Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Sklu_2316.348748724670.0
Kwal_55.2210649548312921e-175
KLLA0E02134g53949811631e-155
YGR197C (SNG1)54743811431e-152
CAGL0G09273g54542611041e-146
Scas_617.354148410881e-144
YJR015W5105049671e-126
CAGL0B03949g6324529671e-124
Scas_647.94494239381e-122
CAGL0B03971g5434358771e-112
ADL193C4654688141e-103
Scas_434.13573064076e-45
Scas_617.0d46451254e-09
Sklu_2068.1569118665.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Sklu_2316.3
         (487 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Sklu_2316.3 , Contig c2316 10494-11957 reverse complement             954   0.0  
Kwal_55.22106                                                         502   e-175
KLLA0E02134g complement(200436..202055) similar to sp|P46950 Sac...   452   e-155
YGR197C (SNG1) [2147] chr7 complement(892500..894143) Probable t...   444   e-152
CAGL0G09273g 885374..887011 similar to sp|P46950 Saccharomyces c...   429   e-146
Scas_617.3                                                            423   e-144
YJR015W (YJR015W) [2918] chr10 (462635..464167) Protein with sim...   377   e-126
CAGL0B03949g complement(387861..389759) similar to sp|P46950 Sac...   377   e-124
Scas_647.9                                                            365   e-122
CAGL0B03971g complement(390700..392331) similar to sp|P47090 Sac...   342   e-112
ADL193C [1548] [Homologous to ScYGR197C (SNG1) - NSH] (357909..3...   318   e-103
Scas_434.1                                                            161   6e-45
Scas_617.0d                                                            53   4e-09
Sklu_2068.1 YNL059C, Contig c2068 494-2198                             30   5.2  

>Sklu_2316.3 , Contig c2316 10494-11957 reverse complement
          Length = 487

 Score =  954 bits (2467), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 464/487 (95%), Positives = 464/487 (95%)

Query: 1   MSSSFATEPESLGFKEVAAGEQQSLNQFEQRCLDQAQSEHDSVRTSLSEVASNDGGSLQR 60
           MSSSFATEPESLGFKEVAAGEQQSLNQFEQRCLDQAQSEHDSVRTSLSEVASNDGGSLQR
Sbjct: 1   MSSSFATEPESLGFKEVAAGEQQSLNQFEQRCLDQAQSEHDSVRTSLSEVASNDGGSLQR 60

Query: 61  MATSFFSPRLQAQRKHVWFQFLFNILALAALTISVFSLYWGALYNRNSHLGKVRILAVIQ 120
           MATSFFSPRLQAQRKHVWFQFLFNILALAALTISVFSLYWGALYNRNSHLGKVRILAVIQ
Sbjct: 61  MATSFFSPRLQAQRKHVWFQFLFNILALAALTISVFSLYWGALYNRNSHLGKVRILAVIQ 120

Query: 121 DDGSLPGALPAIIDANPGGWHVYTSEQFQSKYHINETQIDSKIEHLVHTQKFWMSLNVKP 180
           DDGSLPGALPAIIDANPGGWHVYTSEQFQSKYHINETQIDSKIEHLVHTQKFWMSLNVKP
Sbjct: 121 DDGSLPGALPAIIDANPGGWHVYTSEQFQSKYHINETQIDSKIEHLVHTQKFWMSLNVKP 180

Query: 181 NATNALHESLQNPSADPFVASNYFEAIYESGRDPTNFRSSILPLLQEVELSFQKNYTSSY 240
           NATNALHESLQNPSADPFVASNYFEAIYESGRDPTNFRSSILPLLQEVELSFQKNYTSSY
Sbjct: 181 NATNALHESLQNPSADPFVASNYFEAIYESGRDPTNFRSSILPLLQEVELSFQKNYTSSY 240

Query: 241 LPELLSHTXXXXXXXXXXXXXXXXEFCSEDMRPFSNYVLLGPLQVGLIFCVLLTFFQLAM 300
           LPELLSHT                EFCSEDMRPFSNYVLLGPLQVGLIFCVLLTFFQLAM
Sbjct: 241 LPELLSHTNLSNASPANLAAAGNLEFCSEDMRPFSNYVLLGPLQVGLIFCVLLTFFQLAM 300

Query: 301 FGPLHGMVSPKLKPAHILIYRYCISMTAYFFLSLFFCTVSAIFQVDFTPTFGRAGFMVYW 360
           FGPLHGMVSPKLKPAHILIYRYCISMTAYFFLSLFFCTVSAIFQVDFTPTFGRAGFMVYW
Sbjct: 301 FGPLHGMVSPKLKPAHILIYRYCISMTAYFFLSLFFCTVSAIFQVDFTPTFGRAGFMVYW 360

Query: 361 MSTWLIMAAVGGANENVLSLILPYGAQYLGFWLVFWIVSNISPSFFPLALMNNFYRYGYM 420
           MSTWLIMAAVGGANENVLSLILPYGAQYLGFWLVFWIVSNISPSFFPLALMNNFYRYGYM
Sbjct: 361 MSTWLIMAAVGGANENVLSLILPYGAQYLGFWLVFWIVSNISPSFFPLALMNNFYRYGYM 420

Query: 421 MPIHNAMDIYKVIFLNTYKGTLGRNYGILCAWVVINSILFVPVLKIVGNKMKQNAQKXXX 480
           MPIHNAMDIYKVIFLNTYKGTLGRNYGILCAWVVINSILFVPVLKIVGNKMKQNAQK   
Sbjct: 421 MPIHNAMDIYKVIFLNTYKGTLGRNYGILCAWVVINSILFVPVLKIVGNKMKQNAQKAAA 480

Query: 481 XXXXEKV 487
               EKV
Sbjct: 481 AAAAEKV 487

>Kwal_55.22106
          Length = 495

 Score =  502 bits (1292), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 247/483 (51%), Positives = 328/483 (67%), Gaps = 11/483 (2%)

Query: 2   SSSFATEPESLGFKEVAAGEQQSLNQFEQRCLDQAQSEHDSVRTS--LSEVASNDGGSLQ 59
           S S +++ E  GF     GE        +R   +   E+++  T   L  V S     L 
Sbjct: 9   SESRSSDEEHAGFARAIVGEGSEEGSSGERGYKELDPENEAGATEGELRRVESK----LS 64

Query: 60  RMATSFFSPRLQAQRKHVWFQFLFNILALAALTISVFSLYWGALYNRNSHLGKVRILAVI 119
           R+ T FFS R++ +R+ +  +FL N   LA L +SVFSLYWGA Y R+ H+ KV+ILAV+
Sbjct: 65  RVVTGFFSDRVKGERRKLIMRFLLNHFLLAMLIMSVFSLYWGATYQRSKHMHKVKILAVV 124

Query: 120 QDD----GSLPGALPAIIDANPGGWHVYTSEQFQSKYHINETQIDSKIEHLVHTQKFWMS 175
           QD+      +  ++P + +  PG WHVY +  FQ KY + + ++D+KI+ LVH QK+W+S
Sbjct: 125 QDEPGTGTGIASSIPTLAEQAPGTWHVYNTSSFQQKYGVAQDEVDAKIQQLVHDQKYWVS 184

Query: 176 LNVKPNATNALHESLQNPSADPFVASNYFEAIYESGRDPTNFRSSILPLLQEVELSFQKN 235
           LNVKPNAT+ L ESLQN  A PF +S +FE  YESGRDPTN +SSILP+   +E  +Q  
Sbjct: 185 LNVKPNATSTLIESLQNSRASPFNSSAFFELFYESGRDPTNLKSSILPIALSLESRYQNI 244

Query: 236 YTSSYLPELLSH-TXXXXXXXXXXXXXXXXEFCSEDMRPFSNYVLLGPLQVGLIFCVLLT 294
           Y S+ LP +LS+ T                 F   D RPF++YVLLGPLQVGLI+C+LLT
Sbjct: 245 YASTILPGILSNITQRVGDVSRNVAMAGNMVFAQVDNRPFNDYVLLGPLQVGLIYCILLT 304

Query: 295 FFQLAMFGPLHGMVSPKLKPAHILIYRYCISMTAYFFLSLFFCTVSAIFQVDFTPTFGRA 354
           FFQLA+FGP+H ++  KLKP H+L+YRY I+   YFFLSLFFC VS  FQVDFT  FGRA
Sbjct: 305 FFQLALFGPIHALLGQKLKPVHMLLYRYVIAFVNYFFLSLFFCLVSLAFQVDFTKAFGRA 364

Query: 355 GFMVYWMSTWLIMAAVGGANENVLSLILPYGAQYLGFWLVFWIVSNISPSFFPLALMNNF 414
           GFMV WMS+WL+MAAVGGANEN+L++I+ +G QYLGFWL+FW+V NISP+F+P+ L +NF
Sbjct: 365 GFMVAWMSSWLLMAAVGGANENMLTIIMAFGPQYLGFWLIFWVVLNISPAFYPMELTHNF 424

Query: 415 YRYGYMMPIHNAMDIYKVIFLNTYKGTLGRNYGILCAWVVINSILFVPVLKIVGNKMKQN 474
           YRYGYM PI+N + I++V FL+ Y+G LGRNYGILCAW+V+N  +F  V+K+     K+ 
Sbjct: 425 YRYGYMTPIYNGVGIFRVTFLDLYRGHLGRNYGILCAWIVLNMAIFPFVMKLFVYVKKRE 484

Query: 475 AQK 477
           A K
Sbjct: 485 AMK 487

>KLLA0E02134g complement(200436..202055) similar to sp|P46950
           Saccharomyces cerevisiae YGR197c SNG1 involved in
           nitroguanidine resistance, start by similarity
          Length = 539

 Score =  452 bits (1163), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 231/498 (46%), Positives = 312/498 (62%), Gaps = 24/498 (4%)

Query: 1   MSSSFATEPESLGFKEVAAGEQQSL---------NQFEQRCLDQAQS----EHDSVRTSL 47
           M++  + + ES GF    +G +            NQ +    +QA+S      +S     
Sbjct: 40  MNAESSADEESQGFAGNESGRKSRTPSLAMVGEDNQDQSTSDEQAESVEEFNKESANIDD 99

Query: 48  SEVASNDGG-------SLQRMATSFFSPRLQAQRKHVWFQFLFNILALAALTISVFSLYW 100
                NDG        +L R+ T FFS +L   R     +F  N   L +L I++FSLYW
Sbjct: 100 KNEEQNDGSPAEAGQPALGRVKTRFFSSKLSTHRNIFARRFALNCFLLGSLAIAMFSLYW 159

Query: 101 GALYNRNSHLGKVRILAVIQDDGSLPGALPAIIDANPGGWHVYTSEQFQSKYHINETQID 160
           GALYN +S    V+ +AV++DDG +   +  I+D+    + VY +  F+ KY   +  I 
Sbjct: 160 GALYNHSSDYHNVKFIAVVEDDGDMGAGVIPIMDSAIPQFFVYNTSSFRDKYG-QDVNIS 218

Query: 161 SKIEHLVHTQKFWMSLNVKPNATNALHESLQNPSADPFVASNYFEAIYESGRDPTNFRSS 220
            K+ HLVHT+KFW SL V P  T+A  +SL    A  F +++YFE  Y++ RD +N R+S
Sbjct: 219 EKVHHLVHTKKFWGSLIVYPGTTDAFVDSLTTDDAPAFNSTDYFEFFYKTARDLSNMRAS 278

Query: 221 ILPLLQEVELSFQKNY-TSSYLPELLSHTXXXXXXXXXXXXXXXXEFCSEDMRPFSNYVL 279
           I+PLL  +E +++K +  + Y P ++++                  +   D RPF++Y L
Sbjct: 279 IVPLLTSIETTYKKTFFYNDYFPSVIANITNISGPNLSAAGDM--NWKQIDNRPFTDYTL 336

Query: 280 LGPLQVGLIFCVLLTFFQLAMFGPLHGMVSPKLKPAHILIYRYCISMTAYFFLSLFFCTV 339
           LGP+QVGLI+C+LLTFFQLA+FGP H M+SP LKP HI++YR   S   YFFLSLFFCTV
Sbjct: 337 LGPMQVGLIYCILLTFFQLALFGPFHAMLSPLLKPKHIILYRLVTSWATYFFLSLFFCTV 396

Query: 340 SAIFQVDFTPTFGRAGFMVYWMSTWLIMAAVGGANENVLSLILPYGAQYLGFWLVFWIVS 399
           SAIF VDFT  FGR GF+VYWM+TW++M AVGGANENVLS++L Y  QYLGFWL+ WI+ 
Sbjct: 397 SAIFHVDFTLAFGRGGFVVYWMTTWILMGAVGGANENVLSILLAYCPQYLGFWLISWIII 456

Query: 400 NISPSFFPLALMNNFYRYGYMMPIHNAMDIYKVIFLNTYKGTLGRNYGILCAWVVINSIL 459
           NIS SF PL L N FYRYGYM PI+NAM+IY+VIF +TYKG +GRNYGIL AW V+N++L
Sbjct: 457 NISASFVPLVLANRFYRYGYMTPIYNAMEIYRVIFTDTYKGDMGRNYGILAAWCVLNTLL 516

Query: 460 FVPVLKIVGNKMKQNAQK 477
           F  V+KIVG K   +A+K
Sbjct: 517 FPFVMKIVGQKFMNDAKK 534

>YGR197C (SNG1) [2147] chr7 complement(892500..894143) Probable
           transport protein, confers resistance to MNNG and
           nitrosoguanidine [1644 bp, 547 aa]
          Length = 547

 Score =  444 bits (1143), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 214/438 (48%), Positives = 295/438 (67%), Gaps = 12/438 (2%)

Query: 49  EVASNDGGSLQRMATSFFSPRLQAQRKHVWFQFLFNILALAALTISVFSLYWGALYNRNS 108
           E   NDGG L R+ T  FSPRL+  RK +  +F+ N   +A + +S+ S+YWGA Y  + 
Sbjct: 77  EKGGNDGGPLARIQTGLFSPRLRNHRKKILSKFVLNNFFIACVCVSLISIYWGACYGTDR 136

Query: 109 HLGKVRILAVIQDD------GSLPGALPAIIDANPGGWHVYTSEQFQSKY-HINETQIDS 161
           +  KV+ + V+QD        S+   +P+++ + PG WH+Y +  F  K+   N T+ID 
Sbjct: 137 YFFKVKNIVVLQDAPSNTSVQSISAIIPSLLASVPGTWHIYNATSFHRKFGTTNSTEIDR 196

Query: 162 KIEHLVHTQKFWMSLNVKPNATNALHESLQNPSAD-PFVASNYFEAIYESGRDPTNFRSS 220
           KI  L++ +++W++LNVKPNAT+ L+ SL +  A+  F +S +FE+++ESGRDP++ +S+
Sbjct: 197 KIVDLIYDERYWLALNVKPNATDTLYNSLISQDANSEFNSSIFFESVFESGRDPSSVKST 256

Query: 221 ILPLLQEVELSFQKNYTSSYLPELLSHTXXXXXXXXXXXXXXXXE----FCSEDMRPFSN 276
           ILPL+Q++E+  QK Y   YLP L+S+                      F   D RPF++
Sbjct: 257 ILPLMQQLEVRLQKYYVKEYLPSLMSNITSNDRDLNINMENWAIAGQLLFTYNDYRPFAD 316

Query: 277 YVLLGPLQVGLIFCVLLTFFQLAMFGPLHGMVSPKLKPAHILIYRYCISMTAYFFLSLFF 336
            +L+ PLQVGLI+C+LLT  QL+++G LHG ++  LKP HILIYR  IS   YF LS+ F
Sbjct: 317 RILMAPLQVGLIYCILLTVLQLSLYGKLHGEMARVLKPKHILIYRLLISWATYFLLSIGF 376

Query: 337 CTVSAIFQVDFTPTFGRAGFMVYWMSTWLIMAAVGGANENVLSLILPYGAQYLGFWLVFW 396
           CTVSAIF++DFTP FGR GF+VYWMSTWL+M AVGGANENVLSL++ Y   YL  WL+ W
Sbjct: 377 CTVSAIFRIDFTPAFGRGGFVVYWMSTWLVMMAVGGANENVLSLVIAYCPPYLSIWLMTW 436

Query: 397 IVSNISPSFFPLALMNNFYRYGYMMPIHNAMDIYKVIFLNTYKGTLGRNYGILCAWVVIN 456
           I+ NIS SF+P+ L N FYRYGY+MPIHNA+DIYKVIFLN  K  +GRNYGIL AWV +N
Sbjct: 437 IILNISASFYPMVLNNEFYRYGYIMPIHNAVDIYKVIFLNLTKRKMGRNYGILVAWVALN 496

Query: 457 SILFVPVLKIVGNKMKQN 474
           + L    +K  G KM++N
Sbjct: 497 TSLMPFCMKFAGKKMQKN 514

>CAGL0G09273g 885374..887011 similar to sp|P46950 Saccharomyces
           cerevisiae YGR197c SNG1 or sp|P47090 Saccharomyces
           cerevisiae YJR015w, hypothetical start
          Length = 545

 Score =  429 bits (1104), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 207/426 (48%), Positives = 282/426 (66%), Gaps = 12/426 (2%)

Query: 64  SFFSPRLQAQRKHVWFQFLFNILALAALTISVFSLYWGALYNRNSHLGKVRILAVIQDDG 123
           +  +P+L++ +  + FQF F  + LA + +S+  +YWGA Y    +L KV IL+VIQD  
Sbjct: 104 NILNPKLESHKSVLAFQFCFTNVLLATVCLSIICIYWGAAYRTEHYLFKVNILSVIQDQD 163

Query: 124 -----SLPGALPAIIDANPGGWHVYTSEQFQSKYHINETQ--IDSKIEHLVHTQKFWMSL 176
                S+   LPA+ID  PG WH+Y    F  KY I  T   +D KI  L+  +K+WMSL
Sbjct: 164 YNNIQSMASTLPALIDQTPGTWHLYNRSSFVEKYGIENTSEAVDKKITDLIFEEKYWMSL 223

Query: 177 NVKPNATNALHESLQNPSADPFVASNYFEAIYESGRDPTNFRSSILPLLQEVELSFQKNY 236
           NVK  AT AL+ SL + +A  F +S YFE ++ESGRDPTN +S+ILP++Q+++ ++ + Y
Sbjct: 224 NVKTGATEALYNSLTDNTAPAFNSSAYFECMFESGRDPTNLKSAILPIMQQLQAAYVQYY 283

Query: 237 TSSYLPELLSHTXXXXXXX-----XXXXXXXXXEFCSEDMRPFSNYVLLGPLQVGLIFCV 291
           TS+YLP +L +                      EF   D RPF + VLL PLQVGLIF +
Sbjct: 284 TSTYLPSMLRNVSATINSIGDVNPLSLANSGNFEFNYIDYRPFFDRVLLAPLQVGLIFTL 343

Query: 292 LLTFFQLAMFGPLHGMVSPKLKPAHILIYRYCISMTAYFFLSLFFCTVSAIFQVDFTPTF 351
           +LT  QL+++GP+H  +    KP H L+YRY +S + YF LSLFFCTVSAI+Q+DFT  F
Sbjct: 344 ILTVVQLSLYGPMHAKMVRVFKPKHFLLYRYGLSWSTYFILSLFFCTVSAIYQIDFTLAF 403

Query: 352 GRAGFMVYWMSTWLIMAAVGGANENVLSLILPYGAQYLGFWLVFWIVSNISPSFFPLALM 411
           GR GF++YW++T+ +M A+G  NENV+SLI+ Y  QY+  WL+ WI+ NISPSF+P+ L 
Sbjct: 404 GRGGFVIYWITTFYVMLAIGATNENVISLIVAYCPQYMPIWLISWIILNISPSFYPMVLN 463

Query: 412 NNFYRYGYMMPIHNAMDIYKVIFLNTYKGTLGRNYGILCAWVVINSILFVPVLKIVGNKM 471
           N FYRYGY MP+HNA+DIY+VIFL+  +  LGRNYGIL AWV +  I+F  V+KI G KM
Sbjct: 464 NQFYRYGYAMPLHNAVDIYRVIFLDLSRNKLGRNYGILTAWVAVTHIIFPFVMKIAGTKM 523

Query: 472 KQNAQK 477
           K NA K
Sbjct: 524 KSNAMK 529

>Scas_617.3
          Length = 541

 Score =  423 bits (1088), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 205/484 (42%), Positives = 310/484 (64%), Gaps = 22/484 (4%)

Query: 15  KEVAAGEQQ-SLNQFEQRCLDQAQS----EHDSVRTSLSEVASNDGG-SLQRMATSFFSP 68
           K+ A G    ++N F      Q Q+      ++ + ++++   N+    +    T  +SP
Sbjct: 54  KDAAKGSNSYAVNSFSSAAGSQPQAYNPDGQNTAKPAVTQPEENEENVPISPTKTRLYSP 113

Query: 69  RLQAQRKHVWFQFLFNILALAALTISVFSLYWGALYNRNSHLGKVRILAVIQDD------ 122
           +L +QRK +  +F+ + L LA + +S+ SLYWG+LY    HL ++ I+A+IQDD      
Sbjct: 114 KLASQRKKITVKFIISNLLLAGVCLSILSLYWGSLYQTTKHLERISIIAIIQDDYIPPND 173

Query: 123 ---GSLPGALPAIIDANPGGWHVYTSEQFQSKYHINE-TQIDSKIEHLVHTQKFWMSLNV 178
               S+   +P+ I+ + G WHVY    FQ K+++ + T I+ ++  L+H +K+W++LN+
Sbjct: 174 LNLTSVVAPVPSFIEQSTGKWHVYNQSYFQEKFNVQDPTMINERLNALIHDEKYWIALNI 233

Query: 179 KPNATNALHESLQNPSADPFVASNYFEAIYESGRDPTNFRSSILPLLQEVELSFQKNYTS 238
             N T  +  SL  P+   F ++ +   +YE+ R+PT   + +LP++QE+EL++Q  Y +
Sbjct: 234 GANLTMRIVNSLTTPNEPFFNSTQHIRVVYETSREPTTLEAYMLPIIQEIELAYQDFYHT 293

Query: 239 SYLPELLSH------TXXXXXXXXXXXXXXXXEFCSEDMRPFSNYVLLGPLQVGLIFCVL 292
            YLPELLS       T                +F  +D+  F + +L+ PLQVGLI+C++
Sbjct: 294 EYLPELLSKLQNSTTTPLSNTGAANLANIGKFQFDYDDILVFPDRILIAPLQVGLIYCLI 353

Query: 293 LTFFQLAMFGPLHGMVSPKLKPAHILIYRYCISMTAYFFLSLFFCTVSAIFQVDFTPTFG 352
           LT FQL++FGPLH  ++  LKP HI+IYR  +S   YFFLSLFFCTVSAIFQ+DFT TFG
Sbjct: 354 LTVFQLSLFGPLHAEMAKYLKPKHIIIYRLSVSWATYFFLSLFFCTVSAIFQIDFTVTFG 413

Query: 353 RAGFMVYWMSTWLIMAAVGGANENVLSLILPYGAQYLGFWLVFWIVSNISPSFFPLALMN 412
           + GF++YWM+T+L+M A+GGANENVLSLI+ +  +YL  WL+ WI+ NISP+F P+ L N
Sbjct: 414 KGGFVIYWMTTYLVMLALGGANENVLSLIILFIPEYLPLWLLSWIIMNISPTFNPMVLDN 473

Query: 413 NFYRYGYMMPIHNAMDIYKVIFLNTYKGTLGRNYGILCAWVVINSILFVPVLKIVGNKMK 472
            FYRYGYMMP+H A+DI+KV+FLN  K  +GRNYGIL AW+V+N+ LF  V+KIVG  ++
Sbjct: 474 VFYRYGYMMPLHQALDIFKVVFLNVSKRHMGRNYGILVAWIVVNTCLFPLVMKIVGKTVQ 533

Query: 473 QNAQ 476
           +  +
Sbjct: 534 KRME 537

>YJR015W (YJR015W) [2918] chr10 (462635..464167) Protein with
           similarity to Sng1p and multidrug resistance proteins
           [1533 bp, 510 aa]
          Length = 510

 Score =  377 bits (967), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 213/504 (42%), Positives = 304/504 (60%), Gaps = 30/504 (5%)

Query: 1   MSSSFATEPESLGFKEVAAGEQ-------QSLNQFEQRCLDQAQSEHDSVRTSLS---EV 50
           M+SS   + E   +  + A E+         L+      + Q   + D   T  S   E 
Sbjct: 1   MTSSL-DDIEPTAYNNMEADEEYCRRNDIHDLSSVVGDAVSQGVPDMDGQTTDSSKDPEP 59

Query: 51  ASNDGGSLQRMATSFFSPRLQAQRKHVWFQFLFNILALAALTISVFSLYWGALYNRNSHL 110
            S D  +    + SFFSP LQ QRK V  +F+F    LA +  ++F L+WGALY+ + +L
Sbjct: 60  NSEDKKAFPPSSGSFFSPNLQGQRKKVLLKFVFTNCLLAIICFTMFVLFWGALYDTSKYL 119

Query: 111 GKVRILAVIQDDG-------------SLPGALPAIIDANPGGWHVYTSEQFQSKYHINE- 156
            KV++L VIQ+               S+  ALP  I+  P  W +Y S  FQ+K+ +N  
Sbjct: 120 HKVKLLVVIQEPPVVILDNNSSMVVPSISYALPTFINKIPCDWDIYNSPTFQAKFDVNTP 179

Query: 157 TQIDSKIEHLVHTQKFWMSLNVKPNATNALHESLQNPSADPFVASNYFEAIYESGRDPTN 216
            Q++ K+  LV+ +K+W ++N+KPNAT  L ESL N +A  F ++ + + +YE+GRDPTN
Sbjct: 180 QQVNDKVVDLVYDEKYWFAINIKPNATETLFESLINDTAPLFNSTLFNQVVYETGRDPTN 239

Query: 217 FRSSILPLLQEVELSFQKNYTSSYLPELLSHTX-----XXXXXXXXXXXXXXXEFCSEDM 271
            +S+ILP+ Q +E  +   YT +YLP LL++                       +   D 
Sbjct: 240 LKSTILPVAQTIEEYYHTFYTLNYLPPLLTNITQVYRYALTNNARYIAAAGKYNYEYYDH 299

Query: 272 RPFSNYVLLGPLQVGLIFCVLLTFFQLAMFGPLHGMVSPKLKPAHILIYRYCISMTAYFF 331
           RPF++ +LL P Q+G+++C+LLTFFQ  ++GPLH  ++  L+PA+ LIYR  +S   +FF
Sbjct: 300 RPFTDRILLAPTQIGVVYCLLLTFFQFLLYGPLHVEMAKVLRPANGLIYRIAMSWFTFFF 359

Query: 332 LSLFFCTVSAIFQVDFTPTFGRAGFMVYWMSTWLIMAAVGGANENVLSLILPYGAQYLGF 391
            SLFFCT +AIFQVDFT +FGR GF+VYWMSTWL M A GGANEN + L++  G QYLGF
Sbjct: 360 ASLFFCTTTAIFQVDFTKSFGRGGFVVYWMSTWLFMLAAGGANENAVMLVITLGPQYLGF 419

Query: 392 WLVFWIVSNISPSFFPLALMNNFYRYGYMMPIHNAMDIYKVIFLNTYKGTLGRNYGILCA 451
           W++ +++ NI+PSFFPLAL NN YRYGYMMP+HN +DIY+VIF +  +  +GRNYGIL A
Sbjct: 420 WILSFVILNIAPSFFPLALNNNVYRYGYMMPVHNVIDIYRVIFFDVTRRKMGRNYGILVA 479

Query: 452 WVVINSILFVPVLKIVGNKMKQNA 475
            + +N+ L   V K    K+KQ A
Sbjct: 480 LIALNTALLPFVGKYASRKLKQKA 503

>CAGL0B03949g complement(387861..389759) similar to sp|P46950
           Saccharomyces cerevisiae YGR197c SNG1 or sp|P47090
           Saccharomyces cerevisiae YJR015w, hypothetical start
          Length = 632

 Score =  377 bits (967), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 185/452 (40%), Positives = 286/452 (63%), Gaps = 24/452 (5%)

Query: 50  VASNDGGSLQRMA---------TSFFSPRLQAQRKHVWFQFLFNILALAALTISVFSLYW 100
           +A ++G  + R++         TS FS R++  R+ +  +F+   + LA   I   SLYW
Sbjct: 147 MADDEGDVISRVSSTASQWKKKTSLFSKRMKDHRRRILAKFISTHILLAIFVIGALSLYW 206

Query: 101 GALYNRNSHLGKVRILAVIQD------DGSLPGALPA----IIDANPGGWHVYTSEQFQS 150
           GA+YN + +L +V  +AVIQD      DG++  AL      II++ PG W +  S +F+ 
Sbjct: 207 GAIYNYSGNLYRVHSIAVIQDEPYTAPDGTVIPALTRNVTNIINSIPGNWRIMNSTEFKV 266

Query: 151 KYHI-NETQIDSKIEHLVHTQKFWMSLNVKPNATNALHESLQNPSADPFVASNYFEAIYE 209
            Y++ N  +ID K+  L+  +KFW+++NV+  AT A ++S+    A  F ++NYF++IYE
Sbjct: 267 IYNVTNAQEIDEKVAELIFDEKFWLAVNVREGATEAFYKSVTEEGAPVFNSTNYFQSIYE 326

Query: 210 SGRDPTNFRSSILPLLQEVELSFQKNYTSSYLPELLSH--TXXXXXXXXXXXXXXXXEFC 267
           SGRDPTN +SSI P+L + E  F+  Y   Y+PE + +  +                 F 
Sbjct: 327 SGRDPTNLKSSIYPILAKFESVFRSQYLKIYVPEFIKNITSPDFNETVNTANLYGLGNFA 386

Query: 268 --SEDMRPFSNYVLLGPLQVGLIFCVLLTFFQLAMFGPLHGMVSPKLKPAHILIYRYCIS 325
             S D+RPF++ VLLGPL +GL + ++ + F +++FGP++  ++  LKP  +  YR  IS
Sbjct: 387 TNSYDLRPFTDRVLLGPLSMGLNYNIMFSVFSISIFGPVNKEMAKYLKPRSLFFYRILIS 446

Query: 326 MTAYFFLSLFFCTVSAIFQVDFTPTFGRAGFMVYWMSTWLIMAAVGGANENVLSLILPYG 385
            + +FFLSLF CTVSAIFQ+DFTP FG+AGF++YWM++WL+M AVG ANEN+LS+IL + 
Sbjct: 447 WSMFFFLSLFTCTVSAIFQIDFTPGFGKAGFVIYWMTSWLVMTAVGMANENILSIILTFC 506

Query: 386 AQYLGFWLVFWIVSNISPSFFPLALMNNFYRYGYMMPIHNAMDIYKVIFLNTYKGTLGRN 445
            QY+ +W++ W + NI+PS +PL L++ FYR+GY MPIHN + IY+VIFL+  +  + RN
Sbjct: 507 PQYMSYWMIIWTILNIAPSLYPLVLISRFYRFGYAMPIHNGVQIYRVIFLDISRHQMSRN 566

Query: 446 YGILCAWVVINSILFVPVLKIVGNKMKQNAQK 477
           YGIL AWV +N+ +   V K +   +K+  ++
Sbjct: 567 YGILAAWVAVNTAINPFVNKFISKVVKKREER 598

>Scas_647.9
          Length = 449

 Score =  365 bits (938), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 179/423 (42%), Positives = 264/423 (62%), Gaps = 16/423 (3%)

Query: 70  LQAQRKHVWFQFLFNILALAALTISVFSLYWGALYNRNSHLGKVRILAVIQDDG-----S 124
           ++ +RK+V   F F    LA    ++F L+WG  Y       +V+ILAVIQD+G      
Sbjct: 1   MKGERKNVLINFAFTNGVLAVFCFTIFVLFWGINYRITDKYHRVQILAVIQDEGINNSTV 60

Query: 125 LPGA--LPAIIDANPGGWHVYTSEQFQSKYHINETQ-IDSKIEHLVHTQKFWMSLNVKPN 181
           LP A  LP ++  NP  WH+Y +  F  K+  N T+ ID ++ H V ++ +WM+LNVKPN
Sbjct: 61  LPMASILPTLMQENPATWHLYNTTSFNEKFGTNSTEAIDKEVIHEVFSEHYWMALNVKPN 120

Query: 182 ATNALHESLQNPSADPFVASNYFEAIYESGRDPTNFRSSILPLLQEVELSFQKNYTSSYL 241
           AT AL E+  NP+  PF ++ YF+A++ S RDP+NFR ++LPL++ +E +++  Y ++Y 
Sbjct: 121 ATQALFETFINPNGPPFNSTEYFQAVFLSARDPSNFRVTLLPLIEFLETAYRNYYINTYF 180

Query: 242 PELLSHTXX----XXXXXXXXXXXXXXEFCSEDMRPFSNYVLLGPLQVGLIFCVLLTFFQ 297
           P+ +S+                      F   D RPF+   L+ P+ +G+ +C+LLTFFQ
Sbjct: 181 PQFMSNVSIANNLTTVNVTNIALAGAMNFDYFDYRPFTERELIAPVMIGVAYCLLLTFFQ 240

Query: 298 LAMFGPLHGMVSPKLKPAHILIYRYCISMTAYFFLSLFFCTVSAIFQVDFTPTFGRAGFM 357
             ++  LH   S  LKP  ++ YR  +     F  SLFFCT SAIFQVDFT  FG+ GF+
Sbjct: 241 FLVYSGLHAETSRLLKPNQVIYYRIIMLWCTMFIASLFFCTTSAIFQVDFTRAFGKGGFV 300

Query: 358 VYWMSTWLIMAAVGGANENVLSLILPYGAQYLGFWLVFWIVSNISPSFFPLALMNNFYRY 417
           VYWM+TWL M A GG NEN +SL+   G ++LG W++ +I+ NI+P+F+PL L N  YRY
Sbjct: 301 VYWMTTWLFMVACGGTNENAVSLLFLMGPRFLGIWILSFIILNITPTFYPLILANPVYRY 360

Query: 418 GYMMPIHNAMDIYKVIFLNTYKGTLGRNYGILCAWVVINS----ILFVPVLKIVGNKMKQ 473
           GYMMP+HNA+DIY+VIFL+  K  +GRN+G+L AW+ +N+     ++  V KI+ N++ +
Sbjct: 361 GYMMPVHNAIDIYRVIFLDLSKHKMGRNFGLLIAWIAMNTAALPFVYKFVSKILTNRVVE 420

Query: 474 NAQ 476
            AQ
Sbjct: 421 EAQ 423

>CAGL0B03971g complement(390700..392331) similar to sp|P47090
           Saccharomyces cerevisiae YJR015w or sp|P46950
           Saccharomyces cerevisiae YGR197c SNG1, hypothetical
           start
          Length = 543

 Score =  342 bits (877), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 180/435 (41%), Positives = 265/435 (60%), Gaps = 14/435 (3%)

Query: 57  SLQRMATSFFSPRLQAQRKHVWFQFLFNILALAALTISVFSLYWGALYNRNSHLGKVRIL 116
           +L +  T FFSP  + QRK V +++L  +  L     ++  L WG LY    ++ + ++L
Sbjct: 102 TLTKTKTRFFSPNFKDQRKRVAYRWLLAVFLLMCFCFTILVLMWGVLYRTPHYVRRAKVL 161

Query: 117 AVIQDDG-----------SLPGALPAIIDANPGGWHVYTSEQFQSKYHINETQ-IDSKIE 164
           AVIQ+D            S+   L  II   P  W +Y +  FQ KY++   + ++ K+ 
Sbjct: 162 AVIQEDQVYRFNDTVQFPSVSSPLYDIIAEVPLSWEIYNATSFQIKYNVEGIEAMNQKVI 221

Query: 165 HLVHTQKFWMSLNVKPNATNALHESLQNPSAD-PFVASNYFEAIYESGRDPTNFRSSILP 223
            LV+ ++FW++LNV+ N T+ L  SL +  +D  F +++ FE +YESGRD TN  S +LP
Sbjct: 222 DLVYKEEFWLALNVQGNVTDTLVRSLISADSDVQFNSTSLFEVVYESGRDITNLPSVLLP 281

Query: 224 LLQEVELSFQKNYTSSYLPELLSH-TXXXXXXXXXXXXXXXXEFCSEDMRPFSNYVLLGP 282
           + Q +E  FQK YT  YLP+LL + T                +F   D RP ++ V L  
Sbjct: 282 VFQGIEGVFQKVYTYQYLPQLLGNITNGDNFNPARVAAAGRMKFNYNDYRPVTDRVTLLS 341

Query: 283 LQVGLIFCVLLTFFQLAMFGPLHGMVSPKLKPAHILIYRYCISMTAYFFLSLFFCTVSAI 342
            Q+G ++C+LLT FQ  +FGPLHG +S  +K +++ IYR  +  +  FF+S+F+CTVSA+
Sbjct: 342 TQIGAVYCLLLTVFQFLVFGPLHGEMSRMIKFSNLWIYRLIVLWSVLFFVSIFWCTVSAM 401

Query: 343 FQVDFTPTFGRAGFMVYWMSTWLIMAAVGGANENVLSLILPYGAQYLGFWLVFWIVSNIS 402
           +QVDFT  FGRAGF+VYWMST+L M AVGG NENV+ LI+     Y+GFW++ +++ N++
Sbjct: 402 YQVDFTKAFGRAGFVVYWMSTYLYMLAVGGLNENVIMLIILISPSYIGFWILSFVILNLA 461

Query: 403 PSFFPLALMNNFYRYGYMMPIHNAMDIYKVIFLNTYKGTLGRNYGILCAWVVINSILFVP 462
           P+FF +   N FYRYGY MP+H  + I +VIF +  K  LGRNYGILCAWV +N+I    
Sbjct: 462 PAFFAIGYANVFYRYGYAMPLHCIVGINRVIFFDISKHQLGRNYGILCAWVGLNTISMPF 521

Query: 463 VLKIVGNKMKQNAQK 477
           V K V   + + A+K
Sbjct: 522 VSKFVLKTLHKRARK 536

>ADL193C [1548] [Homologous to ScYGR197C (SNG1) - NSH]
           (357909..359306) [1398 bp, 465 aa]
          Length = 465

 Score =  318 bits (814), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 184/468 (39%), Positives = 268/468 (57%), Gaps = 18/468 (3%)

Query: 25  LNQFEQRCLD-QAQSEHDSVRTSLSEVASND---------GGSLQRMATSFFSPRLQAQR 74
           +N  E    D +  S  +SV+  L E   N          GG L R+ T F SPR+   R
Sbjct: 1   MNVQEDESTDFEDDSRTESVQMYLGEYPKNAEREGSGEMLGGKLARLKTRFMSPRVYLAR 60

Query: 75  KHVWFQFLFNILALAALTISVFSLYWGALYNRNSHLGKVRILAVIQD-DGSLPGALPAII 133
           K +   FL N L LA L + VFSL+ G L N+  +LG++ +L V+QD D  +   L    
Sbjct: 61  KRLLVLFLSNKLFLACLVLVVFSLHVGVLVNQQQYLGRLPMLMVVQDEDAGMSAELLRAA 120

Query: 134 DANPGGWHVYTSEQFQSKYHINE-TQIDSKIEHLVHTQKFWMSLNVKPNATNALHESLQN 192
           +   G W         S + + E   +D  ++ L+   ++WM+L+V+P AT AL  SL +
Sbjct: 121 EHAAGRWTTVHGAAAWSHFGLEEDADLDEYLQSLIRKHRYWMALHVRPGATEALRRSLDD 180

Query: 193 PSADPFVASNYFEAIYESGRDPTNFRSSILPLLQEVELSFQKNYTSSYLPELL---SHTX 249
           P A  F +S +F+  YE+ RD  N   S+  L++ +E +F+  Y  ++LP  L   ++T 
Sbjct: 181 PGAPVFNSSEFFKVYYETVRD-FNAMGSVRKLMETLEANFRAYYLDTWLPGELRERANTI 239

Query: 250 XXXXXXXXXXXXXXXEFCSEDMRPFSNYVLLGPLQVGLIFCVLLTFFQLAMFGPLHGMVS 309
                           +   D+ PF +  L G LQVG+I C+LLTFFQLAM   LH  +S
Sbjct: 240 DLSSTGSNIVAAGSMRWSYVDLGPFYDPSLYGILQVGMIICLLLTFFQLAMISALHTELS 299

Query: 310 PKLKPAHILIYRYCISMTAYFFLSLFFCTVSAIFQVDFTPTFGRAGFMVYWMSTWLIMAA 369
             L+ +H+L+YRY +S  +Y  LSLF+  V  I+ +D    +GRAGF+V+WM+TWL M A
Sbjct: 300 LLLRTSHLLLYRYIVSYASYLLLSLFYSIVPIIYHLDMEKAYGRAGFLVFWMTTWLFMTA 359

Query: 370 VGGANENVLSLILPYGAQYLGFWLVFWIVSNISPSFFPLALMNNFYRYGYMMPIHNAMDI 429
           +GGANENV+S+I  Y  +++GFWL+FWIV NI+P+F+ L L N+FY+YGY+ PI+NA + 
Sbjct: 360 LGGANENVISVIFEYCPRFVGFWLMFWIVFNITPTFYSLHLANDFYKYGYITPIYNAREC 419

Query: 430 YKVIFLNTYKGTLGRNYGILCAWVVINSILFVPVLKIVGNKMKQNAQK 477
           YKV+  +T +G L   Y +L AW V+N+ LF   LKIV   +K   QK
Sbjct: 420 YKVLLFDTDRGYLKVAYVVLVAWTVLNAALFPLALKIV--NIKSGKQK 465

>Scas_434.1
          Length = 357

 Score =  161 bits (407), Expect = 6e-45,   Method: Compositional matrix adjust.
 Identities = 98/306 (32%), Positives = 159/306 (51%), Gaps = 25/306 (8%)

Query: 23  QSLNQFEQRCLDQAQSEHDSVRTSLSEVASNDGG----SLQRMA---TSFFSPRLQAQRK 75
           QS++       ++ Q+     RTSLS+    D      SL  +A   T+ FSP L   RK
Sbjct: 52  QSMDNLNTTSDEEKQNPLKERRTSLSQHPGEDEAITIASLPELAPAKTTLFSPHLTQHRK 111

Query: 76  HVWFQFLFNILALAALTISVFSLYWGALYNRNSHLGKVRILAVIQDD---------GSLP 126
            ++++F+     +     +V  ++WG LY  N +  KV  L V+QD+          S+ 
Sbjct: 112 KIFWKFISINAIIGLFCCTVLPIFWGCLYGTNQYFHKVHYLMVVQDEPLQLGGLSVPSMA 171

Query: 127 GALPAIIDANPGGWHVYTSEQFQSKYHI-NETQIDSKIEHLVHTQKFWMSLNVKPNATNA 185
             LP I+ + PG WHVY +  F   YH+ N + I++K+  L+  ++FW+++NVKPNAT +
Sbjct: 172 SFLPEIVPSLPGTWHVYNTSTFMDHYHLTNASDINNKVVDLIFQERFWVAVNVKPNATAS 231

Query: 186 LHESLQNP-SADP---FVASNYFEAIYESGRDPTNFRSSILPLLQEVELSFQKNYTSSYL 241
           L +SL  P S  P   F A+N+F+ IYE+ RD T+ +++++ ++QE+E ++++ Y   YL
Sbjct: 232 LMQSLVQPQSTTPETLFNATNFFQVIYETARDVTSVQAAMVLVVQEMESAYREIYMEQYL 291

Query: 242 PELLSH----TXXXXXXXXXXXXXXXXEFCSEDMRPFSNYVLLGPLQVGLIFCVLLTFFQ 297
           P +L+                       F   D R F N  L+GPL  G I+ + +T FQ
Sbjct: 292 PTILAQMDPTNQISSLAPTSLSRATNINFQYWDYRSFYNRALMGPLLAGTIYSLTITVFQ 351

Query: 298 LAMFGP 303
             +F P
Sbjct: 352 FLIFTP 357

>Scas_617.0d
          Length = 46

 Score = 52.8 bits (125), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 21/45 (46%), Positives = 33/45 (73%)

Query: 429 IYKVIFLNTYKGTLGRNYGILCAWVVINSILFVPVLKIVGNKMKQ 473
           +YKVIF +  +  +GRNYGIL AW+V+N+ LF  ++K VG  +++
Sbjct: 2   VYKVIFCDLERSKMGRNYGILVAWIVLNTCLFPFIMKFVGKTLQE 46

>Sklu_2068.1 YNL059C, Contig c2068 494-2198
          Length = 569

 Score = 30.0 bits (66), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 35/118 (29%), Positives = 49/118 (41%), Gaps = 31/118 (26%)

Query: 59  QRMATSFFSPRLQAQRKHVWFQFLFNILALAALTISVFSLYWGALYNRNSHLGKVRILAV 118
           ++MAT      LQ+QR + W+Q +F    +  LT  + SL+     N++   G V I + 
Sbjct: 137 EKMAT------LQSQRSN-WYQLMFECFGVPKLTFGIDSLFSYFANNQSDSTGLV-ISSG 188

Query: 119 IQDDGSLP-----GALPAIIDANPGGWHV--YT----------------SEQFQSKYH 153
            +D   +P     G L      N GG H   YT                S QFQS YH
Sbjct: 189 NEDTNVIPVVCGKGILSEAKRINWGGRHSVEYTTNLLSLKYPYFPTKLVSSQFQSIYH 246

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.324    0.137    0.422 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 15,169,972
Number of extensions: 637287
Number of successful extensions: 1972
Number of sequences better than 10.0: 16
Number of HSP's gapped: 1968
Number of HSP's successfully gapped: 16
Length of query: 487
Length of database: 16,596,109
Length adjustment: 106
Effective length of query: 381
Effective length of database: 12,926,601
Effective search space: 4925034981
Effective search space used: 4925034981
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 63 (28.9 bits)