Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Sklu_2260.639939921480.0
Kwal_23.57644624627475e-95
ADL083C3543965769e-71
YER054C (GIP2)5485215901e-70
Scas_715.465701924408e-49
CAGL0J02904g5432134222e-46
YIL045W (PIG2)5381793986e-43
Scas_704.415821813943e-42
CAGL0L00803g8272143748e-39
KLLA0F27533g4981272354e-21
YOR178C (GAC1)7931371343e-08
YLR273C (PIG1)6481661146e-06
Scas_659.215941571112e-05
Scas_521.15791571092e-05
CAGL0H04037g9151321075e-05
Kwal_56.23262429113840.022
Scas_526.4915158850.023
AGR275C679117790.12
Kwal_26.821450259740.45
Sklu_1063.222439710.66
Kwal_33.145456839650.82
YKL067W (YNK1)15371652.4
CAGL0F04917g682109663.6
AGL084C17536644.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Sklu_2260.6
         (399 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Sklu_2260.6 YIL045W, Contig c2260 9086-10285 reverse complement       832   0.0  
Kwal_23.5764                                                          292   5e-95
ADL083C [1658] [Homologous to ScYIL045W (PIG2) - SH; ScYER054C (...   226   9e-71
YER054C (GIP2) [1483] chr5 complement(262051..263697) Glc7p-inte...   231   1e-70
Scas_715.46                                                           174   8e-49
CAGL0J02904g complement(279516..281147) similar to sp|P40036 Sac...   167   2e-46
YIL045W (PIG2) [2622] chr9 (271160..272776) Protein that interac...   157   6e-43
Scas_704.41                                                           156   3e-42
CAGL0L00803g 98548..101031 some similarities with sp|P40036 Sacc...   148   8e-39
KLLA0F27533g 2549457..2550953 weakly similar to sp|P40036 Saccha...    95   4e-21
YOR178C (GAC1) [4975] chr15 complement(667860..670241) Regulator...    56   3e-08
YLR273C (PIG1) [3666] chr12 complement(689085..691031) Protein t...    49   6e-06
Scas_659.21                                                            47   2e-05
Scas_521.1                                                             47   2e-05
CAGL0H04037g complement(379169..381916) weakly similar to sp|P28...    46   5e-05
Kwal_56.23262                                                          37   0.022
Scas_526.4                                                             37   0.023
AGR275C [4586] [Homologous to ScYOR178C (GAC1) - SH; ScYLR273C (...    35   0.12 
Kwal_26.8214                                                           33   0.45 
Sklu_1063.2 YIL161W, Contig c1063 560-1234 reverse complement          32   0.66 
Kwal_33.14545                                                          30   0.82 
YKL067W (YNK1) [3193] chr11 (314457..314918) Nucleoside diphosph...    30   2.4  
CAGL0F04917g complement(499132..501180) weakly similar to sp|P28...    30   3.6  
AGL084C [4227] [Homologous to NOHBY] (549283..549810) [528 bp, 1...    29   4.5  

>Sklu_2260.6 YIL045W, Contig c2260 9086-10285 reverse complement
          Length = 399

 Score =  832 bits (2148), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 399/399 (100%), Positives = 399/399 (100%)

Query: 1   MYIKKLTNNYSGENKPRSLDFLHKPQRVTQLKTLYAEDSLQRNTNLNRGPPPDYENVAPT 60
           MYIKKLTNNYSGENKPRSLDFLHKPQRVTQLKTLYAEDSLQRNTNLNRGPPPDYENVAPT
Sbjct: 1   MYIKKLTNNYSGENKPRSLDFLHKPQRVTQLKTLYAEDSLQRNTNLNRGPPPDYENVAPT 60

Query: 61  DSREYYGDGTLHRGSIGSLNSYFPDVDEYYPPKPIRKKSGELVKSSLKQHHRSKSLPATP 120
           DSREYYGDGTLHRGSIGSLNSYFPDVDEYYPPKPIRKKSGELVKSSLKQHHRSKSLPATP
Sbjct: 61  DSREYYGDGTLHRGSIGSLNSYFPDVDEYYPPKPIRKKSGELVKSSLKQHHRSKSLPATP 120

Query: 121 TGREPRTEIIIMEPPKRSKSVHFDQRDVVSVKYFQKDERPVEVAQREVEEDQLSFTPKQL 180
           TGREPRTEIIIMEPPKRSKSVHFDQRDVVSVKYFQKDERPVEVAQREVEEDQLSFTPKQL
Sbjct: 121 TGREPRTEIIIMEPPKRSKSVHFDQRDVVSVKYFQKDERPVEVAQREVEEDQLSFTPKQL 180

Query: 181 SFMNSWLSNSTPEETKRPLRRSKKHMMMMNGSGPSPATTASGSSMPPVPGLYNKNFPILS 240
           SFMNSWLSNSTPEETKRPLRRSKKHMMMMNGSGPSPATTASGSSMPPVPGLYNKNFPILS
Sbjct: 181 SFMNSWLSNSTPEETKRPLRRSKKHMMMMNGSGPSPATTASGSSMPPVPGLYNKNFPILS 240

Query: 241 NKNPTSLKLNIFLNIAHGKQVFLQDLSLLGDGNYVVGKVLVKNICYDKQVIVRYTWDQWN 300
           NKNPTSLKLNIFLNIAHGKQVFLQDLSLLGDGNYVVGKVLVKNICYDKQVIVRYTWDQWN
Sbjct: 241 NKNPTSLKLNIFLNIAHGKQVFLQDLSLLGDGNYVVGKVLVKNICYDKQVIVRYTWDQWN 300

Query: 301 TTHDVQCVWFSSGDIVLPGMNMDMFKFVVDVPVDSAEATLATTDPDKEGGREVQFCIRYT 360
           TTHDVQCVWFSSGDIVLPGMNMDMFKFVVDVPVDSAEATLATTDPDKEGGREVQFCIRYT
Sbjct: 301 TTHDVQCVWFSSGDIVLPGMNMDMFKFVVDVPVDSAEATLATTDPDKEGGREVQFCIRYT 360

Query: 361 TRDGNYREEHWDNNNGKNYIVAVVIGDDTRPVNFHDPFS 399
           TRDGNYREEHWDNNNGKNYIVAVVIGDDTRPVNFHDPFS
Sbjct: 361 TRDGNYREEHWDNNNGKNYIVAVVIGDDTRPVNFHDPFS 399

>Kwal_23.5764
          Length = 462

 Score =  292 bits (747), Expect = 5e-95,   Method: Compositional matrix adjust.
 Identities = 185/462 (40%), Positives = 255/462 (55%), Gaps = 94/462 (20%)

Query: 1   MYIKKLTNNY-----SGENKPRSLDFLHKPQRVTQLKTLYAEDSLQRNTNLNRG------ 49
           MYI++  ++      +G    RSL FLHKPQRVTQ + LYA++ L+RNT++NRG      
Sbjct: 1   MYIRRPPSDLRREGSNGAFTDRSLAFLHKPQRVTQPRALYADEWLRRNTDMNRGNVKVEN 60

Query: 50  PPPDYENVAPTDSREYYGDGTLHRGSIGSLNSYFPD--------------VDEYYP---- 91
            P DY       S+ + GDG   + +    N + P               V+ Y+P    
Sbjct: 61  CPEDYF------SQNFKGDGPTKQTAASEANGFDPSASNASAGDTASPLRVNPYFPAEED 114

Query: 92  --------PKPIRKKSGELVKSSLKQHHRSKSLPATPTGREPRTEIII--MEPPKRSKSV 141
                   P  +RKKSGE+V+ SLK   RS+SLPATP+ REP   +       PKRSKSV
Sbjct: 115 SVVADAAAPPLVRKKSGEVVRPSLKMAQRSRSLPATPSDREPDKRLGGPPAAGPKRSKSV 174

Query: 142 HFDQRDVVSVKYFQKDERPVEVAQREVEE----DQLSFT---PKQLSF------------ 182
           HFDQRDVV  KYF +++ P++VA+++V E    DQ + T   P  ++             
Sbjct: 175 HFDQRDVVKFKYFWQEDSPLDVAEQDVLEGPLDDQRAKTVVGPTSMARDLTVDDDDDGND 234

Query: 183 -------MNSWLSNSTPEE-----TKRPLRRSKKHMMMMNGSGPSPATTASGSSMPPVPG 230
                  +   LSN T E      +   LRRS+++  +           A G++ P  PG
Sbjct: 235 DRAVQRDLTMSLSNLTFERRMSNTSGGGLRRSRRYQKL----------KAQGATPPTRPG 284

Query: 231 LYNKNFPILSNKNPTSLKLNIFLNIAHGKQVFLQDLSLLGDGNYVVGKVLVKNICYDKQV 290
           LY+ NF  L++ +  SLK NIFLNIAH    FLQ+LSL+GD +Y+VG VLVKN+ Y+K V
Sbjct: 285 LYHANFATLADDDQCSLKSNIFLNIAHNSSCFLQELSLIGDQHYLVGHVLVKNVYYEKTV 344

Query: 291 IVRYTWDQWNTTHDVQCVWFSSGDIVLPGMNMDMFKFVVDVP-VDSAEATLATTDPDKEG 349
           +VRYT D W T+ D++CVW SSGD VLPGM+MD FK V+D+  +   + +  +T      
Sbjct: 345 LVRYTRDSWRTSRDIECVWASSGDDVLPGMHMDRFKLVIDLAGLQEGDTSRDSTPSHDSA 404

Query: 350 GR-------EVQFCIRYTTRDGNYREEHWDNNNGKNYIVAVV 384
           G         +QFCI+Y +RD N R E+WDNN G+NY+V VV
Sbjct: 405 GHACQLSTVRLQFCIQYVSRDANSRVEYWDNNAGRNYVVDVV 446

>ADL083C [1658] [Homologous to ScYIL045W (PIG2) - SH; ScYER054C
           (GIP2) - SH] (537421..538485) [1065 bp, 354 aa]
          Length = 354

 Score =  226 bits (576), Expect = 9e-71,   Method: Compositional matrix adjust.
 Identities = 160/396 (40%), Positives = 203/396 (51%), Gaps = 71/396 (17%)

Query: 1   MYIKKLTNNYSGENKPRSLDFLHKPQRVT-QLKTLYAEDSLQRNTNLNR----GPPPDYE 55
           +YIK  +   S E K  SL  L KPQR++ + +    E+ L+RNT+ NR    G     E
Sbjct: 12  IYIKPRS---SQEGKYSSLALLRKPQRISSRTEREEQENILKRNTDYNRKRGGGTWAADE 68

Query: 56  NVAPTDSREYYGDGTLHR-GSIGSLNSYFPDVDEYYPPKPIRKKSGELVKSSLKQHHRSK 114
           N+ P D     GD +  R GS   L  YF      Y                   H RS 
Sbjct: 69  NIDPLD-----GDESPRRAGSPVVLTDYFSQSHAVYDNV---------------GHQRSN 108

Query: 115 SLPATPTGREPRTEIIIMEPPKRSKSVHFDQRDVVSVKYFQKDERPVEVAQREVEEDQL- 173
           SLP TPT    R   +     +RSKSVHFD RDVVSVKYF  DE  + VA  +  EDQL 
Sbjct: 109 SLPGTPTSALKRPGGV-----RRSKSVHFDNRDVVSVKYFNSDESTLLVAHAQSFEDQLR 163

Query: 174 ------SFTPKQLSFMNSWLSNSTPEET-KRPLRRSKKHMMMMNGSGPSPATTASGSSMP 226
                    P  L+ +      +   ++ ++PLR+SK                      P
Sbjct: 164 LRQDARELAPNGLTLVAPAGGMAGGAKSPRKPLRKSKCFRQYQ--------------LRP 209

Query: 227 PVPGLYNKNFPILSNKNPTSLKLNIFLNIAHGKQVFLQDLSLLGDGNYVV-GKVLVKNIC 285
            +  L N NFPIL+NK+P  L LNIFLNIA+ ++VFLQDLSL  D   V+ G+VLVKNI 
Sbjct: 210 QLRTLRNVNFPILANKDPAVLTLNIFLNIAYNRKVFLQDLSL--DSMLVMTGRVLVKNIH 267

Query: 286 YDKQVIVRYTWDQWNTTHDVQCVWFSSGDIVLPGMNMDMFKFVVDVPVDSAEATLATTDP 345
           YDK VIVRYTWD W  T D   VW SSG+ VLPG +MD+F+F +DVP   +         
Sbjct: 268 YDKSVIVRYTWDNWAHTSDTASVWISSGNAVLPGKDMDLFEFAIDVPAPVS--------- 318

Query: 346 DKEGGREVQFCIRYTTRDGNYREEHWDNNNGKNYIV 381
              G   ++FCIRY  RD +  + HWDNN+G NY+V
Sbjct: 319 ---GTPRLEFCIRYQVRDNSDFQTHWDNNHGNNYVV 351

>YER054C (GIP2) [1483] chr5 complement(262051..263697)
           Glc7p-interacting protein, possible regulatory subunit
           for the PP1 family protein phosphatase Glc7p [1647 bp,
           548 aa]
          Length = 548

 Score =  231 bits (590), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 184/521 (35%), Positives = 247/521 (47%), Gaps = 158/521 (30%)

Query: 11  SGENKPRSLDFLHKPQRVTQLKT-LYAEDSLQRNTNLNRG--PPPDYENVAPTDSREYYG 67
           S E    SL FLHKPQRVTQ++   + E+ +QRNT+LN+      + ENV          
Sbjct: 51  STEETLNSLKFLHKPQRVTQMRANRFPEEEVQRNTDLNKRIFSAGNDENVDNESGWSKIA 110

Query: 68  DGTLHRGSIGSLN-------------------------SYFPDV-----------DE--- 88
               H  S+ SLN                         + +P+            DE   
Sbjct: 111 AAKNHT-SVESLNGSTRPPFKIELPPLSPKSTVPKSFQAEYPEAKSPGNDMNFEYDEEIL 169

Query: 89  --YYPPKPIRKKSGELVKSSLKQHHRSKSLPATPTGREPRTEIIIMEPPK--RSKSVHFD 144
             + PP  + KKSGEL+KSSLK+  RSKSLP TP  R           P   RSKSVHFD
Sbjct: 170 IPFAPP--VYKKSGELLKSSLKR--RSKSLPTTPGIRSGNGVQARDGSPMLIRSKSVHFD 225

Query: 145 QRDVVSVKYFQKDERPVEVAQREVEEDQLSFTPKQLSFM----------NSWLSNST--- 191
           Q     VKYF +DE P+ V + E  ++ LSF  K ++ M          +S L  ++   
Sbjct: 226 Q--AAPVKYFAEDESPINVNKTEQHDNCLSFKHKPVNLMVDPEEETKMLSSGLETTSIDD 283

Query: 192 ------------PEETKRP----------LRRSKKHMMMM----------------NGSG 213
                       P +   P          LR+SK+   ++                NG G
Sbjct: 284 DLTTVAPKGFAHPAKISNPNNGKGTNNTKLRKSKRFQNLLKNRTDMPPSKSNKKFVNGGG 343

Query: 214 PSPATTASGSSMPPVPGLYNKNFPILSNKNPTSLKLNIFLNIAHGKQVFLQDLSLL--GD 271
               +  +  +   V GLY+KNFPILSNKNP SLKLNIF+N++  K+VFLQ+LSL    D
Sbjct: 344 AHEISDRNSKNY-HVVGLYSKNFPILSNKNPKSLKLNIFINLSQNKKVFLQELSLYIHRD 402

Query: 272 GNY---------------------------------VVGKVLVKNICYDKQVIVRYTWDQ 298
            NY                                 + G++LVKNI YDK+V+VRYTWD 
Sbjct: 403 NNYFSNSSSFYNIPNSHNGNDCNGVAKGYNAGCTRLIAGRILVKNIFYDKRVVVRYTWDS 462

Query: 299 WNTTHDVQCVWFSSGDIVLPGMNMDMFKFVVDVPVDSAEATLATTDPDKEGGREVQFCIR 358
           W TTH+V+CV+ S GD +LPG NMD+F F++D         ++  DP      +++FCI 
Sbjct: 463 WRTTHEVECVYISDGDGILPGTNMDIFHFIID--------DVSKVDPRG----KLEFCIH 510

Query: 359 YTTRDGNYREEHWDNNNGKNYIVAVVIGDDTRPVNFHDPFS 399
           Y+TR+   REE+WDNNNG NY V VV+        F+DPF+
Sbjct: 511 YSTRNDYEREEYWDNNNGNNYKVDVVMD------GFNDPFA 545

>Scas_715.46
          Length = 570

 Score =  174 bits (440), Expect = 8e-49,   Method: Compositional matrix adjust.
 Identities = 87/192 (45%), Positives = 117/192 (60%), Gaps = 41/192 (21%)

Query: 228 VPGLYNKNFPILSNKNPTSLKLNIFLNIAHGKQVFLQDLSL------------------- 268
           V GLYN NFPILSNKNP SLKLNIF+ ++  K+ FLQ+++L                   
Sbjct: 388 VVGLYNINFPILSNKNPKSLKLNIFIKLSKDKKCFLQEVTLHIEKENPLKRLLPANGSNS 447

Query: 269 -LGDGN-------YVVGKVLVKNICYDKQVIVRYTWDQWNTTHDVQCVWFSSGDIVLPGM 320
             G G+        + GK+LVKNI YDK+VIVRYTW+ W T HDV+C+W S GD ++PG 
Sbjct: 448 EFGQGSIIQRSTRLITGKILVKNIFYDKRVIVRYTWNDWRTVHDVECIWVSDGDGIVPGT 507

Query: 321 NMDMFKFVVDVPVDSAEATLATTDPDK-EGGREVQFCIRYTTRDGNYREEHWDNNNGKNY 379
           NMD+F+F++D             D +K E   +++FCI+YT R+   R E+WDNN+GKNY
Sbjct: 508 NMDVFRFLID-------------DANKLEARAKLEFCIQYTARNDTERLEYWDNNDGKNY 554

Query: 380 IVAVVIGDDTRP 391
            V V++   T P
Sbjct: 555 KVGVIMNGFTNP 566

 Score = 87.4 bits (215), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 74/183 (40%), Positives = 94/183 (51%), Gaps = 30/183 (16%)

Query: 6   LTNNYSGENKP-----RSLDFLHKPQRVTQLKT-LYAEDSLQRNTNLNRG---------- 49
           +TN   GE K       S+DFL+KPQRVTQ+    + E+ ++RNT+LN+           
Sbjct: 72  MTNKIGGERKTSLNSLNSMDFLYKPQRVTQMNVDKFPEEEVKRNTDLNKNIRLVTSGSVA 131

Query: 50  ---PPPDYENVAPTDSREYYGDGTLHRGSIGSLNSYFPDVDEYY----PPKPIRKKSGEL 102
                   E ++P D  E     T+        N     VDE Y    P  PI KKSGEL
Sbjct: 132 KDEEETGREYMSPIDLPEISPRSTIQSSEFIQNNKTQEGVDERYDGITPLSPIYKKSGEL 191

Query: 103 VKSSLKQHHRSKSLPATPT--GREPRTEIIIMEPPKRSKSVHFDQRDVVSVKYFQKDERP 160
           +KSSLK+  RSKSLP+T     +  R E   ME   RSKSVHFDQ+    VKYF++DE P
Sbjct: 192 LKSSLKR--RSKSLPSTSEILQKSLRFENDAMEMV-RSKSVHFDQK--APVKYFREDESP 246

Query: 161 VEV 163
             V
Sbjct: 247 STV 249

>CAGL0J02904g complement(279516..281147) similar to sp|P40036
           Saccharomyces cerevisiae YER054c GIP2, hypothetical
           start
          Length = 543

 Score =  167 bits (422), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 97/213 (45%), Positives = 122/213 (57%), Gaps = 47/213 (22%)

Query: 208 MMNGSGPSPATTASGSSMPPVPGLYNKNFPILSNKNPTSLKLNIFLNIAHGKQVFLQDLS 267
           M NGS        SG     V GLYN+NFPILSNKNP SLKLNIF+N++ GK+VFLQ+LS
Sbjct: 353 MFNGS-------YSGKQQQRVVGLYNENFPILSNKNPKSLKLNIFINLSQGKEVFLQELS 405

Query: 268 LL----------GDG---------NYVVGKVLVKNICYDKQVIVRYTWDQWNTTHDVQCV 308
           L           G G           + G+VLVKNI +DK+V++RYTWD+W    DV+ V
Sbjct: 406 LHIHRERAFYSPGSGVDIGTPINTRLLSGRVLVKNIFFDKRVLIRYTWDRWRNVQDVEGV 465

Query: 309 WFSSGDIVLP-GMNMDMFKFVVDVPVDSAEATLATTDPDK-EGGREVQFCIRYTTRDGNY 366
           W SS   ++P G  MD+F FV+D             D  K EG   ++FCI+YTTRD   
Sbjct: 466 WVSSAQGLVPGGAAMDVFHFVID-------------DATKWEGKASLEFCIQYTTRDDTQ 512

Query: 367 REEHWDNNNGKNYIVAVVIGDDTRPVNFHDPFS 399
           R E WDNN GKNY V +V+        F +PF+
Sbjct: 513 RLEFWDNNCGKNYCVDLVMD------GFRNPFA 539

 Score = 80.1 bits (196), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 74/190 (38%), Positives = 93/190 (48%), Gaps = 48/190 (25%)

Query: 12  GENKPRSLDFLHKPQRVTQL-KTLYAEDSLQRNTNLNRGPPPDYENVAPTDS--REYY-- 66
           G  K  SL FLHKPQRV+QL K  + E+ L RNT LN+       N+   DS  REY   
Sbjct: 36  GSGKLTSLQFLHKPQRVSQLNKDRFPEEELLRNTQLNK-------NLHQVDSNYREYSQG 88

Query: 67  -GDGTLHRGSIG-------SLNSYFPDVDEY-----------------YPPKPIRKKSGE 101
            GDG               S  S  P++D                   + P P+ KKSGE
Sbjct: 89  PGDGGASERQQARDDLIPLSPKSTLPELDTNMLDNTLDSDNSSNDLAPFSP-PVYKKSGE 147

Query: 102 LVKSSLKQHHRSKSLPATPTGREPRTEIIIMEPPK---RSKSVHFDQRDVVSVKYFQKDE 158
            VKS LK+  RSKSLP TP      T +    PP    RSKSVHFDQ     V+YF ++E
Sbjct: 148 PVKSVLKR--RSKSLPGTPG---LNTSMHGASPPNKLMRSKSVHFDQ--TAPVRYFNENE 200

Query: 159 RPVEVAQREV 168
           RP++V+  ++
Sbjct: 201 RPIDVSNADI 210

>YIL045W (PIG2) [2622] chr9 (271160..272776) Protein that interacts
           with Gsy2p, possible regulatory subunit for the
           PP1-family protein phosphatase Glc7p [1617 bp, 538 aa]
          Length = 538

 Score =  157 bits (398), Expect = 6e-43,   Method: Compositional matrix adjust.
 Identities = 85/179 (47%), Positives = 118/179 (65%), Gaps = 12/179 (6%)

Query: 212 SGPSPATTASGSSMPPVPGLYNKNFPILSNKNPTSLKLNIFLNIAHGKQVFLQDLSLL-G 270
           S  S A    G+S   V GLYNKNFPILS++N  SLKLNIFLN++ G+ VFLQ+++LL G
Sbjct: 344 SAKSGANLFIGNSKRIV-GLYNKNFPILSDRNRKSLKLNIFLNLSRGRPVFLQEITLLTG 402

Query: 271 DGNYVV-GKVLVKNICYDKQVIVRYTWDQWNTTHDVQCVWFSSGDIVLPGMNMDMFKFVV 329
             N V+ GKV VKNI +DK++IVRYTWD W T H+ +CV+FS+ + +LPG NMD+FKF +
Sbjct: 403 FHNMVIIGKVFVKNIYFDKKIIVRYTWDAWRTFHESECVYFSNANGILPGSNMDIFKFSI 462

Query: 330 DVPVDSAEATLATTDPDKEGGREVQFCIRYTTRDGNY-REEHWDNNNGKNYIVAVVIGD 387
           D         +   +       +++FCI+Y T   +  R+E+WDNN+  NY + VV  +
Sbjct: 463 D--------DIHNPNDKDSNISQLEFCIQYLTWGVDRSRKEYWDNNDSANYKIDVVTNE 513

 Score = 85.1 bits (209), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 73/207 (35%), Positives = 110/207 (53%), Gaps = 38/207 (18%)

Query: 18  SLDFLHKPQRVTQLKT-LYAEDSLQRNTNLNRGPPPDYENVAPTDSREYY----GDGTLH 72
           SL+FLHKP+R++ +K     +D LQRNT++N+G    Y N     +   +     +   H
Sbjct: 52  SLEFLHKPRRLSNVKLHRLPQDELQRNTDMNKGM---YFNGKQVHAHHPFINSGANFNAH 108

Query: 73  RGSIGSL-------------NSYFPDVDEYYPPKPIRKKSGELVKSSLKQHHRSKSLPAT 119
              +  L             N  +   +   P  PI KKSGELVKSSLK+  RSKSLP T
Sbjct: 109 HQDVSKLGEEEDEISPLSHDNFQYESEENGNPSPPIYKKSGELVKSSLKR--RSKSLPIT 166

Query: 120 P------TGREPR---TEIIIMEPPKRSKSVHFDQRDVVSVKYFQKDERPVEVAQREVEE 170
           P      TG + +    + +     +RSKSVHFD+  V+ +K F ++E+P++V ++ V++
Sbjct: 167 PKSIFNKTGSKSKHVNLDHVDTRLLQRSKSVHFDR--VLPIKLFNENEKPIDVGKQMVQQ 224

Query: 171 DQLSFTPK---QLSFMNSWLSNSTPEE 194
           D L+F  K   +LS +N   S+S P E
Sbjct: 225 DVLNFKHKPLTRLSALNGG-SDSVPIE 250

>Scas_704.41
          Length = 582

 Score =  156 bits (394), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 79/181 (43%), Positives = 116/181 (64%), Gaps = 28/181 (15%)

Query: 219 TASGSSMPPVPGLYNKNFPILSNKNPTSLKLNIFLNIAHGKQVFLQDLSL---------- 268
           T + +S   V GLY+KNFP L+NKNP SLKLNIF+N + GK+VFLQDL+L          
Sbjct: 402 TTTLTSEKSVIGLYSKNFPTLNNKNPRSLKLNIFVNYSKGKKVFLQDLNLHIQNDYINNH 461

Query: 269 LGDGN----YVVGKVLVKNICYDKQVIVRYTWDQWNTTHDVQCVWFSSGDIVLPGMNMDM 324
           +G+ N    Y++G+ LV+NI +DK+V+++YTWD W +  D++ ++ S    ++PG NMD+
Sbjct: 462 VGNNNKQNKYIIGRALVENIYFDKKVVLKYTWDNWRSYRDIEAIYVSDAKQIIPGSNMDV 521

Query: 325 FKFVVDVPVDSAEATLATTDPDKEGGR-EVQFCIRYTTRDGNYREEHWDNNNGKNYIVAV 383
           FKF++D             D +K   +  ++FCI+Y TR+   R+E WDNN+ KNY V V
Sbjct: 522 FKFLID-------------DVNKSVSKCHLEFCIQYQTRNEKERKEFWDNNDDKNYKVDV 568

Query: 384 V 384
           V
Sbjct: 569 V 569

 Score = 65.5 bits (158), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 62/196 (31%), Positives = 89/196 (45%), Gaps = 40/196 (20%)

Query: 18  SLDFLHKPQRVTQLK-TLYAEDSLQRNTNLNRGPPPDYENVAPTDSREYYGDGTLHRGSI 76
           SL+FL +P+++ QLK     ++ L+RNTNLN+   P    + PT  +  Y    L+    
Sbjct: 99  SLNFLQEPRKLDQLKLNALPQEELRRNTNLNKNINPIPTPIKPTIYKNSY---YLNDNDT 155

Query: 77  GSLNSYFPDVDEYYPP------------------------KPIRKKSGELVKSSLKQHHR 112
            +      + DE  P                         KP+ KKSGEL+K SLK+  R
Sbjct: 156 DAFKEEQENEDEISPITQVPANAKIPFPVPNNAYMEVNRIKPVYKKSGELLKPSLKR--R 213

Query: 113 SKSLPATPTGREPRTEII--------IMEPPKRSKSVHFDQRDVVSVKYFQKDERPVEVA 164
           S+SLP TP         I              RSKSVHF   + + V++F KDE P+ VA
Sbjct: 214 SQSLPVTPNISNLNLRRINGHANGNDRAHHLARSKSVHF--ANTLPVRFFSKDESPIIVA 271

Query: 165 QREVEEDQLSFTPKQL 180
           +     ++L+F  K L
Sbjct: 272 ESHEITNELNFKHKPL 287

>CAGL0L00803g 98548..101031 some similarities with sp|P40036
           Saccharomyces cerevisiae YER054c GIP2 or sp|P40187
           Saccharomyces cerevisiae YIL045w PIG2, hypothetical
           start
          Length = 827

 Score =  148 bits (374), Expect = 8e-39,   Method: Compositional matrix adjust.
 Identities = 86/214 (40%), Positives = 119/214 (55%), Gaps = 43/214 (20%)

Query: 207 MMMN--GSG-------PSPATTASGSSMPP--VPGLYNKNFPILSNKNPTSLKLNIFLNI 255
           +MMN  GSG       P+P  + S +S     +  L +KNFP L +K   SLKLNIFLN 
Sbjct: 619 LMMNDRGSGLKDNFKDPTPPVSQSSTSKKEEKMTTLVSKNFPTLGSKTSKSLKLNIFLNS 678

Query: 256 AHGKQVFLQDLSL------------------LG--------DGNYVVGKVLVKNICYDKQ 289
              K+V LQ++SL                  +G        D   + G VLVKNI +DK+
Sbjct: 679 TSDKKVLLQEVSLNVQKRKSNYYNSNFGGPGIGFSTGRDEDDKLIITGTVLVKNIYFDKK 738

Query: 290 VIVRYTWDQWNTTHDVQCVWFSSGDIVLPGMNMDMFKFVVDVPVDSAEATLATTDPDKEG 349
           V +RYTWD W + ++V+ ++  SG+  LPG  MD+F+F++D  V S    ++        
Sbjct: 739 VSIRYTWDHWRSCNEVESMYVGSGNNYLPGSQMDIFRFMIDNTVLSNGQYVSNR------ 792

Query: 350 GREVQFCIRYTTRDGNYREEHWDNNNGKNYIVAV 383
            RE++FCI+YTTR    REE+WDNNNGKNYIV +
Sbjct: 793 SRELEFCIQYTTRSNTAREEYWDNNNGKNYIVEI 826

 Score = 75.5 bits (184), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 53/103 (51%), Positives = 63/103 (61%), Gaps = 10/103 (9%)

Query: 84  PDVDEYYPPKPIRKKSGELVKSSLKQHHRSKSLPATPTG--REPRTEIIIMEPPK----R 137
           P  D   P  P+ KKSGELVKSSLK+  RSKSLP TP    R   +  + M  P+    R
Sbjct: 442 PVEDHMMPLPPVYKKSGELVKSSLKR--RSKSLPVTPNSNRRTQNSRGVRMNNPRDQLIR 499

Query: 138 SKSVHFDQRDVVSVKYFQKDERPVEVAQREVEEDQLSFTPKQL 180
           SKSVHFDQR  + VKYF K+E P  V+ R+ E+D LSF  K L
Sbjct: 500 SKSVHFDQR--LPVKYFFKEESPSVVSIRDEEDDVLSFQHKPL 540

 Score = 43.9 bits (102), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 24/46 (52%), Positives = 33/46 (71%), Gaps = 4/46 (8%)

Query: 7   TNNYSGENKPR--SLDFLHKPQRVTQLKT--LYAEDSLQRNTNLNR 48
           T+N  G  K R  SLDFLHKPQRVTQ+K+    + + L+RNT++N+
Sbjct: 299 TSNVIGTGKGRINSLDFLHKPQRVTQMKSEDFISPEELKRNTDMNK 344

>KLLA0F27533g 2549457..2550953 weakly similar to sp|P40036
           Saccharomyces cerevisiae YER054c GIP2 GLC7P-interacting
           protein, hypothetical start
          Length = 498

 Score = 95.1 bits (235), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 47/127 (37%), Positives = 78/127 (61%), Gaps = 18/127 (14%)

Query: 263 LQDLSLLGDGNYVVGKVLVKNICYDKQVIVRYTWDQWNTTHDVQCVWFSSGDIVLPG--- 319
           LQDL L   G+ ++G V+V+NI Y+K+VIVRYT D W +  DV+ VW ++   +  G   
Sbjct: 385 LQDLRLDTQGHMLIGNVIVRNISYEKRVIVRYTLDSWKSQQDVESVWITNHCNLKSGTGA 444

Query: 320 MNMDMFKFVVDV-PVDSAEATLATTDPDKEGGREVQFCIRYTTRDGNYREEHWDNNNGKN 378
           +++D+F+F +D+  +++ E               ++ CI Y TR+G+   +HWDNN+G+N
Sbjct: 445 IDIDVFQFAIDLGKINTIE--------------HIEMCILYQTREGSSWIDHWDNNSGQN 490

Query: 379 YIVAVVI 385
           Y V+V +
Sbjct: 491 YKVSVRV 497

 Score = 44.3 bits (103), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 27/53 (50%), Positives = 34/53 (64%), Gaps = 7/53 (13%)

Query: 112 RSKSLPATPT-GREPRTEIIIMEPP--KRSKSVHFDQRDVVSVKYFQKDERPV 161
           RSKSLP +P  GR  + +     PP  KRSKSVHF Q +   VKYF++DE P+
Sbjct: 170 RSKSLPTSPLEGRVSQEQ----RPPVFKRSKSVHFAQSEKFEVKYFREDESPL 218

 Score = 37.0 bits (84), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 21/49 (42%), Positives = 31/49 (63%), Gaps = 2/49 (4%)

Query: 1  MYIKKLTNNYSGENKPRSLDFLHKPQRVT-QLKTLYAEDSLQRNTNLNR 48
          MY +    N     K  SL+FL KPQR++ Q++T    D+L+RNT+LN+
Sbjct: 1  MYQRDAVQNLQS-GKFSSLNFLRKPQRISCQVETTAMNDALKRNTDLNK 48

>YOR178C (GAC1) [4975] chr15 complement(667860..670241) Regulatory
           subunit for protein serine/threonine phosphatase Glc7p
           [2382 bp, 793 aa]
          Length = 793

 Score = 56.2 bits (134), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 38/137 (27%), Positives = 67/137 (48%), Gaps = 17/137 (12%)

Query: 248 KLNIFLNIAHGKQVFLQDLSLLGD-GNYVVGKVLVKNICYDKQVIVRYTWDQWNTTHDVQ 306
           +L  +LN   G+ V L  L+ LGD  + + G V VKN+ ++K + +++T++ W   H V 
Sbjct: 233 QLTKYLN---GQNVKLHSLTQLGDDSSKITGLVYVKNLSFEKYLEIKFTFNSWRDIHYVT 289

Query: 307 CVWFSSGDIVLPGMNMDMFKFVVDVP----VDSAEATLATTDPDKEGGREVQFCIRYTTR 362
             +  + +      N+D FKF +D+     +   +  +            ++ C RY   
Sbjct: 290 ANFNRTIN-----SNVDEFKFTIDLNSLKYILLIKRIITMEKNTSSCPLNIELCCRYDVN 344

Query: 363 DGNYREEHWDNNNGKNY 379
           +    E ++DNNNGKNY
Sbjct: 345 N----ETYYDNNNGKNY 357

>YLR273C (PIG1) [3666] chr12 complement(689085..691031) Protein that
           interacts with Gsy2p, possible regulatory subunit for
           the PP1 family protein phosphatase Glc7p [1947 bp, 648
           aa]
          Length = 648

 Score = 48.5 bits (114), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 42/166 (25%), Positives = 76/166 (45%), Gaps = 19/166 (11%)

Query: 228 VPGLYNKNFPILSNKNPTSLKLNIFLNIAHGKQVFLQDLSLLGDGNYVV-GKVLVKNICY 286
           V GL +K F  L+ +N     L +         V  +D+     GN  + G + V N+ +
Sbjct: 182 VTGLEDKIFKYLNGQNIKVHSLEL------SDPVSYEDICSNNFGNCQIWGLIFVNNLNF 235

Query: 287 DKQVIVRYTWDQWNTTHDVQCVWFSSGDIVLPGMNMDMFKFVVDVP---VDSAEATLATT 343
           +K++ +++T + W   H +   +  S   V P  ++D FKF++D+    ++     L  T
Sbjct: 236 EKKIEIKFTLNNWADIHYINAHYNKS---VTP--HVDEFKFIIDISALKLNLISKNLIYT 290

Query: 344 DPDKEGGR---EVQFCIRYTTRDGNYREEHWDNNNGKNYIVAVVIG 386
           +  +        +QFC RY      YR   +DNN+ KNY + + + 
Sbjct: 291 NFFERKTTCLLNLQFCCRYDVNGFEYR-SFYDNNDYKNYEITISLS 335

>Scas_659.21
          Length = 594

 Score = 47.4 bits (111), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 39/157 (24%), Positives = 70/157 (44%), Gaps = 16/157 (10%)

Query: 210 NGSGPSPATTASGSSMPPVPGLYNKNFPILSNKNPTSLKLNI-FLNIAHGKQVFLQDLSL 268
           NG G S    A G+  P       +++ ++S+   +  K  + F  + +G+ + L  L  
Sbjct: 159 NGEGDSAELFADGADEP----FEVRDWQLMSSPVQSQFKNEVPFEQLLNGQNIKLYSLKS 214

Query: 269 LGDGNY--VVGKVLVKNICYDKQVIVRYTWDQWNTTHDVQCVWFSSGDIVLPGMNMDMFK 326
             DG    +VG +LV NI ++K + V++T++ W      Q  +F+        +  D FK
Sbjct: 215 ENDGQAFKLVGLILVNNIQFEKNIEVKFTFNNWENIC-YQVAYFNRS----LNVKFDEFK 269

Query: 327 FVVDV----PVDSAEATLATTDPDKEGGREVQFCIRY 359
           F +D+     +   +  L T DP       ++ C RY
Sbjct: 270 FTIDLTSFKSLLKLQKILYTKDPVTHCPINIEMCCRY 306

>Scas_521.1
          Length = 579

 Score = 46.6 bits (109), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 39/157 (24%), Positives = 69/157 (43%), Gaps = 16/157 (10%)

Query: 210 NGSGPSPATTASGSSMPPVPGLYNKNFPILSNKNPTSLKLNI-FLNIAHGKQVFLQDLSL 268
           NG G S    A G+  P       +++ ++S+   +  K  + F  + +G+ + L  L  
Sbjct: 141 NGEGDSAELFADGADEP----FEVRDWQLMSSPVQSQFKSEMPFEQLLNGQNIKLYSLKS 196

Query: 269 LGDGNY--VVGKVLVKNICYDKQVIVRYTWDQWNTTHDVQCVWFSSGDIVLPGMNMDMFK 326
             DG    +VG +LV NI ++K + V++T++ W      Q  +F+           D FK
Sbjct: 197 ENDGQAFKLVGLILVNNIQFEKNIEVKFTFNNWENIC-YQVAYFNRS----LNAKFDEFK 251

Query: 327 FVVDV----PVDSAEATLATTDPDKEGGREVQFCIRY 359
           F +D+     +   +  L T DP       ++ C RY
Sbjct: 252 FTIDLTSFKSLLKLQKILYTKDPVTHCPINIEMCCRY 288

>CAGL0H04037g complement(379169..381916) weakly similar to sp|P28006
           Saccharomyces cerevisiae YOR178c GAC1 ser/thr
           phosphoprotein phosphatase 1, hypothetical start
          Length = 915

 Score = 45.8 bits (107), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 36/132 (27%), Positives = 66/132 (50%), Gaps = 18/132 (13%)

Query: 209 MNGSGPSPATTASGSSMPPVPGLYNKNFPILSNKNPTSLKLNIFLNIAHGKQVF------ 262
           +NGS  + A T+  +S+  V     +N  + S  N     L  F+++  G+  F      
Sbjct: 227 LNGSTNNQAQTSRRTSITHVADDNLQNCELASEVN----WLLTFVDVNPGQHSFENSDGN 282

Query: 263 LQDLSLLGDG---NYVVGKVLVKNICYDKQVIVRYTWDQWNTTHDVQCVWFSSGDIVLPG 319
           ++ +SL  D    + +VGK+LVKN+ Y+K + V+YT++ WN  H +   +  S       
Sbjct: 283 IKLVSLAQDSTIDDKIVGKILVKNLNYEKFIEVKYTFNNWNDIHYITAYFTKS-----IS 337

Query: 320 MNMDMFKFVVDV 331
             +D F+F +++
Sbjct: 338 AEIDEFEFKINL 349

>Kwal_56.23262
          Length = 429

 Score = 37.0 bits (84), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 29/113 (25%), Positives = 49/113 (43%), Gaps = 13/113 (11%)

Query: 255 IAH--GKQVFLQDLSLLGDGNYVVGKVLVKNICYDKQVIVRYTWDQWNTTHDVQCVWFSS 312
           +AH  G  + L  +S   D   + G + V N+ ++K + +++T++ W   H V      S
Sbjct: 14  LAHLQGHNIKLNRISACLDSKKLQGLIYVANLNFEKSLEIKFTFNNWRDVHYVAAHHHRS 73

Query: 313 GDIVLPGMNMDMFKFVVDVPVDS---AEATLATTDPDK-EGGREVQ--FCIRY 359
               +     D FKF +D+   S       L + DP + E   +V    C RY
Sbjct: 74  ITDAI-----DEFKFTIDLAGLSFFMQSKNLVSCDPQRPETCCKVSMNLCCRY 121

>Scas_526.4
          Length = 915

 Score = 37.4 bits (85), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 35/158 (22%), Positives = 68/158 (43%), Gaps = 19/158 (12%)

Query: 187 LSNSTPEETKRPL--RRSKKHMMMMNGSGPSPATTASGSSMPPVPG---------LYNKN 235
           L N + E+T      R    H +  N +    +T  S S +              L + N
Sbjct: 208 LHNGSQEDTGNKQGDRDDDHHFIYHNNANTMNSTLNSNSVLLSATSHSFDSINWILKSSN 267

Query: 236 FPILSNKN-PTSLKLNIFLNIAHGKQVFLQDLSL-LGDGNYVVGKVLVKNICYDKQVIVR 293
                + N   SL++++F N   G+ + L  L+    + + ++G + V N+ ++K + ++
Sbjct: 268 ISTFHDTNKKNSLEVSLF-NFLQGQNIRLHSLNQDSNNSSKLIGLIYVNNLNFEKFIEIK 326

Query: 294 YTWDQWNTTHDVQCVWFSSGDIVLPGMNMDMFKFVVDV 331
           ++++ W   H V      S        N+D FKFV+D+
Sbjct: 327 FSFNHWKDIHYVTAFLNKS-----VTSNIDEFKFVIDL 359

>AGR275C [4586] [Homologous to ScYOR178C (GAC1) - SH; ScYLR273C
           (PIG1) - SH] (1254768..1256807) [2040 bp, 679 aa]
          Length = 679

 Score = 35.0 bits (79), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 24/117 (20%), Positives = 48/117 (41%), Gaps = 12/117 (10%)

Query: 252 FLNIAHGKQVFLQDLSLLGDGNYVVGKVLVKNICYDKQVIVRYTWDQWNTTHDVQCVWFS 311
                 G  + L  +SL+ D + + G + V N+ ++K + V++++D+W   H V   +  
Sbjct: 264 LFQFLQGHNIRLNKVSLV-DMHTIKGSLYVTNLHFEKFIEVKFSFDEWKNIHYVTAQYLK 322

Query: 312 SGDIVLPGMNMDMFKFVVDVPVDSAEATLATTDPDKEGGRE------VQFCIRYTTR 362
           +         +D F+F++D+        +        G RE      +  C RY   
Sbjct: 323 T-----VTSKVDEFQFIIDLSSYKYFMKVKNLLYCVPGARETWCPVTMSLCCRYDVN 374

>Kwal_26.8214
          Length = 502

 Score = 33.1 bits (74), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 16/59 (27%), Positives = 31/59 (52%)

Query: 128 EIIIMEPPKRSKSVHFDQRDVVSVKYFQKDERPVEVAQREVEEDQLSFTPKQLSFMNSW 186
           EI++ E  K ++  +F+  +V  V YFQ   + +   +  + +DQ+ + P+   FM  W
Sbjct: 110 EILVEELSKYTQLQYFEDLEVEDVNYFQTIMKYLYERRELLTDDQIQYLPQLARFMELW 168

>Sklu_1063.2 YIL161W, Contig c1063 560-1234 reverse complement
          Length = 224

 Score = 32.0 bits (71), Expect = 0.66,   Method: Compositional matrix adjust.
 Identities = 15/39 (38%), Positives = 24/39 (61%)

Query: 311 SSGDIVLPGMNMDMFKFVVDVPVDSAEATLATTDPDKEG 349
           S G IV   +  D+FKF ++VP D  ++ L  ++P+K G
Sbjct: 113 SYGFIVKGVLGKDLFKFTLNVPQDYPKSPLKLSNPNKNG 151

>Kwal_33.14545
          Length = 68

 Score = 29.6 bits (65), Expect = 0.82,   Method: Composition-based stats.
 Identities = 12/39 (30%), Positives = 23/39 (58%)

Query: 135 PKRSKSVHFDQRDVVSVKYFQKDERPVEVAQREVEEDQL 173
           P    S  F++R+++    + KD   ++ A+R +EE+QL
Sbjct: 28  PNEKCSYPFNEREIIENLVYTKDGEILDAAKRRLEEEQL 66

>YKL067W (YNK1) [3193] chr11 (314457..314918) Nucleoside diphosphate
           kinase, responsible for synthesis of all nucleoside
           triphosphates except ATP [462 bp, 153 aa]
          Length = 153

 Score = 29.6 bits (65), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 21/71 (29%), Positives = 35/71 (49%), Gaps = 2/71 (2%)

Query: 148 VVSVKYFQKDERPVEVAQREVEEDQLSFTPKQLSFMNSWLSNSTPEETKRPLRRSKKHMM 207
           +V++K  + D++ +E  Q   E     F PK +SFM S    +T  E K  +R+ +  + 
Sbjct: 36  LVAIKLVKADDKLLE--QHYAEHVGKPFFPKMVSFMKSGPILATVWEGKDVVRQGRTILG 93

Query: 208 MMNGSGPSPAT 218
             N  G +P T
Sbjct: 94  ATNPLGSAPGT 104

>CAGL0F04917g complement(499132..501180) weakly similar to sp|P28006
           Saccharomyces cerevisiae YOR178c GAC1 ser/thr
           phosphoprotein phosphatase 1, hypothetical start
          Length = 682

 Score = 30.0 bits (66), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 23/109 (21%), Positives = 47/109 (43%), Gaps = 7/109 (6%)

Query: 223 SSMPPVPGLYNKNFPILSNKNPTSLKLNIFLNIAHGKQVFLQDLSLLGDGNYVVGKVLVK 282
           +++ P    YN N     +    S    +  N  +G  + L +L      N + G + V 
Sbjct: 142 TNLVPFSQKYNLNHYRYDDVKDISKIETMIFNYLNGSNIKLHNLQ--KKTNKLKGLIYVN 199

Query: 283 NICYDKQVIVRYTWDQWNTTHDVQCVWFSSGDIVLPGMNMDMFKFVVDV 331
           N+ ++K + V+++++ W   H     +  S        ++D F+F +DV
Sbjct: 200 NLNFEKFIEVKFSFNNWKDIHYATATYNKS-----ITDHIDEFRFTIDV 243

>AGL084C [4227] [Homologous to NOHBY] (549283..549810) [528 bp, 175
           aa]
          Length = 175

 Score = 29.3 bits (64), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 15/36 (41%), Positives = 23/36 (63%), Gaps = 4/36 (11%)

Query: 110 HHRS--KSLPATPTGREPRTEIIIM--EPPKRSKSV 141
           HHRS  + +PA  + R+PRTEI+    E P R++ +
Sbjct: 122 HHRSAAREIPAVESARDPRTEILAAGGECPDRARHL 157

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.315    0.133    0.402 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 15,514,245
Number of extensions: 746679
Number of successful extensions: 1807
Number of sequences better than 10.0: 57
Number of HSP's gapped: 1760
Number of HSP's successfully gapped: 71
Length of query: 399
Length of database: 16,596,109
Length adjustment: 104
Effective length of query: 295
Effective length of database: 12,995,837
Effective search space: 3833771915
Effective search space used: 3833771915
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 63 (28.9 bits)