Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Sklu_2286.333833817040.0
Kwal_27.126133113477851e-103
ADL330W2762997039e-92
YBR105C (VID24)3623096813e-87
CAGL0K12254g3353216202e-78
KLLA0B09592g3333255975e-75
Scas_718.43563265273e-64
Scas_667.273322582831e-28
YGR066C2922462011e-17
YML118W (NGL3)50526637.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Sklu_2286.3
         (338 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Sklu_2286.3 YBR105C, Contig c2286 2431-3447 reverse complement        660   0.0  
Kwal_27.12613                                                         306   e-103
ADL330W [1411] [Homologous to ScYBR105C (VID24) - SH] complement...   275   9e-92
YBR105C (VID24) [294] chr2 complement(450838..451926) Protein re...   266   3e-87
CAGL0K12254g complement(1196376..1197383) similar to sp|P38263 S...   243   2e-78
KLLA0B09592g 834414..835415 weakly similar to sp|P38263 Saccharo...   234   5e-75
Scas_718.4                                                            207   3e-64
Scas_667.27                                                           113   1e-28
YGR066C (YGR066C) [2028] chr7 complement(620923..621801) Protein...    82   1e-17
YML118W (NGL3) [3853] chr13 (32334..33851) Protein with possible...    29   7.2  

>Sklu_2286.3 YBR105C, Contig c2286 2431-3447 reverse complement
          Length = 338

 Score =  660 bits (1704), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 317/338 (93%), Positives = 317/338 (93%)

Query: 1   MINETVKSLKKDAVLSSVCPRPLTPPLQLTNKLIQQCREEESLYKCSSRDSLASLNSLQH 60
           MINETVKSLKKDAVLSSVCPRPLTPPLQLTNKLIQQCREEESLYKCSSRDSLASLNSLQH
Sbjct: 1   MINETVKSLKKDAVLSSVCPRPLTPPLQLTNKLIQQCREEESLYKCSSRDSLASLNSLQH 60

Query: 61  QDSIASPKKYILEDNSAYNNVSNDTRVDATTRTNFLKPRMKFTGYQVSGYKKYQVIVDLQ 120
           QDSIASPKKYILEDNSAYNNVSNDTRVDATTRTNFLKPRMKFTGYQVSGYKKYQVIVDLQ
Sbjct: 61  QDSIASPKKYILEDNSAYNNVSNDTRVDATTRTNFLKPRMKFTGYQVSGYKKYQVIVDLQ 120

Query: 121 XXXXXXXXXXXXXXXXXXXXXIRGLTNQHPEITTFFESFTVMDTIGFLSSCIPEELNAYK 180
                                IRGLTNQHPEITTFFESFTVMDTIGFLSSCIPEELNAYK
Sbjct: 121 TVDLPTTPATTTTPHLTGFLTIRGLTNQHPEITTFFESFTVMDTIGFLSSCIPEELNAYK 180

Query: 181 GNDHVDLEHWLNFPCFKELCMRRPASNNKHSSSTSYACNGKPNAYHKYTNYANVQSNCVG 240
           GNDHVDLEHWLNFPCFKELCMRRPASNNKHSSSTSYACNGKPNAYHKYTNYANVQSNCVG
Sbjct: 181 GNDHVDLEHWLNFPCFKELCMRRPASNNKHSSSTSYACNGKPNAYHKYTNYANVQSNCVG 240

Query: 241 GDADVNILHQILNGQYTHENYLCNRFIFMRWKEKFLVPDAEIDSVEGASYDGYYYIVHDQ 300
           GDADVNILHQILNGQYTHENYLCNRFIFMRWKEKFLVPDAEIDSVEGASYDGYYYIVHDQ
Sbjct: 241 GDADVNILHQILNGQYTHENYLCNRFIFMRWKEKFLVPDAEIDSVEGASYDGYYYIVHDQ 300

Query: 301 VTGNILGFYYHKDAEKFQQLELSPVMSGMESACDFEFC 338
           VTGNILGFYYHKDAEKFQQLELSPVMSGMESACDFEFC
Sbjct: 301 VTGNILGFYYHKDAEKFQQLELSPVMSGMESACDFEFC 338

>Kwal_27.12613
          Length = 311

 Score =  306 bits (785), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 173/347 (49%), Positives = 208/347 (59%), Gaps = 47/347 (13%)

Query: 1   MINET-VKSLKKDAVLSSVCPRPLTPPLQLT--NKLIQQCREEESLYKCSSRDSLASLNS 57
           MINET VK LK     S    R ++PPL  +  N+ +  C+  + LY+CSS DS+ SL  
Sbjct: 1   MINETTVKQLKPSTHESPQ--RAVSPPLLASPNNRHVMTCKATDELYRCSSVDSVDSLRH 58

Query: 58  LQHQDSI--ASPKKYILEDNSAYNNVSNDTRVDA----TTRTNFLKPRMKFTGYQVSGYK 111
                 +  A+ +KYI ED S Y + +   R       T  TNFL+PRM+F+GYQ+S YK
Sbjct: 59  TFTPSGVSSAATRKYIAEDRSRYESRARARRAARRAPHTCCTNFLRPRMQFSGYQISDYK 118

Query: 112 KYQVIVDLQXXXXXXXXXXXXXXXXXXX-XXIRGLTNQHPEITTFFESFTVMDTIGFLSS 170
           KYQV V LQ                      IRGLT+QHPEITTFF+ + V D +GFLSS
Sbjct: 119 KYQVTVSLQTVALPDAPGSSAMAPHVTGFLSIRGLTSQHPEITTFFDGYAVTDNLGFLSS 178

Query: 171 CIPEELNAYKGNDHVDLEHWLNFPCFKELCMRRPASNNKHSSSTSYACNGKPNAYHKYTN 230
            +P EL+A+K  D  DLEHWL+FPCFKELC  RP S          AC            
Sbjct: 179 ALPPELDAFKATDKTDLEHWLSFPCFKELC--RPES----------AC------------ 214

Query: 231 YANVQSNCVGGDADVNILHQILNGQYTHENYLCNRFIFMRWKEKFLVPDAEIDSVEGASY 290
                      D   N+L  +L G Y+HE+YL NRFI+MRWKEKFLVPDAEIDSVEGASY
Sbjct: 215 -----------DEGTNVLGAVLEGSYSHEDYLQNRFIYMRWKEKFLVPDAEIDSVEGASY 263

Query: 291 DGYYYIVHDQVTGNILGFYYHKDAEKFQQLELSPVMSGMESACDFEF 337
           DGYYYIVHDQVTG+ILGFYYH+DAEKFQQLEL+P+       C FEF
Sbjct: 264 DGYYYIVHDQVTGHILGFYYHQDAEKFQQLELTPLQDPCAGDCSFEF 310

>ADL330W [1411] [Homologous to ScYBR105C (VID24) - SH]
           complement(121954..122784) [831 bp, 276 aa]
          Length = 276

 Score =  275 bits (703), Expect = 9e-92,   Method: Compositional matrix adjust.
 Identities = 150/299 (50%), Positives = 173/299 (57%), Gaps = 46/299 (15%)

Query: 42  SLYKCSSRDSLASLNSLQHQDSIASP--KKYILEDNSAYNNVSNDTRVDATTRTNFLKPR 99
            L++C S +SLAS  +     +  SP  +KY+              R  ATT TN+L+P 
Sbjct: 20  GLFRCGSGESLASAWTAD-TSAGCSPCARKYMAGLGGGGGGGKAAPR--ATTTTNWLRPL 76

Query: 100 MKFTGYQVSGYKKYQVIVDLQXXXXXXXX-XXXXXXXXXXXXXIRGLTNQHPEITTFFES 158
           M F GYQ+SGYKKYQV V LQ                      IRGLTNQHPEITTFFES
Sbjct: 77  MAFQGYQISGYKKYQVHVLLQTVALPTKGCATATTPHVTGFLTIRGLTNQHPEITTFFES 136

Query: 159 FTVMDTIGFLSSCIPEELNAYKGNDHVDLEHWLNFPCFKELCMRRPASNNKHSSSTSYAC 218
           F V DT+GFLSS +P EL  YK +D VDLEHWLNFP FKELCM                 
Sbjct: 137 FAVNDTVGFLSSSMPPELAEYKSSDRVDLEHWLNFPSFKELCM----------------- 179

Query: 219 NGKPNAYHKYTNYANVQSNCVGGDADVNILHQILNGQYTHENYLCNRFIFMRWKEKFLVP 278
                                GG   V     I++G YTH +YL  RF+FMRWKEKFLVP
Sbjct: 180 --------------------AGGGTTVA---DIMDGHYTHRDYLARRFVFMRWKEKFLVP 216

Query: 279 DAEIDSVEGASYDGYYYIVHDQVTGNILGFYYHKDAEKFQQLELSPVMSGMESACDFEF 337
           D E+ +VEGASYDGYYYIVHDQVTG++LGFYYHKDAEKFQQLEL+PV    +  C FEF
Sbjct: 217 DEEVGAVEGASYDGYYYIVHDQVTGSVLGFYYHKDAEKFQQLELTPVYPDRQGVCCFEF 275

>YBR105C (VID24) [294] chr2 complement(450838..451926) Protein
           required for vacuolar import and degradation of Fbp1p
           (fructose-1,6-bisphosphatase) [1089 bp, 362 aa]
          Length = 362

 Score =  266 bits (681), Expect = 3e-87,   Method: Compositional matrix adjust.
 Identities = 148/309 (47%), Positives = 191/309 (61%), Gaps = 18/309 (5%)

Query: 39  EEESLYKCSSRDSLASLNSLQHQDSIASPKKYILEDNSAY---NNVSNDTRVDATTRTNF 95
           +E+ LYKC+SRDSL+SL  L H  + ++ KKYI+ED S Y   N V   +  + T  TN+
Sbjct: 63  QEQDLYKCASRDSLSSLQQLAHTPNGSTRKKYIVEDQSPYSSENPVIVTSSYNHTVCTNY 122

Query: 96  LKPRMKFTGYQVSGYKKYQVIVDLQXXXXXXXXXXXXXXXXXXXXXIRGLTNQHPEITTF 155
           L+PRM+FTGYQ+SGYK+YQV V+L+                     IRGLTNQHPEI+T+
Sbjct: 123 LRPRMQFTGYQISGYKRYQVTVNLKTVDLPKKDCTSLSPHLSGFLSIRGLTNQHPEISTY 182

Query: 156 FESFTV-MDTIGFLSSCIPEE--LNAYKGNDHVDLEHWLNFPCFKELCMRRPASNNKHSS 212
           FE++ V    +GFLSS   +E  LN +K  D  DLEHW+NFP F++L +      ++ + 
Sbjct: 183 FEAYAVNHKELGFLSSSWKDEPVLNEFKATDQTDLEHWINFPSFRQLFLM-----SQKNG 237

Query: 213 STSYACNGKPNAYHKYTNYANVQSNCVGGDADVNILHQILNGQYTHENYLCNRFIFMRWK 272
             S   NG  NA  K       Q       AD   + +I + +   +NYL  RFIFM+WK
Sbjct: 238 LNSTDDNGTTNAAKKLP----PQQLPTTPSADAGNISRIFSQEKQFDNYLNERFIFMKWK 293

Query: 273 EKFLVPDAEI-DSVEGASYDGYYYIVHDQVTGNILGFYYHKDAEKFQQLELSPVMSGM-- 329
           EKFLVPDA + + V+GASYDG+YYIVHDQVTGNI GFYYH+DAEKFQQLEL P +     
Sbjct: 294 EKFLVPDALLMEGVDGASYDGFYYIVHDQVTGNIQGFYYHQDAEKFQQLELVPSLKNKVE 353

Query: 330 ESACDFEFC 338
            S C FEF 
Sbjct: 354 SSDCSFEFA 362

>CAGL0K12254g complement(1196376..1197383) similar to sp|P38263
           Saccharomyces cerevisiae YBR105c VID24 required for
           vacuolar import and degradation of FBP1P, hypothetical
           start
          Length = 335

 Score =  243 bits (620), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 142/321 (44%), Positives = 185/321 (57%), Gaps = 40/321 (12%)

Query: 38  REEESLYKCSSRDSLASLNSLQHQDS-----IASPKKYILEDNSAYNNVSNDTRVDAT-- 90
           R  E LYKC S+DSL SL  L  + S     +   KKYI+ D S+Y  VS    V  T  
Sbjct: 35  RPLEGLYKCHSKDSLPSLQHLIDRSSSESLPLKKKKKYIMNDRSSYTTVSVPRYVTPTHK 94

Query: 91  --TRTNFLKPRMKFTGYQVSGYKKYQVIVDLQXXXXXXXXXXXXXXXXXXX--XXIRGLT 146
             T+TNFL+PR++F+GYQ+SGYK+YQV V L+                       I+GLT
Sbjct: 95  NTTQTNFLRPRLEFSGYQLSGYKRYQVNVSLKTVDLPTVESGNTTTTPHITGYLTIKGLT 154

Query: 147 NQHPEITTFFESFTV-MDTIGFLSSCIPEELN--AYKGNDHVDLEHWLNFPCFKELCMRR 203
           +QHPEITTFFE++ V  + +GFLSS  PEE N   YK +D  DLEHWLNFP F+EL + +
Sbjct: 155 SQHPEITTFFEAYAVEHNELGFLSSQWPEENNYEPYKSDDQTDLEHWLNFPAFRELFIAQ 214

Query: 204 PASNNKHSSSTSYACNGKPNAYHKYTNYANVQSNCVGGDADVNILHQIL---NGQYTHEN 260
            A+  K     +     K  +                    +N L ++      Q    N
Sbjct: 215 HANLVKEDEEATPDFKKKRQS--------------------INTLAELFMENQAQNEGRN 254

Query: 261 YLCNRFIFMRWKEKFLVPDAEIDSVEGASYDGYYYIVHDQVTGNILGFYYHKDAEKFQQL 320
           YL +R+IFMRWKEKFLVPDA +++V+GASYDG+YY+VHDQ+TG + GFYYH+DAE+FQQL
Sbjct: 255 YLNDRYIFMRWKEKFLVPDAFVENVDGASYDGFYYVVHDQLTGCMQGFYYHQDAERFQQL 314

Query: 321 ELSPVMSGME---SACDFEFC 338
           EL P     +   S+C FE  
Sbjct: 315 ELVPCKKAQDLCNSSCTFELA 335

>KLLA0B09592g 834414..835415 weakly similar to sp|P38263
           Saccharomyces cerevisiae YBR105c VID24 required for
           vacuolar import and degradation of FBP1P, hypothetical
           start
          Length = 333

 Score =  234 bits (597), Expect = 5e-75,   Method: Compositional matrix adjust.
 Identities = 134/325 (41%), Positives = 182/325 (56%), Gaps = 49/325 (15%)

Query: 20  PRPLTPPLQLTNKLIQQCREEESLYKCSSRDSLASLNSLQHQDSIASPKKYILEDNSAYN 79
           P PLTP                SL++  S DS+ S+   +  ++    + Y ++D S   
Sbjct: 52  PAPLTPFFHRNPYF-----RNTSLHRTGSHDSINSIR--RSHENFQDSEDYDIQD-SCSP 103

Query: 80  NVSNDTRVDATT-----RTNFLKPRMKFTGYQVSGYKKYQVIVDLQXXXXXXXXXXXX-X 133
           ++++  R    T     RT++L  R +F GYQ+SGYKK+QV++ +Q              
Sbjct: 104 SLNSPPRSRPQTPKNHERTHWLGARKRFVGYQLSGYKKFQVMITIQSVSLPNDNESNCCS 163

Query: 134 XXXXXXXXIRGLTNQHPEITTFFESFTVMDTIGFLSSCIPEELNAYKGNDHVDLEHWLNF 193
                   I+GLT Q+PEITTFFES TV D++GFLS  IP +  +YK +D  DLEHWLNF
Sbjct: 164 PHLTGFLSIKGLTVQNPEITTFFESITVTDSLGFLSKDIPIDYASYKASDQTDLEHWLNF 223

Query: 194 PCFKELCMRRPASNNKHSSSTSYACNGKPNAYHKYTNYANVQSNCVGGDADVNILHQILN 253
           P FKELCM+   ++ K+ S                                 NIL  I++
Sbjct: 224 PSFKELCMQ---NDPKYPSK--------------------------------NILQSIID 248

Query: 254 GQYTHENYLCNRFIFMRWKEKFLVPDAEIDSVEGASYDGYYYIVHDQVTGNILGFYYHKD 313
           G Y+H +YL  RF++MRW EKFLVPDA+++S++GASYDGYYYIVHDQ+ GNILGFYYH+ 
Sbjct: 249 GTYSHTDYLNQRFLYMRWNEKFLVPDADLESIDGASYDGYYYIVHDQLLGNILGFYYHEH 308

Query: 314 AEKFQQLELSPVMSGMESACDFEFC 338
           AE+FQQLEL P+       C FEF 
Sbjct: 309 AERFQQLELQPLQEPSIGDCSFEFA 333

>Scas_718.4
          Length = 356

 Score =  207 bits (527), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 132/326 (40%), Positives = 166/326 (50%), Gaps = 68/326 (20%)

Query: 41  ESLYKCSSRDSLASLNSLQHQDSIASP--------------KKYILEDNSAYNNVSNDTR 86
           + +Y+C S DSL SL++L    S+                 KKYI  DNS+Y+   N+  
Sbjct: 71  DEIYRCESNDSLPSLHNLASSSSLTLKSPSSSLSPSPSSSYKKYINNDNSSYSQSYNNIP 130

Query: 87  VDATTRTNFLKPRMKFTGYQVSGYKKYQVIVDLQXXX--XXXXXXXXXXXXXXXXXXIRG 144
              TT TNFL P MKF G+Q+SGYKKYQV V ++                       I+G
Sbjct: 131 SATTTNTNFLTPSMKFKGFQMSGYKKYQVTVTIKTVNLPSSTQETITTQPHMTGSLTIKG 190

Query: 145 LTNQHPEITTFFESFTVMDTIGFLSS----CIPEELNAYKGNDHVDLEHWLNFPCFKELC 200
           LT Q+P+ITTFF+SF V +   FLSS        +L+  + ND +DLEHWLNFP FK+L 
Sbjct: 191 LTFQYPQITTFFQSFAVNENFHFLSSHWDANTRAQLHDLQSNDRIDLEHWLNFPIFKQLF 250

Query: 201 MRRPASNNKHSSSTSYACNGKPNAYHKYTNYANVQSNCVGGDADVNILHQILNGQYTHEN 260
           M                  G+    H+  +Y                           + 
Sbjct: 251 MA--------------DVEGEETQDHEIDSYL--------------------------KQ 270

Query: 261 YLCNRFIFMRWKEKFLVPDAE------IDSVEGASYDGYYYIVHDQVTGNILGFYYHKDA 314
           YL NRFIFMRWKEKFL+ D E       D + GAS+DG+YYIVHDQV G+I GFYYHKDA
Sbjct: 271 YLNNRFIFMRWKEKFLIRDGEHIDDDDEDEINGASFDGFYYIVHDQVDGSIHGFYYHKDA 330

Query: 315 EKFQQLELSPVMSGMES--ACDFEFC 338
           EKFQQLEL PV +   S  +  FEF 
Sbjct: 331 EKFQQLELVPVFNERSSHPSSTFEFA 356

>Scas_667.27
          Length = 332

 Score =  113 bits (283), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 80/258 (31%), Positives = 125/258 (48%), Gaps = 49/258 (18%)

Query: 91  TRTNFLKPRMKFTGYQVSGYKKYQVIVDLQXXXXXXXXXXXXXXXXXXXXXIRGLTNQHP 150
           T +++LKP+ +F G QV G K Y + VDL+                     I+G ++   
Sbjct: 114 TLSHYLKPKKRFHGVQVVGPKVYVIKVDLETINFPPFNYNIFNPHLTGRLNIQGFSDTGE 173

Query: 151 EITTFFESFTVM-DTIGFLSS------CIPEELNAYKGNDHVDLEHWLNFPCFKELCMRR 203
           ++TT+FE +++  D +GFLSS      C+ E+L A   +D VD+ HWL    F+ +  ++
Sbjct: 174 DVTTYFEGYSIENDKLGFLSSNWEDHPCL-EDLTA---DDIVDIFHWLKLKPFRRILNKK 229

Query: 204 PASNNKHSSSTSYACNGKPNAYHKYTNYANVQSNCVGGDADVNILHQILN-GQYTHENYL 262
           P   NK  S                                + +L  I+N  +Y ++   
Sbjct: 230 PV--NKRWSKLP-----------------------------LRVLKDIVNETEYQNDG-- 256

Query: 263 CNRFIFMRWKEKFLVPDAEIDS-VEGASYDGYYYIVHDQVTGNILGFYYHKDAEKFQQLE 321
             R++FM+WKE+F++  A  D  V G +Y G+YYIVHD+ TG I GFY+ +    FQ+L 
Sbjct: 257 --RYVFMKWKERFVIDHAVDDEPVAGITYRGFYYIVHDKFTGEIEGFYHERGTAAFQRLS 314

Query: 322 LSPVMSGMESACD-FEFC 338
           L PV +    + D FE C
Sbjct: 315 LQPVETLTNVSSDSFELC 332

>YGR066C (YGR066C) [2028] chr7 complement(620923..621801) Protein of
           unknown function, has low similarity to a region of S.
           cerevisiae Vid24p, which is required for vacuolar import
           and degradation of fructose-1,6-bisphosphatase (S.
           cerevisiae Fbp1p) [879 bp, 292 aa]
          Length = 292

 Score = 82.0 bits (201), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 65/246 (26%), Positives = 102/246 (41%), Gaps = 59/246 (23%)

Query: 94  NFLKPRMKFTGYQVSGYKKYQVIVDLQXXXXXXXXXXXXXX-XXXXXXXIRGLTNQHPEI 152
           +FL+P ++F G Q S Y  Y V V +                       I+ LT    ++
Sbjct: 77  DFLRPGLRFGGSQSSKYTYYTVEVKIDTVNLPLYKDSRSLDPHVTGTFTIKNLTPVLDKV 136

Query: 153 TTFFESFTV-MDTIGFLSSCIPEE--LNAYKGNDHVDLEHWLNFPCFKELCMRRPASNNK 209
            T FE + +  +     S   P E  L+ Y      D  HW  F  F         S+N 
Sbjct: 137 VTLFEGYVINYNQFPLCSLHWPAEETLDPYMAQRESDCSHWKRFGHF--------GSDNW 188

Query: 210 HSSSTSYACNGKPNAYHKYTNYANVQSNCVGGDADVNILHQILNGQYTHEN--YLCNRFI 267
             +  ++                                     GQY HE+  ++  R+I
Sbjct: 189 SLTERNF-------------------------------------GQYNHESAEFMNQRYI 211

Query: 268 FMRWKEKFLVPDAEIDSV--------EGASYDGYYYIVHDQVTGNILGFYYHKDAEKFQQ 319
           +++WKE+FL+ D E +++        EGAS++G+YY+  DQ+TG++ G+YYH   E FQ+
Sbjct: 212 YLKWKERFLLDDEEQENLMLDDNHHLEGASFEGFYYVCLDQLTGSVEGYYYHPACELFQK 271

Query: 320 LELSPV 325
           LEL P 
Sbjct: 272 LELVPT 277

>YML118W (NGL3) [3853] chr13 (32334..33851) Protein with possible
           DNAse/RNAse function, member of the magnesium-dependent
           ExoIII-APE nuclease family [1518 bp, 505 aa]
          Length = 505

 Score = 28.9 bits (63), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 11/26 (42%), Positives = 19/26 (73%)

Query: 174 EELNAYKGNDHVDLEHWLNFPCFKEL 199
           E LNA++GN++V +  +L  PC +E+
Sbjct: 445 EPLNAFEGNNNVKIIGYLRMPCAQEM 470

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.318    0.133    0.404 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 11,439,279
Number of extensions: 503069
Number of successful extensions: 1399
Number of sequences better than 10.0: 15
Number of HSP's gapped: 1399
Number of HSP's successfully gapped: 19
Length of query: 338
Length of database: 16,596,109
Length adjustment: 102
Effective length of query: 236
Effective length of database: 13,065,073
Effective search space: 3083357228
Effective search space used: 3083357228
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 62 (28.5 bits)