLVKQIRFGASGLKISPIIIGCMSYGSKNWADWVLEDKEKIFGILKRAYDRGLRTYD 60

Query: 50  TAVLYGN---EREVGEGILKWLKENPSSNKREDVFYAT---------------KLWNSQN 91
           TA +Y N   ER + E   K+  +  +      VFYA                +  +  N
Sbjct: 61  TADMYSNGYSERLLKEFFEKYQIKRETVVIMSKVFYAVDEDLDLHHGLDINEVEDLHLTN 120

Query: 92  GYNNAKRAIQECFE-KVEGLG-YIDLLLIHSPLSGSRKRLETYKAMQEAVDKGIVRSIGV 149
               ++R I E  +   E LG YID+L IH  L       E  KA+ + V+ G  R IG 
Sbjct: 121 QRGLSRRHILEAVKNSTERLGTYIDVLQIHR-LDKETPMKEIMKALNDVVEAGYARYIGS 179

Query: 150 SNY------GVHHIDELLNWNE-LKYKPFVNQI------EISPWLMRQELADYC---KSR 193
           S+        +  I E  NW + +  + F N +      EI P+  R  +A       +R
Sbjct: 180 SSMLATEFAELQFIAEKHNWFQFVSLQSFYNLLNREDEREIIPFAKRHNIALTPWSPNAR 239

Query: 194 GLIVEAYAP------------------LTHGYKINHPNVLRVAKEAGCNSGQVLIRWSLQ 235
           GL+    +                   LT   K     V  VAK+   +   +   W L 
Sbjct: 240 GLLTRPVSKISVRIKSDPTFKIVGLDKLTEDQKEIINRVEEVAKKHNTSMAIISNSWVLS 299

Query: 236 HGYVPLPKTKSVKRLPSNLDVYNIELTQEQMDFLDQP 272
            G  P+    S+ R+   +   + EL +E + +L++P
Sbjct: 300 KGCNPIVGLNSIARVDEAIASIDFELPEEDIKYLEEP 336

>CAGL0E05214g complement(508038..509078) highly similar to tr|Q02895
           Saccharomyces cerevisiae YPL088w, start by similarity
          Length = 346

 Score = 40.0 bits (92), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 75/300 (25%), Positives = 112/300 (37%), Gaps = 72/300 (24%)

Query: 36  IVYEALKCGYRHLDTAVLYGN---EREVGEGILKWLKENPSSNKREDVFYATKLW----- 87
           I+  A   G R  DTA +Y N   ER + E   K+        KRE V   TK++     
Sbjct: 48  ILKHAYDRGLRTYDTADVYSNGYSERLLKEFFEKY------QIKRETVVIMTKVFFGVDE 101

Query: 88  --NSQNG---YNN-------------AKRAIQECFEKVEGLG-YIDLLLIHSPLSGSRKR 128
             N  +G   YN+              K  ++      E LG YID+L IH  L      
Sbjct: 102 DLNLHHGLKAYNDHDDLILTNQRGLSRKHILEGVKNSTERLGTYIDVLQIHR-LDKETPM 160

Query: 129 LETYKAMQEAVDKGIVRSIGVSNY------GVHHIDELLNWNEL-KYKPFVNQI------ 175
            E  KA+ + V+ G  R IG S+        +  I E  NW +    + F N +      
Sbjct: 161 KEIMKALNDVVEAGYARYIGSSSMLATEFAELQFIAEKHNWFQFVSLQSFYNLLNREDER 220

Query: 176 EISPWLMRQELADYC---KSRGLIVEAYAPLTHGYK--------------------INHP 212
           EI P+  R  +A       +RGL+       T   K                    IN  
Sbjct: 221 EIIPFAKRHNIALIPWSPNARGLLTRPLNKTTDRIKSDPTFKYLDLDNLTEDQKEIINR- 279

Query: 213 NVLRVAKEAGCNSGQVLIRWSLQHGYVPLPKTKSVKRLPSNLDVYNIELTQEQMDFLDQP 272
            V  VAK+   +   +   W L  G  P+    S+ R+   +   + EL+ E + ++++P
Sbjct: 280 -VEEVAKKHNTSMAIISNSWVLSKGCNPIVGLNSIDRVDEAIASIDFELSDEDIKYIEEP 338

>CAGL0E05192g complement(506594..507631) highly similar to tr|Q02895
           Saccharomyces cerevisiae YPL088w, start by similarity
          Length = 345

 Score = 38.9 bits (89), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 73/297 (24%), Positives = 109/297 (36%), Gaps = 67/297 (22%)

Query: 36  IVYEALKCGYRHLDTAVLYGN---EREVGEGILKWLKENPSSNKREDVFYATKLW----- 87
           I+  A   G R  DTA +Y N   ER + E   K+        KRE V   TK++     
Sbjct: 48  ILKHAYDRGLRTYDTADVYSNGYSERLLKEFFEKY------QIKRETVVIMTKVFFGVDE 101

Query: 88  --NSQNGYN---------------NAKRAIQECFEKVEGLG-YIDLLLIHSPLSGSRKRL 129
             N Q G                 + K  ++      E LG YID+L IH  L       
Sbjct: 102 DLNLQPGVKIDEQEDLVLTNQRGLSRKHILEGVKNSTERLGTYIDVLQIHR-LDKETPMK 160

Query: 130 ETYKAMQEAVDKGIVRSIGVSNY------GVHHIDELLNWNELK-----YKPFV--NQIE 176
           E  KA+ + V+ G  R IG S+        +  I E  NW +       Y   +  ++ E
Sbjct: 161 EIMKALNDVVEAGYARYIGSSSMLATEFAELQFIAEKHNWFQFVSLQSLYNLLIREDERE 220

Query: 177 ISPWLMRQELADYC---KSRGLIVE------------------AYAPLTHGYKINHPNVL 215
           I P+  R  +A       +RGL+                        LT   K     V 
Sbjct: 221 IIPFAKRHNIALIPWSPNARGLLTRPLNKTTDRIKSDPTFKYLELDKLTEDQKEIINRVE 280

Query: 216 RVAKEAGCNSGQVLIRWSLQHGYVPLPKTKSVKRLPSNLDVYNIELTQEQMDFLDQP 272
            VAK+   +   +   W L  G  P+    S+ R+   +   + EL +E + +L++P
Sbjct: 281 EVAKKHNTSMAIISNSWVLSKGCNPIVGLNSIDRVDEAIASIDFELPEEDIKYLEEP 337

>Kwal_26.8377
          Length = 338

 Score = 38.1 bits (87), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 31/130 (23%), Positives = 67/130 (51%), Gaps = 8/130 (6%)

Query: 33  TSEIVYEALKCGYRHLDTAVLYGNEREVGEGILKWLKENPSSNKREDVFYATKLWNSQ-N 91
            SE++  A++ G R +DT+  YG+  ++    L+ LK+      RE+ F  TK+   + +
Sbjct: 45  VSEMLKYAVQHGIRAIDTSPYYGDSEKLFGKALESLKDEIP---RENYFICTKVGRIRLD 101

Query: 92  GYNNAKRAIQE-CFEKVEGL--GYIDLLLIHS-PLSGSRKRLETYKAMQEAVDKGIVRSI 147
            ++ ++  ++       E L   Y+D++ +H      + + LE  K +++  D+G++ + 
Sbjct: 102 EFDYSREHVRSSVLRSCERLRTDYLDVVFLHDVEFVETAQVLEALKELRKLKDEGVLHNF 161

Query: 148 GVSNYGVHHI 157
           G+S Y V  +
Sbjct: 162 GISGYPVDFL 171

>ABR094W [685] [Homologous to ScYMR041C - SH]
           complement(555931..557010) [1080 bp, 359 aa]
          Length = 359

 Score = 37.0 bits (84), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 37/142 (26%), Positives = 66/142 (46%), Gaps = 15/142 (10%)

Query: 26  YDLPSNATSEIVYEALKCGYRHLDTAVLYGNEREV-GEGILKWLKENPSSNKREDVFYAT 84
           Y++P   T  +V  AL+ G   +DT+  YG   E+ GE +     E+P    RE  F  T
Sbjct: 52  YEVP---TLGLVRRALEAGICAIDTSPYYGKSEEIYGEALAAVRDEHP----RETYFICT 104

Query: 85  KLWN---SQNGYNNA--KRAIQECFEKVEGLGYIDLLLIHS-PLSGSRKRLETYKAMQEA 138
           K+     S   Y+ A  + ++     ++    Y+DL+ +H      +    E  + ++  
Sbjct: 105 KVGREGPSDFDYSAAHVRASVHRSCARLH-TEYLDLVYLHDIEFVEAAGIWEALQELRRL 163

Query: 139 VDKGIVRSIGVSNYGVHHIDEL 160
            D+G++R  G+S Y V  + E+
Sbjct: 164 KDEGVIRFFGISGYPVELLQEV 185

>KLLA0F19360g 1792778..1793812 similar to sgd|S0006009 Saccharomyces
           cerevisiae YPL088w, start by similarity
          Length = 344

 Score = 36.2 bits (82), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 70/304 (23%), Positives = 115/304 (37%), Gaps = 73/304 (24%)

Query: 35  EIVYEALK-C---GYRHLDTAVLYGN---EREVGEGILKWLKENPSSNKREDVFYATKLW 87
           E ++  LK C   G R  DTA  Y N   E+ VGE + K+      + +RE V   TK++
Sbjct: 40  EKIFSTLKYCYDHGLRTFDTADFYSNGLSEKLVGEFLKKY------NIRRETVVILTKVY 93

Query: 88  ---------NSQNGYN-------------NAKRAIQECFEKVEGLGY-IDLLLIHSPLSG 124
                    +  NG+              + K  +       + L   ID+L IH  L  
Sbjct: 94  FPVDEDLELSHSNGFTENDLLDLTNQQGLSRKHILAGVTASCKRLDTCIDVLQIHR-LDR 152

Query: 125 SRKRLETYKAMQEAVDKGIVRSIGVSNYGVHHIDELLNWNE-LKYKPFVNQIEISPWLMR 183
                E  +++   V+ G VR IG S        EL +  E   +  F++       L R
Sbjct: 153 ETPMEEIMRSLNHVVESGQVRYIGASTMLATEFVELQSIAERYGWHKFISSQSCYNLLYR 212

Query: 184 Q---ELADYCKSRGLIVEAYAPLTHG--------------YKIN-----------HPN-- 213
           +   EL  Y K  G+ +  ++P   G              Y+ +            P   
Sbjct: 213 EDERELIPYLKRHGVGMIPWSPNARGILCRPVSQQSNSKRYETDGRIKGRQLDQLQPQET 272

Query: 214 -----VLRVAKEAGCNSGQVLIRWSLQHGYVPLPKTKSVKRLPSNLDVYNIELTQEQMDF 268
                V  +AK+ G +   V   W L  G  P+    S+ R+   +    ++L++E++ +
Sbjct: 273 EIVNRVEDLAKKHGVSMAVVSSAWVLAKGGYPIVGLSSIDRVKEIISATELKLSEEEIQY 332

Query: 269 LDQP 272
           L+QP
Sbjct: 333 LEQP 336

>Scas_705.10
          Length = 348

 Score = 35.0 bits (79), Expect = 0.057,   Method: Compositional matrix adjust.
 Identities = 48/220 (21%), Positives = 94/220 (42%), Gaps = 35/220 (15%)

Query: 11  KLSSGYTLPSIGLGTYDLPSNATSEIVYEALKCGYRHLDTAVLYGNER--EVGEG----- 63
           K+ +GY L S+      +P +       +A KC +R ++ A+  GN+    VGE      
Sbjct: 13  KIDTGYGLMSLTWKDVPVPKD-------QAFKCMHRVIELAMQRGNKAFFNVGEFYGPNF 65

Query: 64  -----ILKWLKENPSSNKREDV----FYATKLWNSQNGYNNAKRAIQECFEKVEGLGYID 114
                +  + K+ P   K   +     Y+T  +      +   +++++C E++ G  YID
Sbjct: 66  INLNYVKDFFKKYPDLRKNTIISCKGAYSTVTYKPLLKTDEVIKSVRDCVEQIGG--YID 123

Query: 115 LL--LIHSPLSGSRKRL---ETYKAMQEAVDKGIVRSIGVSNYGVHHIDELLNWNELKYK 169
           +       P +     +   E + A+   V++G +  I +S      I   ++ +  KY 
Sbjct: 124 IFEPARLDPEAADESEVYAHEPFDALAALVEEGAIGGISLSEVTAEEI-VAIHKDYGKYL 182

Query: 170 PFVNQIEISPW---LMRQELADYCKSRGLIVEAYAPLTHG 206
             V ++E+S +   ++   +A  C    L+V  Y+PL  G
Sbjct: 183 VCV-EVELSMFTKDILNNGIAKACNDLNLVVICYSPLGKG 221

>KLLA0B05302g 478541..478696 similar to sp|P14065 Saccharomyces
           cerevisiae YOR120w GCY1 galactose-induced protein of
           aldo/keto reductase family, hypothetical start
          Length = 51

 Score = 30.8 bits (68), Expect = 0.15,   Method: Composition-based stats.
 Identities = 14/45 (31%), Positives = 24/45 (53%)

Query: 135 MQEAVDKGIVRSIGVSNYGVHHIDELLNWNELKYKPFVNQIEISP 179
           MQ     G  R++GVSN+ + +++++ N       P VNQ  + P
Sbjct: 1   MQPLPKTGKTRAVGVSNFSIKNLEDMSNSGLDVLVPAVNQFNVHP 45

>CAGL0F06061g complement(604063..605073) similar to sp|Q04212
           Saccharomyces cerevisiae YMR041c, hypothetical start
          Length = 336

 Score = 33.5 bits (75), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 33/136 (24%), Positives = 66/136 (48%), Gaps = 8/136 (5%)

Query: 35  EIVYEALKCGYRHLDTAVLYG-NEREVGEGI--LKWLKENPSSNKREDVFYATKLWNSQ- 90
           +++  A   G   +DT+  YG +E   G+ +  LK   E+  S  R+  +  TK+   + 
Sbjct: 36  DMLKHAFTNGINAIDTSPYYGPSEIIFGQALHKLKSPDEDGLSFTRDQYYICTKVGRIKL 95

Query: 91  NGYNNAKRAIQ-ECFEKVEGLG--YIDLLLIHS-PLSGSRKRLETYKAMQEAVDKGIVRS 146
             ++ + +A++       E L   Y+DL+ +H        K +E  K +++  ++G++R 
Sbjct: 96  EEFDYSPKAVRASVLRSCERLDTDYLDLVYLHDVEFVEFTKSMEALKELRKLKEEGVIRH 155

Query: 147 IGVSNYGVHHIDELLN 162
            G+S Y V ++  L N
Sbjct: 156 FGLSGYPVKYLAFLCN 171

>Scas_709.28
          Length = 323

 Score = 32.7 bits (73), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 30/136 (22%), Positives = 66/136 (48%), Gaps = 12/136 (8%)

Query: 35  EIVYEALKCGYRHLDTAVLYGN-EREVGEGILKWLKENPSSNKREDVFYATKLWN-SQNG 92
           EI+  A + G   +DT+  YGN E  +G+ +     + P    R+     TK+   S + 
Sbjct: 28  EILRVAFENGINCIDTSPYYGNSEILIGKALHNLGDKFP----RDSYLICTKVGRLSLDS 83

Query: 93  YN----NAKRAIQECFEKVEGLGYIDLLLIHS-PLSGSRKRLETYKAMQEAVDKGIVRSI 147
           ++    N +R++    +++    Y+DL+ +H       +  L   + +++  ++GI++  
Sbjct: 84  FDYSADNVRRSVVRSCKRLNS-DYLDLVYLHDVEFVNMKDSLVALRELKKLKNEGIIKRF 142

Query: 148 GVSNYGVHHIDELLNW 163
           G+S Y V ++  L ++
Sbjct: 143 GISGYPVDYLFHLSSY 158

>Scas_665.18
          Length = 399

 Score = 32.3 bits (72), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 31/116 (26%), Positives = 52/116 (44%), Gaps = 19/116 (16%)

Query: 149 VSNYGVHHIDELLNWNELKY--KPFVNQI---------EISPWLMRQELADYCKSRGLIV 197
           + NYGV   +E   +N LKY   P VN +         E S W   + LA +CK  G+  
Sbjct: 61  IGNYGVPSTEERDEFNLLKYVESPHVNVVGIVVAEYAYEYSHWAAVESLASWCKREGV-- 118

Query: 198 EAYAPLTHGYKINHPNVLRVAKEAGCNSGQVLIRWSLQHGYVPLPKTKSVKRLPSN 253
              A +T    ++   +++  +E G + G++ I       YV    T  V+++ +N
Sbjct: 119 ---AAIT---GVDTREIVQYLREQGSSLGRITIGNDEPVEYVDPMNTHLVEQVSTN 168

>Kwal_26.9322
          Length = 331

 Score = 30.4 bits (67), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 18/82 (21%), Positives = 38/82 (46%), Gaps = 9/82 (10%)

Query: 130 ETYKAMQEAVDKGIVRSIGVSNYGVHHIDELLNWNELKYKPFVNQIEIS-----PWLMRQ 184
           ET++ + E + KG +  + +S      I  +      K+  ++  +E+      P ++  
Sbjct: 135 ETFETIVEYIKKGDLGGLSLSEVTAEQIRAV----HAKFGEYLCCVEVEMSLFVPDILTN 190

Query: 185 ELADYCKSRGLIVEAYAPLTHG 206
            +AD C   G+ +  Y+PL +G
Sbjct: 191 GIADTCNELGIPIVCYSPLCNG 212

>KLLA0B09658g complement(837873..838901) similar to sgd|S0006331
           Saccharomyces cerevisiae YPR127w, hypothetical start
          Length = 342

 Score = 30.0 bits (66), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 21/82 (25%), Positives = 36/82 (43%), Gaps = 9/82 (10%)

Query: 130 ETYKAMQEAVDKGIVRSIGVSNYGVHHIDELLNWNELKYKPFVNQIEI-----SPWLMRQ 184
           ET+  + E V KG +  I +S      I  +      +Y  ++  +E+     S  ++  
Sbjct: 145 ETFDTIVEYVKKGKIGGISLSEVTAEQIRAI----HKEYGEYLVCVEVELSMFSAEILSN 200

Query: 185 ELADYCKSRGLIVEAYAPLTHG 206
            + D C   GL + AY+PL  G
Sbjct: 201 GIVDTCNELGLPIVAYSPLGRG 222

>YMR041C (YMR041C) [4005] chr13 complement(350965..351972) Member of
           the aldo-keto reductase family, which include some
           related monomeric NADPH-dependent oxidoreductases, has
           high similarity to uncharacterized C. albicans
           Orf6.6905p [1008 bp, 335 aa]
          Length = 335

 Score = 29.3 bits (64), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 31/130 (23%), Positives = 55/130 (42%), Gaps = 12/130 (9%)

Query: 35  EIVYEALKCGYRHLDTAVLYG-NEREVGEGILKWLKENPSSNKREDVFYATKLWNSQNGY 93
           +I+  A   G   +DT+  YG +E   G  +     E P    R+  F  TK+       
Sbjct: 39  DIIKYAFSHGINAIDTSPYYGPSEVLYGRALSNLRNEFP----RDTYFICTKVGRIGAEE 94

Query: 94  NNAKR-----AIQECFEKVEGLGYIDLLLIHS-PLSGSRKRLETYKAMQEAVDKGIVRSI 147
            N  R     ++    E++    Y+DL+ +H          LE  K ++   +KG++++ 
Sbjct: 95  FNYSRDFVRFSVHRSCERLHT-TYLDLVYLHDVEFVKFPDILEALKELRTLKNKGVIKNF 153

Query: 148 GVSNYGVHHI 157
           G+S Y +  I
Sbjct: 154 GISGYPIDFI 163

>Sklu_2274.6 YMR041C, Contig c2274 7634-8653
          Length = 339

 Score = 28.9 bits (63), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 30/124 (24%), Positives = 60/124 (48%), Gaps = 16/124 (12%)

Query: 40  ALKCGYRHLDTAVLYGNEREVGEGILKWLKENPSSNKREDVFYATKLWN---SQNGYN-- 94
           A+  G R +DT+  YG    +    L  +K+  +   R+  +  TK+      +  Y   
Sbjct: 49  AMDHGIRAIDTSPYYGPSETLYGNALDAIKDEYA---RDTYYICTKVGRIRLDEFDYTRE 105

Query: 95  NAKRAIQECFEKVEGLGYIDLLLIHS----PLSGSRKRLETYKAMQEAVDKGIVRSIGVS 150
           + + ++Q    +++   Y+DL+ +H      LS   + LE  ++++   D+GI+R+ G+S
Sbjct: 106 HVRFSVQRSCARLKT-TYLDLVYLHDVEFVELSQIFEALEELRSLK---DEGIIRNFGLS 161

Query: 151 NYGV 154
            Y V
Sbjct: 162 GYPV 165

>Scas_717.47
          Length = 220

 Score = 28.5 bits (62), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 14/38 (36%), Positives = 21/38 (55%)

Query: 73  SSNKREDVFYATKLWNSQNGYNNAKRAIQECFEKVEGL 110
           S N+ EDV +   L  S  G NN +R ++   +K+E L
Sbjct: 178 SPNRSEDVLFLQSLNPSSKGKNNKRRKLKLSRKKIEQL 215

>Scas_704.25
          Length = 154

 Score = 27.7 bits (60), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 26/99 (26%), Positives = 45/99 (45%), Gaps = 21/99 (21%)

Query: 56  NEREVGEGILKWLKENPSSNKREDVFYATKLWNSQNGYNNAKRAIQECFEKVEGLGYIDL 115
           N++ +G  +L  + +   + +RE ++Y T        Y+ AKR             Y+D 
Sbjct: 56  NDQRLGIKLLTDIYKEEPTRRRECLYYLTIGCYKSGEYSMAKR-------------YVDK 102

Query: 116 LLIHSPLSGSRKRLETYKAM-----QEAVDKGIVRSIGV 149
           L  H P   + K+++T K M     Q+   KG+V + GV
Sbjct: 103 LHEHEP---NNKQVQTLKKMVEDKIQKETVKGVVVATGV 138

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.316    0.134    0.409 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 10,235,076
Number of extensions: 454310
Number of successful extensions: 1385
Number of sequences better than 10.0: 76
Number of HSP's gapped: 1238
Number of HSP's successfully gapped: 87
Length of query: 286
Length of database: 16,596,109
Length adjustment: 101
Effective length of query: 185
Effective length of database: 13,099,691
Effective search space: 2423442835
Effective search space used: 2423442835
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 61 (28.1 bits)