Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Sklu_2260.530230216130.0
Scas_715.4530530212221e-170
Kwal_23.575730730712211e-170
YER053C30030411631e-162
YJR077C (MIR1)3113036161e-78
CAGL0F00231g3072936038e-77
Sklu_1119.13072936039e-77
Scas_673.173142955873e-74
Kwal_33.155973052935847e-74
AER450C3082995752e-72
KLLA0B14454g3052945491e-68
CAGL0K02365g9193102085e-18
Sklu_1149.22962882001e-17
KLLA0E13453g9062972014e-17
Kwal_47.173218813052005e-17
Sklu_2359.69022841988e-17
Sklu_2334.23192831912e-16
ADL049W9123031943e-16
YPR021C (AGC1)9023091943e-16
Kwal_26.86692962961876e-16
Kwal_26.79672972841869e-16
Sklu_2432.52882581832e-15
YJL133W (MRS3)3143121833e-15
KLLA0E18810g3772711843e-15
Scas_379.23012871814e-15
CAGL0K08250g2972901799e-15
Scas_489.42973081727e-14
YOR222W (ODC2)3072751711e-13
KLLA0D07073g2972921692e-13
KLLA0E23705g3681951668e-13
YBR291C (CTP1)2992701648e-13
YMR166C3682451641e-12
AFL196W3613121632e-12
YKR052C (MRS4)3042921603e-12
KLLA0F03212g3052761603e-12
CAGL0L02079g2972861603e-12
AGL311C3622851579e-12
Scas_721.1293233021561e-11
KLLA0B12826g3192031561e-11
CAGL0G08910g2892921551e-11
Kwal_33.140503142861551e-11
Scas_602.88852921562e-11
Sklu_2431.53701961542e-11
AEL253W3651981533e-11
YJR095W (SFC1)3222881523e-11
Kwal_27.120813691981524e-11
KLLA0D09889g3642991524e-11
Scas_721.273741971515e-11
KLLA0A09383g3662571516e-11
ADL009W3792011481e-10
Kwal_23.47313143021472e-10
Scas_702.103022931462e-10
CAGL0F07711g3682801462e-10
Scas_582.73292921453e-10
KLLA0C13431g3282751453e-10
YPL134C (ODC1)3102651444e-10
YBR192W (RIM2)3771841444e-10
CAGL0M05225g3811821445e-10
YDL198C (YHM1)3002741425e-10
CAGL0L05742g3053031426e-10
ACR260W3113071427e-10
Sklu_2127.52782491409e-10
Scas_669.63732451411e-09
Scas_691.43342941392e-09
ACR109W2992571382e-09
YGR257C (MTM1)3662481382e-09
Kwal_26.76533251731382e-09
Kwal_23.39653071731373e-09
CAGL0F08305g3742611373e-09
CAGL0G01166g2952911363e-09
KLLA0D15015g3171811364e-09
Scas_709.93652891364e-09
Scas_645.93912541365e-09
CAGL0J09790g3002861355e-09
CAGL0M09020g3482541365e-09
YOR130C (ORT1)2921691338e-09
YKL120W (OAC1)3241731339e-09
KLLA0E02772g2842761339e-09
Scas_589.103162751321e-08
Sklu_2430.103241771321e-08
Sklu_2037.23101921311e-08
Kwal_55.213353171871312e-08
Kwal_23.43543432551312e-08
YOR100C (CRC1)3272741302e-08
Kwal_23.35293953001303e-08
KLLA0B11319g3552281276e-08
Kwal_47.182163333091276e-08
Scas_562.123002831267e-08
Scas_632.92921861267e-08
CAGL0K11616g3202861268e-08
YIL006W3731891268e-08
CAGL0K10362g3011811259e-08
Scas_662.123081811241e-07
Kwal_23.29133202831241e-07
CAGL0H03839g2822801232e-07
Sklu_2115.42992921232e-07
CAGL0G03135g3071861232e-07
YNL003C (PET8)2842901212e-07
AFR131C3441931214e-07
YLR348C (DIC1)2982321204e-07
Kwal_0.2322742621195e-07
KLLA0F13464g3002701196e-07
Scas_716.293161861196e-07
Sklu_1926.23052481186e-07
YGR096W (TPC1)3141921187e-07
Kwal_14.22103153081187e-07
KLLA0B08503g3032461188e-07
Sklu_2363.23232961188e-07
Kwal_27.116262992861179e-07
KLLA0F17864g3072031171e-06
Kwal_26.79723581621171e-06
KLLA0E15532g3263021161e-06
CAGL0J02002g3612921162e-06
Kwal_55.208683801711152e-06
Scas_558.22892741142e-06
Scas_717.203563371143e-06
CAGL0J01661g3272951143e-06
YIL134W (FLX1)3113041133e-06
Scas_714.183051911124e-06
AER366W2932351124e-06
Scas_697.473282711125e-06
KLLA0E08877g2942671115e-06
CAGL0K02915g3423461115e-06
Kwal_33.154463051931116e-06
ADL264C3292701116e-06
CAGL0H10538g2972861106e-06
Sklu_1275.13112451108e-06
Kwal_27.125993042541099e-06
AGR383W2932831081e-05
KLLA0E18788g3813401091e-05
CAGL0B04543g3171851072e-05
Kwal_47.192282811331062e-05
ABL023W3091791072e-05
AFR146W2811861062e-05
AER419W4931921072e-05
Scas_640.253061541062e-05
AAL014C2711931053e-05
AGL065C3353331063e-05
YHR002W (LEU5)3571211063e-05
YPR011C3262981053e-05
KLLA0D04950g2741831044e-05
Sklu_2442.82752641035e-05
YEL006W3352771035e-05
Sklu_2117.22981761027e-05
Kwal_55.211063282861027e-05
AGR191W2981861027e-05
Scas_696.93121331019e-05
CAGL0C02013g3291541011e-04
AFR542W3101431001e-04
KLLA0D14036g4313151001e-04
KLLA0E02750g304279983e-04
Sklu_2398.4309235983e-04
Scas_687.15*328134983e-04
AGL064W296255973e-04
ADR036C340232974e-04
AGL047C316301964e-04
Sklu_2433.8420133974e-04
YMR241W (YHM2)314139964e-04
KLLA0E09680g307191964e-04
AFR253W344126965e-04
Sklu_2374.7513254966e-04
AAR036W317157948e-04
Scas_718.5324247949e-04
YDL119C30772930.001
KLLA0F04697g307298930.001
Scas_578.3*524324930.001
Sklu_2435.2344300920.001
Kwal_56.23011303241900.002
Kwal_27.1141929859900.003
Scas_671.1*12370850.003
Kwal_55.21338323251890.003
KLLA0C11363g517196880.006
CAGL0J04114g303168860.008
Sklu_2075.3345198860.009
YNL083W545196860.009
CAGL0D04774g322279850.011
Sklu_2194.3312134830.017
KLLA0D04290g188137800.023
CAGL0F04213g30668820.026
Kwal_33.12988303205810.031
KLLA0A00979g343134810.035
YFR045W285166800.044
Kwal_34.15907312149790.050
Kwal_27.12481304181790.051
YMR056C (AAC1)309205790.056
CAGL0K12210g311204790.062
Scas_667.430868780.064
YBR085W (AAC3)30768780.069
CAGL0K07436g307133780.072
CAGL0D01606g30572780.083
KLLA0E12353g30568770.086
AFR147C315250770.095
Scas_718.2433768770.11
CAGL0J05522g519198770.12
Kwal_23.3042542192770.13
AER184W30570760.13
Sklu_2127.4323266740.25
YBL030C (PET9)318162710.62
Scas_705.9323135700.63
CAGL0B03883g306203690.87
Scas_613.2417757652.2
YBR104W (YMC2)32968652.7
CAGL0M04565g77044653.5
Scas_328.122770633.9
Kwal_33.1454631775644.4
Scas_706.2*19061624.8
Sklu_2443.1021325634.9
KLLA0E22880g43658627.2
KLLA0F08547g308171627.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Sklu_2260.5
         (302 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Sklu_2260.5 YER053C, Contig c2260 6981-7889 reverse complement        625   0.0  
Scas_715.45                                                           475   e-170
Kwal_23.5757                                                          474   e-170
YER053C (PIC2) [1481] chr5 complement(258736..259638) Member of ...   452   e-162
YJR077C (MIR1) [2970] chr10 complement(577169..578104) Phosphate...   241   1e-78
CAGL0F00231g 29705..30628 highly similar to sp|P23641 Saccharomy...   236   8e-77
Sklu_1119.1 YJR077C, Contig c1119 366-1289                            236   9e-77
Scas_673.17                                                           230   3e-74
Kwal_33.15597                                                         229   7e-74
AER450C [2950] [Homologous to ScYJR077C (MIR1) - SH] (1500683..1...   226   2e-72
KLLA0B14454g complement(1268709..1269626) highly similar to sp|P...   216   1e-68
CAGL0K02365g 212702..215461 highly similar to tr|Q12482 Saccharo...    85   5e-18
Sklu_1149.2 YBR291C, Contig c1149 2019-2909 reverse complement         82   1e-17
KLLA0E13453g complement(1184806..1187526) similar to sgd|S000622...    82   4e-17
Kwal_47.17321                                                          82   5e-17
Sklu_2359.6 YPR021C, Contig c2359 14617-17325                          81   8e-17
Sklu_2334.2 YJR095W, Contig c2334 6303-7262 reverse complement         78   2e-16
ADL049W [1692] [Homologous to ScYPR021C - SH] complement(598135....    79   3e-16
YPR021C (AGC1) [5455] chr16 complement(600644..603352) Member of...    79   3e-16
Kwal_26.8669                                                           77   6e-16
Kwal_26.7967                                                           76   9e-16
Sklu_2432.5 YLR348C, Contig c2432 10310-11176 reverse complement       75   2e-15
YJL133W (MRS3) [2785] chr10 (160537..161481) Member of the mitoc...    75   3e-15
KLLA0E18810g 1663220..1664353 some similarities with sp|P38152 S...    75   3e-15
Scas_379.2                                                             74   4e-15
CAGL0K08250g complement(820185..821078) highly similar to sp|P23...    74   9e-15
Scas_489.4                                                             71   7e-14
YOR222W (ODC2) [5014] chr15 (758330..759253) 2-Oxodicarboxylate ...    70   1e-13
KLLA0D07073g 606857..607750 similar to sp|Q03028 Saccharomyces c...    70   2e-13
KLLA0E23705g complement(2099965..2101071) highly similar to sp|P...    69   8e-13
YBR291C (CTP1) [469] chr2 complement(783631..784530) Mitochondri...    68   8e-13
YMR166C (YMR166C) [4121] chr13 complement(593366..594472) Member...    68   1e-12
AFL196W [2999] [Homologous to ScYMR166C - SH] complement(66955.....    67   2e-12
YKR052C (MRS4) [3303] chr11 complement(532192..533106) Member of...    66   3e-12
KLLA0F03212g 302915..303832 highly similar to sp|P33303 Saccharo...    66   3e-12
CAGL0L02079g 243467..244360 highly similar to sp|P38152 Saccharo...    66   3e-12
AGL311C [4001] [Homologous to ScYJR095W (SFC1) - SH] (119645..12...    65   9e-12
Scas_721.129                                                           65   1e-11
KLLA0B12826g 1121106..1122065 similar to sp|P32332 Saccharomyces...    65   1e-11
CAGL0G08910g complement(853693..854562) similar to sp|P40464 Sac...    64   1e-11
Kwal_33.14050                                                          64   1e-11
Scas_602.8                                                             65   2e-11
Sklu_2431.5 YBR192W, Contig c2431 8526-9638                            64   2e-11
AEL253W [2253] [Homologous to ScYBR192W (RIM2) - SH] complement(...    64   3e-11
YJR095W (SFC1) [2987] chr10 (609690..610658) Mitochondrial membr...    63   3e-11
Kwal_27.12081                                                          63   4e-11
KLLA0D09889g complement(834904..835998) similar to sp|Q03829 Sac...    63   4e-11
Scas_721.27                                                            63   5e-11
KLLA0A09383g complement(818752..819852) similar to sp|P53320 Sac...    63   6e-11
ADL009W [1733] [Homologous to ScYIL006W - SH; ScYEL006W - SH] co...    62   1e-10
Kwal_23.4731                                                           61   2e-10
Scas_702.10                                                            61   2e-10
CAGL0F07711g complement(751794..752900) similar to sp|Q03829 Sac...    61   2e-10
Scas_582.7                                                             60   3e-10
KLLA0C13431g 1145919..1146905 similar to sgd|S0005626 Saccharomy...    60   3e-10
YPL134C (ODC1) [5311] chr16 complement(298570..299502) 2-Oxodica...    60   4e-10
YBR192W (RIM2) [375] chr2 (607609..608742) Member of the mitocho...    60   4e-10
CAGL0M05225g 563163..564308 highly similar to sp|P38127 Saccharo...    60   5e-10
YDL198C (GGC1) [676] chr4 complement(103650..104552) Member of t...    59   5e-10
CAGL0L05742g complement(630844..631761) similar to sp|P10566 Sac...    59   6e-10
ACR260W [1307] [Homologous to ScYJL133W (MRS3) - SH; ScYKR052C (...    59   7e-10
Sklu_2127.5 YOR130C, Contig c2127 7354-8190 reverse complement         59   9e-10
Scas_669.6                                                             59   1e-09
Scas_691.4                                                             58   2e-09
ACR109W [1156] [Homologous to ScYOR222W (ODC2) - SH; ScYPL134C (...    58   2e-09
YGR257C (MTM1) [2204] chr7 complement(1006210..1007310) Member o...    58   2e-09
Kwal_26.7653                                                           58   2e-09
Kwal_23.3965                                                           57   3e-09
CAGL0F08305g complement(827705..828829) similar to sp|P53320 Sac...    57   3e-09
CAGL0G01166g complement(111298..112185) highly similar to tr|Q06...    57   3e-09
KLLA0D15015g 1267803..1268756 similar to sp|P53257 Saccharomyces...    57   4e-09
Scas_709.9                                                             57   4e-09
Scas_645.9                                                             57   5e-09
CAGL0J09790g complement(957759..958661) highly similar to sp|P38...    57   5e-09
CAGL0M09020g complement(896312..897358) highly similar to sp|P33...    57   5e-09
YOR130C (ORT1) [4932] chr15 complement(569929..570807) Ornithine...    56   8e-09
YKL120W (OAC1) [3145] chr11 (216990..217964) Mitochondrial oxalo...    56   9e-09
KLLA0E02772g complement(261895..262749) similar to sp|Q12375 Sac...    56   9e-09
Scas_589.10                                                            55   1e-08
Sklu_2430.10 YKL120W, Contig c2430 18856-19830                         55   1e-08
Sklu_2037.2 YIL134W, Contig c2037 1645-2577 reverse complement         55   1e-08
Kwal_55.21335                                                          55   2e-08
Kwal_23.4354                                                           55   2e-08
YOR100C (CRC1) [4905] chr15 complement(513295..514278) Mitochond...    55   2e-08
Kwal_23.3529                                                           55   3e-08
KLLA0B11319g 988293..989360 similar to sgd|S0006332 Saccharomyce...    54   6e-08
Kwal_47.18216                                                          54   6e-08
Scas_562.12                                                            53   7e-08
Scas_632.9                                                             53   7e-08
CAGL0K11616g complement(1121834..1122796) highly similar to sp|P...    53   8e-08
YIL006W (YIL006W) [2659] chr9 (344059..345180) Member of the mit...    53   8e-08
CAGL0K10362g complement(1009155..1010060) similar to sp|Q12375 S...    53   9e-08
Scas_662.12                                                            52   1e-07
Kwal_23.2913                                                           52   1e-07
CAGL0H03839g 359987..360835 highly similar to sp|P38921 Saccharo...    52   2e-07
Sklu_2115.4 YDL119C, Contig c2115 2906-3805                            52   2e-07
CAGL0G03135g 290834..291757 similar to sp|P53257 Saccharomyces c...    52   2e-07
YNL003C (PET8) [4582] chr14 complement(624974..625828) Protein o...    51   2e-07
AFR131C [3323] [Homologous to ScYGR257C - SH] (672999..674033) [...    51   4e-07
YLR348C (DIC1) [3731] chr12 complement(826976..827872) Mitochond...    51   4e-07
Kwal_0.232                                                             50   5e-07
KLLA0F13464g 1246646..1247548 highly similar to sp|P38988 Saccha...    50   6e-07
Scas_716.29                                                            50   6e-07
Sklu_1926.2 YPR058W, Contig c1926 347-1264 reverse complement          50   6e-07
YGR096W (TPC1) [2056] chr7 (676623..677567) Mitochondrial thiami...    50   7e-07
Kwal_14.2210                                                           50   7e-07
KLLA0B08503g complement(753498..754409) similar to sp|P32331 Sac...    50   8e-07
Sklu_2363.2 YPR011C, Contig c2363 11969-12940                          50   8e-07
Kwal_27.11626                                                          50   9e-07
KLLA0F17864g complement(1634241..1635164) similar to sp|P32331 S...    50   1e-06
Kwal_26.7972                                                           50   1e-06
KLLA0E15532g complement(1383230..1384210) similar to sp|P23500 S...    49   1e-06
CAGL0J02002g 198226..199311 similar to sp|P40556 Saccharomyces c...    49   2e-06
Kwal_55.20868                                                          49   2e-06
Scas_558.2                                                             49   2e-06
Scas_717.20                                                            49   3e-06
CAGL0J01661g 154646..155629 highly similar to tr|Q12251 Saccharo...    49   3e-06
YIL134W (FLX1) [2542] chr9 (97395..98330) Protein involved in tr...    48   3e-06
Scas_714.18                                                            48   4e-06
AER366W [2867] [Homologous to ScYIL134W (FLX1) - SH] complement(...    48   4e-06
Scas_697.47                                                            48   5e-06
KLLA0E08877g complement(791157..792041) similar to sgd|S0002277 ...    47   5e-06
CAGL0K02915g 259026..260054 highly similar to sp|P38702 Saccharo...    47   5e-06
Kwal_33.15446                                                          47   6e-06
ADL264C [1477] [Homologous to ScYOR100C (CRC1) - SH] (241532..24...    47   6e-06
CAGL0H10538g 1027739..1028632 highly similar to tr|Q07534 Saccha...    47   6e-06
Sklu_1275.1 , Contig c1275 314-1249                                    47   8e-06
Kwal_27.12599                                                          47   9e-06
AGR383W [4694] [Homologous to ScYDL119C - SH] complement(1436769...    46   1e-05
KLLA0E18788g complement(1661093..1662238) similar to sp|P38702 S...    47   1e-05
CAGL0B04543g 441599..442552 highly similar to tr|Q12289 Saccharo...    46   2e-05
Kwal_47.19228                                                          45   2e-05
ABL023W [569] [Homologous to ScYKL120W (OAC1) - SH] complement(3...    46   2e-05
AFR146W [3338] [Homologous to ScYOR130C (ORT1) - SH] complement(...    45   2e-05
AER419W [2919] [Homologous to ScYNL083W - SH] complement(1442595...    46   2e-05
Scas_640.25                                                            45   2e-05
AAL014C [173] [Homologous to ScYNL003C (PET8) - SH] (317388..318...    45   3e-05
AGL065C [4246] [Homologous to ScYHR002W (LEU5) - SH] (585963..58...    45   3e-05
YHR002W (LEU5) [2287] chr8 (108806..109879) Protein with similar...    45   3e-05
YPR011C (YPR011C) [5447] chr16 complement(583057..584037) Protei...    45   3e-05
KLLA0D04950g 424550..425374 similar to sp|P38921 Saccharomyces c...    45   4e-05
Sklu_2442.8 YNL003C, Contig c2442 12309-13136                          44   5e-05
YEL006W (YEL006W) [1417] chr5 (144326..145333) Member of the mit...    44   5e-05
Sklu_2117.2 YDL198C, Contig c2117 3737-4633                            44   7e-05
Kwal_55.21106                                                          44   7e-05
AGR191W [4502] [Homologous to ScYDL198C (YHM1) - SH] complement(...    44   7e-05
Scas_696.9                                                             44   9e-05
CAGL0C02013g complement(209930..210919) weakly similar to sp|P38...    44   1e-04
AFR542W [3734] [Homologous to ScYMR241W (YHM2) - SH] complement(...    43   1e-04
KLLA0D14036g complement(1203522..1204817) some similarities with...    43   1e-04
KLLA0E02750g 260854..261768 similar to ca|CA6127|IPF149 Candida ...    42   3e-04
Sklu_2398.4 , Contig c2398 9476-10405                                  42   3e-04
Scas_687.15*                                                           42   3e-04
AGL064W [4247] [Homologous to ScYBR291C (CTP1) - SH] complement(...    42   3e-04
ADR036C [1777] [Homologous to ScYPR128C (ANT1) - SH] (771097..77...    42   4e-04
AGL047C [4264] [Homologous to ScYPR011C - NSH] (616853..617803) ...    42   4e-04
Sklu_2433.8 YFR045W, Contig c2433 11995-13257 reverse complement       42   4e-04
YMR241W (YHM2) [4197] chr13 (751960..752904) Suppressor of abf1 ...    42   4e-04
KLLA0E09680g complement(860245..861168) similar to ca|CA5146|CaY...    42   4e-04
AFR253W [3445] [Homologous to ScYFR045W - SH] complement(892939....    42   5e-04
Sklu_2374.7 YNL083W, Contig c2374 13874-15415 reverse complement       42   6e-04
AAR036W [222] [Homologous to ScYGR096W - SH] complement(406887.....    41   8e-04
Scas_718.5                                                             41   9e-04
YDL119C (YDL119C) [751] chr4 complement(246689..247612) Member o...    40   0.001
KLLA0F04697g complement(461126..462049) similar to sp|P40464 Sac...    40   0.001
Scas_578.3*                                                            40   0.001
Sklu_2435.2 YPR128C, Contig c2435 2489-3523 reverse complement         40   0.001
Kwal_56.23011                                                          39   0.002
Kwal_27.11419                                                          39   0.003
Scas_671.1*                                                            37   0.003
Kwal_55.21338                                                          39   0.003
KLLA0C11363g complement(975442..976995) similar to sp|P48233 Sac...    39   0.006
CAGL0J04114g complement(384321..385232) similar to sp|Q99297 Sac...    38   0.008
Sklu_2075.3 , Contig c2075 6414-7451 reverse complement                38   0.009
YNL083W (YNL083W) [4507] chr14 (471377..473014) Member of the mi...    38   0.009
CAGL0D04774g complement(467712..468680) similar to tr|Q06497 Sac...    37   0.011
Sklu_2194.3 YMR241W, Contig c2194 5245-6183                            37   0.017
KLLA0D04290g 366536..367102 similar to sgd|S0006215 Saccharomyce...    35   0.023
CAGL0F04213g 419473..420393 highly similar to sp|P18239 Saccharo...    36   0.026
Kwal_33.12988                                                          36   0.031
KLLA0A00979g complement(92561..93592) weakly similar to sp|P3815...    36   0.035
YFR045W (YFR045W) [1727] chr6 (242129..242986) Member of the mit...    35   0.044
Kwal_34.15907                                                          35   0.050
Kwal_27.12481                                                          35   0.051
YMR056C (AAC1) [4016] chr13 complement(387314..388243) ADP/ATP c...    35   0.056
CAGL0K12210g 1193771..1194706 similar to sp|P38087 Saccharomyces...    35   0.062
Scas_667.4                                                             35   0.064
YBR085W (AAC3) [275] chr2 (415940..416863) ADP/ATP transporter p...    35   0.069
CAGL0K07436g complement(734496..735419) highly similar to sp|Q04...    35   0.072
CAGL0D01606g complement(169066..169983) highly similar to sp|P32...    35   0.083
KLLA0E12353g complement(1092303..1093220) gi|1351895|sp|P49382|A...    34   0.086
AFR147C [3339] [Homologous to NOHBY] (703270..704217) [948 bp, 3...    34   0.095
Scas_718.24                                                            34   0.11 
CAGL0J05522g complement(524930..526489) highly similar to sp|P48...    34   0.12 
Kwal_23.3042                                                           34   0.13 
AER184W [2686] [Homologous to ScYBL030C (PET9) - SH; ScYBR085W (...    34   0.13 
Sklu_2127.4 , Contig c2127 6322-7293                                   33   0.25 
YBL030C (PET9) [164] chr2 complement(163006..163962) ADP/ATP car...    32   0.62 
Scas_705.9                                                             32   0.63 
CAGL0B03883g 383602..384522 weakly similar to sp|P32331 Saccharo...    31   0.87 
Scas_613.24                                                            30   2.2  
YBR104W (YMC2) [293] chr2 (449624..450613) Member of the mitocho...    30   2.7  
CAGL0M04565g complement(499618..501930) similar to tr|Q12168 Sac...    30   3.5  
Scas_328.1                                                             29   3.9  
Kwal_33.14546                                                          29   4.4  
Scas_706.2*                                                            28   4.8  
Sklu_2443.10 YJR133W, Contig c2443 23259-23900 reverse complement      29   4.9  
KLLA0E22880g complement(2033077..2034387) similar to ca|CA2800|I...    28   7.2  
KLLA0F08547g 796328..797254 similar to sp|Q04013 Saccharomyces c...    28   7.2  

>Sklu_2260.5 YER053C, Contig c2260 6981-7889 reverse complement
          Length = 302

 Score =  625 bits (1613), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 302/302 (100%), Positives = 302/302 (100%)

Query: 1   MSTKQPIPLFSPEYYAACTLGGVVACGPTHSSVTPLDLVKCRLQVNPQLYRSNLDGWKTI 60
           MSTKQPIPLFSPEYYAACTLGGVVACGPTHSSVTPLDLVKCRLQVNPQLYRSNLDGWKTI
Sbjct: 1   MSTKQPIPLFSPEYYAACTLGGVVACGPTHSSVTPLDLVKCRLQVNPQLYRSNLDGWKTI 60

Query: 61  VRSEGLSKVFTGVGATFIGYSLQGACKYGGYEYFKQTYSNLLSPETAHRHRTAVYLCASA 120
           VRSEGLSKVFTGVGATFIGYSLQGACKYGGYEYFKQTYSNLLSPETAHRHRTAVYLCASA
Sbjct: 61  VRSEGLSKVFTGVGATFIGYSLQGACKYGGYEYFKQTYSNLLSPETAHRHRTAVYLCASA 120

Query: 121 SAEFLADILLCPWEAIKVKQQTTIPPFCKNFLEGWSKITAAEGLSGLYKGITPLWCRQIP 180
           SAEFLADILLCPWEAIKVKQQTTIPPFCKNFLEGWSKITAAEGLSGLYKGITPLWCRQIP
Sbjct: 121 SAEFLADILLCPWEAIKVKQQTTIPPFCKNFLEGWSKITAAEGLSGLYKGITPLWCRQIP 180

Query: 181 YTMCKFTSFERIVEMIYAKLPRSKQEMSPSQQIGVSFVGGYLAGILCAVVSHPADVMVSK 240
           YTMCKFTSFERIVEMIYAKLPRSKQEMSPSQQIGVSFVGGYLAGILCAVVSHPADVMVSK
Sbjct: 181 YTMCKFTSFERIVEMIYAKLPRSKQEMSPSQQIGVSFVGGYLAGILCAVVSHPADVMVSK 240

Query: 241 VNADRKQGESMVEASKRIYSRIGFGGLWNGLPVRIFMIGTLTSFQWLIYDSFKAYIGLPT 300
           VNADRKQGESMVEASKRIYSRIGFGGLWNGLPVRIFMIGTLTSFQWLIYDSFKAYIGLPT
Sbjct: 241 VNADRKQGESMVEASKRIYSRIGFGGLWNGLPVRIFMIGTLTSFQWLIYDSFKAYIGLPT 300

Query: 301 TG 302
           TG
Sbjct: 301 TG 302

>Scas_715.45
          Length = 305

 Score =  475 bits (1222), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 227/302 (75%), Positives = 258/302 (85%), Gaps = 2/302 (0%)

Query: 3   TKQPIPLFSPEYYAACTLGGVVACGPTHSSVTPLDLVKCRLQVNPQLYRSNLDGWKTIVR 62
           TK PI L++ EYYAACTLGG+VACGPTHSSVTPLDL+KCRLQV+P LYRSN  G   I++
Sbjct: 4   TKSPIELYTKEYYAACTLGGIVACGPTHSSVTPLDLIKCRLQVDPTLYRSNTSGIIQILK 63

Query: 63  SEGLSKVFTGVGATFIGYSLQGACKYGGYEYFKQTYSNLLSPE--TAHRHRTAVYLCASA 120
            EGL K+FTGVGAT IGYSLQGA KYGGYE FK+ YS  L  +  TA+++RT++YL +SA
Sbjct: 64  KEGLGKLFTGVGATCIGYSLQGAGKYGGYELFKRLYSTHLVKDEATAYKYRTSIYLLSSA 123

Query: 121 SAEFLADILLCPWEAIKVKQQTTIPPFCKNFLEGWSKITAAEGLSGLYKGITPLWCRQIP 180
           +AEF ADI+LCP+EAIKVKQQTT+PP+C N +EGW K+ A EGL+G YKGITPLWCRQIP
Sbjct: 124 TAEFFADIMLCPFEAIKVKQQTTMPPWCNNVIEGWKKMYAKEGLNGFYKGITPLWCRQIP 183

Query: 181 YTMCKFTSFERIVEMIYAKLPRSKQEMSPSQQIGVSFVGGYLAGILCAVVSHPADVMVSK 240
           YTMCKFTSFERIVE IYA+LP  K EMS  QQI VSFVGGY+AGILCA+VSHPADVMVSK
Sbjct: 184 YTMCKFTSFERIVEAIYARLPTKKSEMSALQQISVSFVGGYMAGILCAIVSHPADVMVSK 243

Query: 241 VNADRKQGESMVEASKRIYSRIGFGGLWNGLPVRIFMIGTLTSFQWLIYDSFKAYIGLPT 300
           +N +RK  ESM  A KRIYSRIGF GLWNGLPVRI MIGTLTSFQWLIYDSFKAY+GLPT
Sbjct: 244 INNERKVNESMNVALKRIYSRIGFVGLWNGLPVRILMIGTLTSFQWLIYDSFKAYVGLPT 303

Query: 301 TG 302
           +G
Sbjct: 304 SG 305

>Kwal_23.5757
          Length = 307

 Score =  474 bits (1221), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 229/307 (74%), Positives = 257/307 (83%), Gaps = 5/307 (1%)

Query: 1   MSTKQPI----PLFSPEYYAACTLGGVVACGPTHSSVTPLDLVKCRLQVNPQLYRSNLDG 56
           MS K  I     L+SPEYYAACTLGG+VACGPTHS+VTPLDLVKCR QV+  LY+SNLDG
Sbjct: 1   MSQKSSILNSPTLYSPEYYAACTLGGLVACGPTHSAVTPLDLVKCRRQVDASLYKSNLDG 60

Query: 57  WKTIVRSEGLSKVFTGVGATFIGYSLQGACKYGGYEYFKQTYSNLLSPETAHRHRTAVYL 116
           W+ IVRSEG +KVFTGVGAT IGYSLQGA KYGGYE+FK  YS L+SPETAH +RT ++L
Sbjct: 61  WRQIVRSEGATKVFTGVGATAIGYSLQGAFKYGGYEFFKHQYSQLVSPETAHSYRTGIFL 120

Query: 117 CASASAEFLADILLCPWEAIKVKQQTTIPP-FCKNFLEGWSKITAAEGLSGLYKGITPLW 175
            ASASAEF+ADI LCPWEAIKV+QQT +PP F +N  + +SK+  AEG + LYKGITPLW
Sbjct: 121 AASASAEFIADIFLCPWEAIKVRQQTAVPPPFARNVFDAYSKMVGAEGFASLYKGITPLW 180

Query: 176 CRQIPYTMCKFTSFERIVEMIYAKLPRSKQEMSPSQQIGVSFVGGYLAGILCAVVSHPAD 235
            RQIPYTMCKFTSFERIVEMIYA+LP  K+EMS   QI VSF GGYLAGILCAVVSHPAD
Sbjct: 181 FRQIPYTMCKFTSFERIVEMIYARLPTPKREMSQLGQISVSFAGGYLAGILCAVVSHPAD 240

Query: 236 VMVSKVNADRKQGESMVEASKRIYSRIGFGGLWNGLPVRIFMIGTLTSFQWLIYDSFKAY 295
           VMVSKVN +RK GES ++A+ RIY +IGF GLWNGL VRI MIGTLTSFQWLIYDSFKA 
Sbjct: 241 VMVSKVNNERKSGESTLQATSRIYGKIGFPGLWNGLAVRILMIGTLTSFQWLIYDSFKAA 300

Query: 296 IGLPTTG 302
            GLPT+G
Sbjct: 301 AGLPTSG 307

>YER053C (PIC2) [1481] chr5 complement(258736..259638) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters, has similarity to C. elegans mitochondrial
           phosphate carrier protein [903 bp, 300 aa]
          Length = 300

 Score =  452 bits (1163), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 218/304 (71%), Positives = 251/304 (82%), Gaps = 9/304 (2%)

Query: 2   STKQP--IPLFSPEYYAACTLGGVVACGPTHSSVTPLDLVKCRLQVNPQLYRSNLDGWKT 59
           S KQP  I L++ E+YA CTLGG++ACGPTHSS+TPLDLVKCRLQVNP+LY SNL G++ 
Sbjct: 3   SNKQPRKIQLYTKEFYATCTLGGIIACGPTHSSITPLDLVKCRLQVNPKLYTSNLQGFRK 62

Query: 60  IVRSEGLSKVFTGVGATFIGYSLQGACKYGGYEYFKQTYSNLLSPETAHRHRTAVYLCAS 119
           I+ +EG  KV+TG GATF+GYSLQGA KYGGYEYFK  YS+ LSP         VYL AS
Sbjct: 63  IIANEGWKKVYTGFGATFVGYSLQGAGKYGGYEYFKHLYSSWLSPGVT------VYLMAS 116

Query: 120 ASAEFLADILLCPWEAIKVKQQTTIPPFCKNFLEGWSKITAAEG-LSGLYKGITPLWCRQ 178
           A+AEFLADI+LCP+EAIKVKQQTT+PPFC N ++GW K+ A  G +   YKGI PLWCRQ
Sbjct: 117 ATAEFLADIMLCPFEAIKVKQQTTMPPFCNNVVDGWKKMYAESGGMKAFYKGIVPLWCRQ 176

Query: 179 IPYTMCKFTSFERIVEMIYAKLPRSKQEMSPSQQIGVSFVGGYLAGILCAVVSHPADVMV 238
           IPYTMCKFTSFE+IV+ IY+ LP+ K+EM+  QQI VSFVGGYLAGILCA VSHPADVMV
Sbjct: 177 IPYTMCKFTSFEKIVQKIYSVLPKKKEEMNALQQISVSFVGGYLAGILCAAVSHPADVMV 236

Query: 239 SKVNADRKQGESMVEASKRIYSRIGFGGLWNGLPVRIFMIGTLTSFQWLIYDSFKAYIGL 298
           SK+N++RK  ESM  ASKRIY +IGF GLWNGL VRI MIGTLTSFQWLIYDSFKAY+GL
Sbjct: 237 SKINSERKANESMSVASKRIYQKIGFTGLWNGLMVRIVMIGTLTSFQWLIYDSFKAYVGL 296

Query: 299 PTTG 302
           PTTG
Sbjct: 297 PTTG 300

>YJR077C (MIR1) [2970] chr10 complement(577169..578104) Phosphate
           transporter of the mitochondrial carrier (MCF) family
           [936 bp, 311 aa]
          Length = 311

 Score =  241 bits (616), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 124/303 (40%), Positives = 184/303 (60%), Gaps = 4/303 (1%)

Query: 1   MSTKQPIPLFSPEYYAACTLGGVVACGPTHSSVTPLDLVKCRLQVNPQLYRSNLDG-WKT 59
           +S    IP +S   Y    L G + CG THSS+ P+D+VK R+Q+ P +Y   + G +K 
Sbjct: 3   VSAAPAIPQYSVSDYMKFALAGAIGCGSTHSSMVPIDVVKTRIQLEPTVYNKGMVGSFKQ 62

Query: 60  IVRSEGLSKVFTGVGATFIGYSLQGACKYGGYEYFKQTYSNLLSPETAHRHRTAVYLCAS 119
           I+  EG   + TG G T +GYS+QGA K+GGYE FK+ + + L  +TA R++ +VY+ ++
Sbjct: 63  IIAGEGAGALLTGFGPTLLGYSIQGAFKFGGYEVFKKFFIDNLGYDTASRYKNSVYMGSA 122

Query: 120 ASAEFLADILLCPWEAIKVKQQTTIPPFCKNFLEGWSKITAAEGLSGLYKGITPLWCRQI 179
           A AEFLADI LCP EA +++   + P F    + G+S+I   EG+   Y G TP+  +QI
Sbjct: 123 AMAEFLADIALCPLEATRIR-LVSQPQFANGLVGGFSRILKEEGIGSFYSGFTPILFKQI 181

Query: 180 PYTMCKFTSFERIVEMIYAKLPRSKQEMSPSQQIGVSFVGGYLAGILCAVVSHPADVMVS 239
           PY + KF  FER  E  Y      K+++S +    ++ + G  AG+  A+VS PAD ++S
Sbjct: 182 PYNIAKFLVFERASEFYYG-FAGPKEKLSSTSTTLLNLLSGLTAGLAAAIVSQPADTLLS 240

Query: 240 KVNADRKQ-GESMVEASKRIYSRIGFGGLWNGLPVRIFMIGTLTSFQWLIYDSFKAYIGL 298
           KVN  +K  G+S V    ++  ++GF G + GLP R+ M+GTLTS Q+ IY S K+ +G 
Sbjct: 241 KVNKTKKAPGQSTVGLLAQLAKQLGFFGSFAGLPTRLVMVGTLTSLQFGIYGSLKSTLGC 300

Query: 299 PTT 301
           P T
Sbjct: 301 PPT 303

>CAGL0F00231g 29705..30628 highly similar to sp|P23641 Saccharomyces
           cerevisiae YJR077c MIR1, hypothetical start
          Length = 307

 Score =  236 bits (603), Expect = 8e-77,   Method: Compositional matrix adjust.
 Identities = 119/293 (40%), Positives = 180/293 (61%), Gaps = 4/293 (1%)

Query: 7   IPLFSPEYYAACTLGGVVACGPTHSSVTPLDLVKCRLQVNPQLYRSNLDG-WKTIVRSEG 65
           +P +S   YA   L G + CG THSS+ P+D+VK R+Q+ P +Y   + G ++ I+  EG
Sbjct: 5   LPQYSYSDYAKFALAGAIGCGSTHSSMVPIDVVKTRIQLEPTVYNKGMVGSFRKIIAEEG 64

Query: 66  LSKVFTGVGATFIGYSLQGACKYGGYEYFKQTYSNLLSPETAHRHRTAVYLCASASAEFL 125
              + TG G T +GYS+QGA K+GGYE FK+ + + L  +TA R++ +VY+ ++A+AEFL
Sbjct: 65  AGALLTGFGPTLLGYSIQGAFKFGGYEVFKKFFIDTLGYDTAARYKNSVYIGSAAAAEFL 124

Query: 126 ADILLCPWEAIKVKQQTTIPPFCKNFLEGWSKITAAEGLSGLYKGITPLWCRQIPYTMCK 185
           ADI LCP EA +++   + P F    + G+S+I   EG+   Y G TP+  +QIPY + K
Sbjct: 125 ADIALCPLEATRIR-LVSQPTFANGLVGGFSRILKEEGVGSFYSGFTPILFKQIPYNIAK 183

Query: 186 FTSFERIVEMIYAKLPRSKQEMSPSQQIGVSFVGGYLAGILCAVVSHPADVMVSKVNADR 245
           F  FER  E+ ++  P  K  +S +    ++ + G  AG+  A+VS PAD ++SKVN   
Sbjct: 184 FLVFERASELYFSLAP-PKDTLSQTSLTAINLLSGLTAGLAAAIVSQPADTLLSKVNKTS 242

Query: 246 KQ-GESMVEASKRIYSRIGFGGLWNGLPVRIFMIGTLTSFQWLIYDSFKAYIG 297
           K  G+S V    ++  ++GF G + GLP R+ M+GTLTS Q+ IY   K  +G
Sbjct: 243 KAPGQSTVGLLFQLAKQLGFVGSFAGLPTRLVMVGTLTSLQFGIYGQLKKSLG 295

>Sklu_1119.1 YJR077C, Contig c1119 366-1289
          Length = 307

 Score =  236 bits (603), Expect = 9e-77,   Method: Compositional matrix adjust.
 Identities = 117/293 (39%), Positives = 179/293 (61%), Gaps = 4/293 (1%)

Query: 7   IPLFSPEYYAACTLGGVVACGPTHSSVTPLDLVKCRLQVNPQLYRSNL-DGWKTIVRSEG 65
           IP +S   YA   L G + CG THS++ P+D+VK R+Q+ P +Y   +   +K I+ SEG
Sbjct: 5   IPDYSLSDYAKFALAGAIGCGTTHSAMVPIDVVKTRIQLEPTVYNKGMISSFKQIISSEG 64

Query: 66  LSKVFTGVGATFIGYSLQGACKYGGYEYFKQTYSNLLSPETAHRHRTAVYLCASASAEFL 125
              + TG G T +GYSLQG+ K+GGYE FK+ + ++L  + A  ++ ++Y+ ++A AEF 
Sbjct: 65  AGALLTGFGPTLLGYSLQGSFKFGGYEVFKKLFIDVLGYDQAVNYKNSIYIGSAAIAEFF 124

Query: 126 ADILLCPWEAIKVKQQTTIPPFCKNFLEGWSKITAAEGLSGLYKGITPLWCRQIPYTMCK 185
           ADI LCP EA +++  +  P F    + G+S+I   EG    Y G TP+  +QIPY + K
Sbjct: 125 ADIALCPLEATRIRLVSQ-PTFANGLVGGFSRILKEEGAGSFYNGFTPILFKQIPYNIAK 183

Query: 186 FTSFERIVEMIYAKLPRSKQEMSPSQQIGVSFVGGYLAGILCAVVSHPADVMVSKVNADR 245
           F  FER  E +Y  +   K+ +S +   G++ + G  AG+  A+VS PAD ++SKVN  +
Sbjct: 184 FLVFERAAE-VYFGMAGPKESLSTASTTGINLLSGLTAGLAAAIVSQPADTLLSKVNKTK 242

Query: 246 KQ-GESMVEASKRIYSRIGFGGLWNGLPVRIFMIGTLTSFQWLIYDSFKAYIG 297
           K  G+S +    ++  ++GF G + GLP R+ M+GTLTS Q+ IY S K  +G
Sbjct: 243 KAPGQSTIGLLAQLAKQLGFVGSFAGLPTRLVMVGTLTSLQFGIYGSLKKTLG 295

>Scas_673.17
          Length = 314

 Score =  230 bits (587), Expect = 3e-74,   Method: Compositional matrix adjust.
 Identities = 117/295 (39%), Positives = 175/295 (59%), Gaps = 4/295 (1%)

Query: 5   QPIPLFSPEYYAACTLGGVVACGPTHSSVTPLDLVKCRLQVNPQLYRSNLDG-WKTIVRS 63
             IP ++   Y    L G + CG THSS+ P+D+VK R+Q+ P +Y   + G +K I+  
Sbjct: 10  HKIPDYAASDYFKFALAGAIGCGTTHSSLVPVDVVKTRIQLEPTVYNKGMVGSFKKIIAD 69

Query: 64  EGLSKVFTGVGATFIGYSLQGACKYGGYEYFKQTYSNLLSPETAHRHRTAVYLCASASAE 123
           EG   + TG G T +GYS+QGA K+GGYE FK+   + +  E A  ++ +VY+ ++A AE
Sbjct: 70  EGAGALLTGFGPTLLGYSVQGAFKFGGYEVFKKLSIDTIGYENAVHYKNSVYMGSAAVAE 129

Query: 124 FLADILLCPWEAIKVKQQTTIPPFCKNFLEGWSKITAAEGLSGLYKGITPLWCRQIPYTM 183
           FLADI LCP EA +++  +  P F    + G+S+I   EG+   Y G TP+  +QIPY +
Sbjct: 130 FLADIALCPLEATRIRLVSQ-PTFANGLVGGFSRILKEEGVGSFYSGFTPILFKQIPYNI 188

Query: 184 CKFTSFERIVEMIYAKLPRSKQEMSPSQQIGVSFVGGYLAGILCAVVSHPADVMVSKVNA 243
            KF  FER  E+ Y  +  +K+ +S     G++ + G  AG   A VS PAD ++SKVN 
Sbjct: 189 AKFLVFERASEVYYG-IVGAKETLSDMTNTGINLLSGLTAGFAAAFVSQPADTLLSKVNK 247

Query: 244 DRKQ-GESMVEASKRIYSRIGFGGLWNGLPVRIFMIGTLTSFQWLIYDSFKAYIG 297
            +K  G+S +    ++  ++G  G + GLP R+ M+GTLTS Q+ IY S K  +G
Sbjct: 248 TKKAPGQSTIGLLAQLAKQLGVIGSFAGLPTRLIMVGTLTSLQFAIYGSLKNTLG 302

>Kwal_33.15597
          Length = 305

 Score =  229 bits (584), Expect = 7e-74,   Method: Compositional matrix adjust.
 Identities = 119/293 (40%), Positives = 179/293 (61%), Gaps = 4/293 (1%)

Query: 7   IPLFSPEYYAACTLGGVVACGPTHSSVTPLDLVKCRLQVNPQLYRSNL-DGWKTIVRSEG 65
           IP ++   YA   L G + CG THS++ P+D+VK R+Q+ P +Y   +   +K I+ SEG
Sbjct: 5   IPQYTISDYAKFALAGAIGCGTTHSAMVPIDVVKTRIQLEPTVYNKGMISSFKQIISSEG 64

Query: 66  LSKVFTGVGATFIGYSLQGACKYGGYEYFKQTYSNLLSPETAHRHRTAVYLCASASAEFL 125
              + TG G T +GYSLQG+ K+GGYE FK+ + + L  + A  ++ ++Y+ ++A AEF 
Sbjct: 65  AGALLTGFGPTLLGYSLQGSFKFGGYEVFKKLFIDTLGYDQAVNYKNSIYIGSAAIAEFF 124

Query: 126 ADILLCPWEAIKVKQQTTIPPFCKNFLEGWSKITAAEGLSGLYKGITPLWCRQIPYTMCK 185
           ADI LCP EA +++  +  P F    + G+S+I   EGLS  Y G TP+  +QIPY + K
Sbjct: 125 ADIALCPLEATRIRLVSQ-PTFANGLVGGFSRILKEEGLSSFYNGFTPILFKQIPYNIAK 183

Query: 186 FTSFERIVEMIYAKLPRSKQEMSPSQQIGVSFVGGYLAGILCAVVSHPADVMVSKVNADR 245
           F  FER  E +Y  +   K+ +S S   G++ + G  AG+  A+VS PAD ++SKVN  +
Sbjct: 184 FLVFERAAE-VYFGMAGPKETLSTSTTTGLNLLSGLTAGLAAAIVSQPADTLLSKVNKAK 242

Query: 246 KQ-GESMVEASKRIYSRIGFGGLWNGLPVRIFMIGTLTSFQWLIYDSFKAYIG 297
           K  G+S +    ++   +GF G + GLP R+ M+GTLTS Q+ IY S K  +G
Sbjct: 243 KAPGQSTIGLLGQLAKELGFVGSFAGLPTRLVMVGTLTSLQFGIYGSLKKTLG 295

>AER450C [2950] [Homologous to ScYJR077C (MIR1) - SH]
           (1500683..1501609) [927 bp, 308 aa]
          Length = 308

 Score =  226 bits (575), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 122/299 (40%), Positives = 181/299 (60%), Gaps = 4/299 (1%)

Query: 1   MSTKQPIPLFSPEYYAACTLGGVVACGPTHSSVTPLDLVKCRLQVNPQLYRSNLDG-WKT 59
           MST   +P +S   YA   L G + CG THS++ P+D+VK R+Q+ P  Y S + G ++ 
Sbjct: 1   MSTSYQVPNYSLSDYAKFALAGAIGCGATHSAMVPIDVVKTRIQLEPLKYSSGMVGSFRK 60

Query: 60  IVRSEGLSKVFTGVGATFIGYSLQGACKYGGYEYFKQTYSNLLSPETAHRHRTAVYLCAS 119
           IV  EG + + TG G T +GYS+QGA K+GGYE FK+ + + L  ETA ++RT +Y+ ++
Sbjct: 61  IVGEEGAAALLTGFGPTLLGYSMQGAFKFGGYEVFKKAFVDALGYETACQYRTPIYIGSA 120

Query: 120 ASAEFLADILLCPWEAIKVKQQTTIPPFCKNFLEGWSKITAAEGLSGLYKGITPLWCRQI 179
           A AEF ADI LCP EA +++   + P F    + G+++I   EG+   Y G TP+  +QI
Sbjct: 121 AIAEFFADIALCPLEATRIR-LVSQPTFANGLVGGFARILKEEGIGSFYNGFTPILFKQI 179

Query: 180 PYTMCKFTSFERIVEMIYAKLPRSKQEMSPSQQIGVSFVGGYLAGILCAVVSHPADVMVS 239
           PY + KF  FE      Y  L  SK+ +S +   G++ + G  AG+  AV+S PAD ++S
Sbjct: 180 PYNIAKFVVFEHAANA-YFGLAGSKENLSTTAATGINLLAGLTAGLAAAVISQPADTLLS 238

Query: 240 KVNADRKQ-GESMVEASKRIYSRIGFGGLWNGLPVRIFMIGTLTSFQWLIYDSFKAYIG 297
           KVN  +K  G+S      ++  ++GF G + GLP R+ M+GTLTS Q+ IY   K  +G
Sbjct: 239 KVNKTKKAPGQSTFGLLMQLAKQLGFVGSFAGLPTRLVMVGTLTSLQFGIYGKLKQSLG 297

>KLLA0B14454g complement(1268709..1269626) highly similar to
           sp|P23641 Saccharomyces cerevisiae YJR077c MIR1
           phosphate transport protein, mitochondrial (MCF), start
           by similarity
          Length = 305

 Score =  216 bits (549), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 115/294 (39%), Positives = 172/294 (58%), Gaps = 4/294 (1%)

Query: 6   PIPLFSPEYYAACTLGGVVACGPTHSSVTPLDLVKCRLQVNPQLYRSNL-DGWKTIVRSE 64
           P+P ++   YA   L G + CG THSS+ P+D+VK R+Q+ P +Y   +   +K I+ SE
Sbjct: 4   PVPEYTVSDYAKFALAGAIGCGITHSSMVPIDVVKTRIQLEPTVYNKGMVSSFKQIISSE 63

Query: 65  GLSKVFTGVGATFIGYSLQGACKYGGYEYFKQTYSNLLSPETAHRHRTAVYLCASASAEF 124
           G   + TG G T +GYSLQG+ K+GGYE FK+   + +  + A  ++  +Y+ ++A AEF
Sbjct: 64  GAGALLTGFGPTLLGYSLQGSFKFGGYELFKKLAIDNMGYDNAVNYKNTIYIGSAAIAEF 123

Query: 125 LADILLCPWEAIKVKQQTTIPPFCKNFLEGWSKITAAEGLSGLYKGITPLWCRQIPYTMC 184
            ADI LCP EA +++  +  P F      G+S+I   EG+   Y G TP+  +QIPY + 
Sbjct: 124 FADIALCPLEATRIRLVSQ-PTFANGLFGGFSRILKEEGVGSFYNGFTPILFKQIPYNIA 182

Query: 185 KFTSFERIVEMIYAKLPRSKQEMSPSQQIGVSFVGGYLAGILCAVVSHPADVMVSKVNAD 244
           KF  FE      Y  L   K+ MS +    ++   G  AG+  AVVS PAD ++SKVN  
Sbjct: 183 KFFVFEHAANA-YFGLAGPKETMSETTHTAINLAAGLTAGLAAAVVSQPADTLLSKVNKT 241

Query: 245 RKQ-GESMVEASKRIYSRIGFGGLWNGLPVRIFMIGTLTSFQWLIYDSFKAYIG 297
           +K  G+S +    ++  ++GF G + GLP R+ M+GTLTS Q+ IY + K  +G
Sbjct: 242 KKAPGQSTIGLLAQLAKQLGFVGSFTGLPTRLVMVGTLTSLQFGIYGTLKKSLG 295

>CAGL0K02365g 212702..215461 highly similar to tr|Q12482
           Saccharomyces cerevisiae YPR021c, start by similarity
          Length = 919

 Score = 84.7 bits (208), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 80/310 (25%), Positives = 134/310 (43%), Gaps = 36/310 (11%)

Query: 8   PLFSPEYYAACTLGGVVAC-GPTHSSVTPLDLVKCRLQVNPQL--YRSNLDGWKTIVRSE 64
           P+F   Y    +LG V  C G T   V P+D VK R+Q    L  Y++++D +  I+  E
Sbjct: 539 PIFDSLY--NFSLGSVAGCIGAT--IVYPIDFVKTRMQAQRSLSQYKNSIDCFLKILSRE 594

Query: 65  GLSKVFTGVGATFIGYSLQGACKYGGYEYFKQTYSN------LLSPETAHRHRTAVYLCA 118
           G+  V++G+G   IG + + A K    +Y +    +      LLS            + +
Sbjct: 595 GIRGVYSGLGPQLIGVAPEKAIKLTVNDYMRNKLKDKNGKLGLLSE-----------IIS 643

Query: 119 SASAEFLADILLCPWEAIKVKQQTTIPPFCKNFLEGWSKITAAE-----GLSGLYKGITP 173
            ASA     I   P E +K++ Q       +N     +K+TA +     GL GLYKG   
Sbjct: 644 GASAGACQVIFTNPLEIVKIRLQVKGEYVAENAEN--AKLTALQIIKRLGLPGLYKGAAA 701

Query: 174 LWCRQIPYTMCKFTSFERIVEMIYAKLPRSKQEMSPSQQIGVSFVGGYLAGILCAVVSHP 233
              R +P++   F ++  +   ++   P  K + S      +    G LAG+  A ++ P
Sbjct: 702 CLLRDVPFSAIYFPTYAHLKRDLFNFDPNDKNKRSRLNTWEL-LSAGALAGMPAAYLTTP 760

Query: 234 ADVMVSKVNADRKQGES----MVEASKRIYSRIGFGGLWNGLPVRIFMIGTLTSFQWLIY 289
            DV+ +++  D K+GE+    ++ A++ I     F   + G   R+        F    Y
Sbjct: 761 FDVIKTRLQIDPKKGETIYKGIIHAARTILREESFKSFFKGGAARVLRSSPQFGFTLAAY 820

Query: 290 DSFKAYIGLP 299
           + F     LP
Sbjct: 821 ELFHNIFPLP 830

>Sklu_1149.2 YBR291C, Contig c1149 2019-2909 reverse complement
          Length = 296

 Score = 81.6 bits (200), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 70/288 (24%), Positives = 128/288 (44%), Gaps = 32/288 (11%)

Query: 3   TKQPIPLFSPEYYAACTLGGVVACGPTHSSVT-PLDLVKCRLQVNPQLYRSNLDGWKTI- 60
           +KQ  P  S  + A C  G V       +SVT P +  K RLQ+  +  +++ +    I 
Sbjct: 4   SKQVDP--SKSFIAGCLAGAV------EASVTYPFEFAKTRLQLLDKASKASRNPLVLIY 55

Query: 61  --VRSEGLSKVFTGVGATFIGYSLQGACKYGGYEYFKQTYSNLL-SPETAHRHRTAVYLC 117
              +++G+  V+ G  A  +G + +   ++ G++  K    NLL  P+T         + 
Sbjct: 56  NTAKTQGIGSVYVGCPAFIVGNTAKAGVRFLGFDTIK----NLLRDPKTGELSGPRGVIA 111

Query: 118 ASASAEFLADILLCPWEAIKV----KQQTTIPPFCKN---FLEGWSKITAAEGLSGLYKG 170
              +    + + + P+EAIK      +Q+  P +  N    L  ++ +   +GLSGLY+G
Sbjct: 112 GLGAGLLESVVAVTPFEAIKTALIDDKQSATPKYHNNGKGMLRNYTALVRKQGLSGLYRG 171

Query: 171 ITPLWCRQIPYTMCKFTSFERIVEMI--YAKLPRSKQEMSPSQQIGVSFVGGYLAGILCA 228
           + P+  RQ      +   + +I  M+  Y   P+ K   S     G++FV G  +GI+  
Sbjct: 172 VLPVSMRQAANQAVRLGCYNKIKVMVQDYTNAPKDKPLSS-----GLTFVVGAFSGIVTV 226

Query: 229 VVSHPADVMVSKVNA-DRKQGESMVEASKRIYSRIGFGGLWNGLPVRI 275
             + P D + +++ + D K+  S +     I+   G    W G   R+
Sbjct: 227 YTTMPIDTVKTRMQSLDSKRYSSTINCFTTIFKEEGLKAFWKGATPRL 274

>KLLA0E13453g complement(1184806..1187526) similar to sgd|S0006225
           Saccharomyces cerevisiae YPR021c, start by similarity
          Length = 906

 Score = 82.0 bits (201), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 72/297 (24%), Positives = 135/297 (45%), Gaps = 31/297 (10%)

Query: 19  TLGGVVAC-GPTHSSVTPLDLVKCRLQV--NPQLYRSNLDGWKTIVRSEGLSKVFTGVGA 75
           TLG +  C G T   V P+DLVK R+Q   N   Y++++D    I +++G+  +++G+G 
Sbjct: 509 TLGSIAGCIGAT--VVYPIDLVKTRMQAQRNSVQYKNSIDCVVKIFQTKGIRGLYSGLGP 566

Query: 76  TFIGYSLQGACKYGGYEYFKQTYSNLLSPETAHRHRTAVY---LCASASAEFLADILLCP 132
             IG + + A K    ++ +Q + N        + RT  +   + + A+A     +   P
Sbjct: 567 QLIGVAPEKAIKLTVNDFMRQYFMN--------KSRTIKWYQEILSGATAGACQVVFTNP 618

Query: 133 WEAIKVKQQTTIPPFCKNFLE--GWSKITAAEGLSGLYKGITPLWCRQIPYTMCKFTSFE 190
            E +K++ Q       +N     G   I    GL GLYKG      R +P++   F ++ 
Sbjct: 619 LEIVKIRLQMRSDYVGENARPQLGAVGIIRQLGLRGLYKGAAACLLRDVPFSAIYFPTYA 678

Query: 191 RIVEMIYAKLPRSKQEMSPSQQIGVSFVGGYLAGILCAVVSHPADVMVSKVNADRKQGES 250
            + + ++   P  K + +  +   +   GG +AG+  A ++ P DV+ +++  D ++GE+
Sbjct: 679 HLKKDVFNFDPNDKNKRNKLKTWELLLAGG-IAGMPAAYLTTPFDVIKTRLQIDPRKGET 737

Query: 251 ----MVEASKRIYSRIGFGGLWNGLPVRI--------FMIGTLTSFQWLIYDSFKAY 295
               ++ A++ I         + G P R+        F +     FQ L    FK +
Sbjct: 738 TYTGVIHAARTILKEESIKSFFKGGPARVLRSSPQFGFTLAAFEMFQGLFPSHFKNH 794

 Score = 33.1 bits (74), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 19/83 (22%), Positives = 43/83 (51%), Gaps = 2/83 (2%)

Query: 216 SFVGGYLAGILCAVVSHPADVMVSKVNADRK--QGESMVEASKRIYSRIGFGGLWNGLPV 273
           +F  G +AG + A V +P D++ +++ A R   Q ++ ++   +I+   G  GL++GL  
Sbjct: 507 NFTLGSIAGCIGATVVYPIDLVKTRMQAQRNSVQYKNSIDCVVKIFQTKGIRGLYSGLGP 566

Query: 274 RIFMIGTLTSFQWLIYDSFKAYI 296
           ++  +    + +  + D  + Y 
Sbjct: 567 QLIGVAPEKAIKLTVNDFMRQYF 589

>Kwal_47.17321
          Length = 881

 Score = 81.6 bits (200), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 77/305 (25%), Positives = 140/305 (45%), Gaps = 37/305 (12%)

Query: 7   IPLFSPEYYAACTLGGVVAC-GPTHSSVTPLDLVKCRLQV--NPQLYRSNLDGWKTIVRS 63
            P+F   Y     LG V  C G T  +V P+DLVK R+Q   N   Y++++D +  I   
Sbjct: 495 FPIFDSIY--NFLLGSVAGCIGAT--AVYPIDLVKTRMQAQRNFSQYKNSIDCFVKIFSR 550

Query: 64  EGLSKVFTGVGATFIGYSLQGACKYGGYEYFKQTYSNLLSPETAHRHRTAVYLCASASAE 123
           EG+  +++G+G   +G + + A K    +Y ++    LL  E  +R    + + + A+A 
Sbjct: 551 EGIRGIYSGLGPQLVGVAPEKAIKLTVNDYVRK----LLMDEN-NRLTLPLEIISGAAAG 605

Query: 124 FLADILLCPWEAIKVKQQT------TIPPFCKNFLEGWSKITA-----AEGLSGLYKGIT 172
               I   P E +K++ Q       ++P          S++TA     + GL GLYKG+ 
Sbjct: 606 ACQVIFTNPLEIVKIRLQVRSEYADSLPK---------SQLTALGVVKSLGLRGLYKGLV 656

Query: 173 PLWCRQIPYTMCKFTSFERIVEMIYAKLPRSKQEMSPSQQIGVSFVGGYLAGILCAVVSH 232
               R +P++   F ++  +   I+   P+ K + +      +   GG LAG+  A ++ 
Sbjct: 657 ACLMRDVPFSAIYFPTYAHLKRDIFNYDPQDKNKRARLHTWELLTAGG-LAGMPAAYLTT 715

Query: 233 PADVMVSKVNADRKQGES----MVEASKRIYSRIGFGGLWNGLPVRIFMIGTLTSFQWLI 288
           P DV+ +++  D ++GE+    ++ A++ I     F   + G   R+        F    
Sbjct: 716 PFDVIKTRLQIDPRKGETRYTGILHAARTILKEERFKSFFKGGGARVLRSSPQFGFTLAA 775

Query: 289 YDSFK 293
           Y+ F+
Sbjct: 776 YEIFQ 780

 Score = 41.6 bits (96), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 27/85 (31%), Positives = 39/85 (45%), Gaps = 5/85 (5%)

Query: 18  CTLGGVVACGPTHSSVTPLDLVKCRLQVNPQ----LYRSNLDGWKTIVRSEGLSKVFTGV 73
            T GG+ A  P     TP D++K RLQ++P+     Y   L   +TI++ E     F G 
Sbjct: 700 LTAGGL-AGMPAAYLTTPFDVIKTRLQIDPRKGETRYTGILHAARTILKEERFKSFFKGG 758

Query: 74  GATFIGYSLQGACKYGGYEYFKQTY 98
           GA  +  S Q       YE F+  +
Sbjct: 759 GARVLRSSPQFGFTLAAYEIFQNMF 783

>Sklu_2359.6 YPR021C, Contig c2359 14617-17325
          Length = 902

 Score = 80.9 bits (198), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 71/284 (25%), Positives = 133/284 (46%), Gaps = 33/284 (11%)

Query: 8   PLFSPEYYAACTLGGVVAC-GPTHSSVTPLDLVKCRLQVNPQL--YRSNLDGWKTIVRSE 64
           P+F   Y    TLG +  C G T   V P+DLVK R+Q       Y++++D +  I   E
Sbjct: 514 PIFDSIY--NFTLGSIAGCIGAT--VVYPIDLVKTRMQAQRSFSQYKNSIDCFAKIFSRE 569

Query: 65  GLSKVFTGVGATFIGYSLQGACKYGGYEYFK----QTYSNLLSPETAHRHRTAVYLCASA 120
           G+  +++G+G   IG + + A K    +Y +      ++NL         +    + + A
Sbjct: 570 GIRGIYSGLGPQLIGVAPEKAIKLTVNDYMRGRLMDKHANL---------KWYFEILSGA 620

Query: 121 SAEFLADILLCPWEAIKVKQQTTIPPFCKNFLEGWSKITA-----AEGLSGLYKGITPLW 175
            A     +   P E +K++ Q     +  + L+  S++TA       G+ GLYKGI    
Sbjct: 621 CAGACQVVFTNPLEVVKIRLQVR-SEYAGDVLK--SQVTALGVIKQLGIKGLYKGIAACL 677

Query: 176 CRQIPYTMCKFTSFERIVEMIYAKLPRSKQEMSPSQQIGVSFVGGYLAGILCAVVSHPAD 235
            R +P++   F ++  + + ++   P+ K++ +  +   +   GG LAG+  A ++ P D
Sbjct: 678 MRDVPFSAIYFPTYAHLKKDVFKYDPKDKKQRNKLKTWELLVAGG-LAGMPAAYLTTPFD 736

Query: 236 VMVSKVNADRKQGESMVE----ASKRIYSRIGFGGLWNGLPVRI 275
           V+ +++  D ++GE+  E    A++ I     F   + G   R+
Sbjct: 737 VIKTRLQIDPRKGETRYEGIFHAARTILKEESFKSFFKGGSARV 780

 Score = 39.3 bits (90), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 23/83 (27%), Positives = 38/83 (45%), Gaps = 4/83 (4%)

Query: 20  LGGVVACGPTHSSVTPLDLVKCRLQVNPQLYRSNLDGW----KTIVRSEGLSKVFTGVGA 75
           + G +A  P     TP D++K RLQ++P+   +  +G     +TI++ E     F G  A
Sbjct: 719 VAGGLAGMPAAYLTTPFDVIKTRLQIDPRKGETRYEGIFHAARTILKEESFKSFFKGGSA 778

Query: 76  TFIGYSLQGACKYGGYEYFKQTY 98
             +  S Q       YE F+  +
Sbjct: 779 RVLRSSPQFGFTLAAYEIFQNMF 801

>Sklu_2334.2 YJR095W, Contig c2334 6303-7262 reverse complement
          Length = 319

 Score = 78.2 bits (191), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 63/283 (22%), Positives = 120/283 (42%), Gaps = 33/283 (11%)

Query: 35  PLDLVKCRLQVNPQLYRSNLDGWK---------TIVRSEGLSKVFTGVGATFIGYSLQGA 85
           PLD +K R+Q+     RS L+G K          I   EGL  ++ G+GA  IG   + A
Sbjct: 30  PLDTIKVRMQI---YRRSALEGIKPPGFIKTGRNIYTEEGLLALYKGLGAVVIGIIPKMA 86

Query: 86  CKYGGYEYFKQTYSNLLSPETAHRHRTAVYLCASASAEFLADILLCPWEAIKVKQQ---- 141
            ++  YE+++   S L   +T        +L    +    A +++ P E +K++ Q    
Sbjct: 87  IRFSSYEFYR---SALADKQTGSVSTGNTFLAGVGAGTTEAVLVVNPMEVVKIRLQAQHL 143

Query: 142 ---TTIPPFCKNFLEGWSKITAAEGLSGLYKGITPLWCRQIPYTMCKFTSFERIVEMIYA 198
              T   P  +N L+    I   EG+  LY+G++    RQ       FT + ++ E +  
Sbjct: 144 HPETAASPRYRNALQACYLIVKEEGIGALYRGVSLTAARQATNQGANFTVYSKLKEFLQ- 202

Query: 199 KLPRSKQEMSPSQQIGVSFVGGYLAGILCAVVSHPADVMVSKVNADRKQGE-----SMVE 253
                K +  PS +       G ++G +    + P D + +++  D+          +V 
Sbjct: 203 --EHHKTDALPSWETSCI---GLISGAIGPFSNAPLDTIKTRLQKDKSTANMSGWSRIVT 257

Query: 254 ASKRIYSRIGFGGLWNGLPVRIFMIGTLTSFQWLIYDSFKAYI 296
             K++    GF  L+ G+  R+  +    +  + +Y+  + ++
Sbjct: 258 IGKQLIKEEGFRALYKGITPRVMRVAPGQAVTFTVYEFVREHL 300

 Score = 30.0 bits (66), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 20/99 (20%), Positives = 42/99 (42%), Gaps = 6/99 (6%)

Query: 210 SQQIGVSFVGGYLAGILCAVVSHPADVMVSKVNADRKQG------ESMVEASKRIYSRIG 263
           S    V+ + G  AG+  A+  HP D +  ++   R+           ++  + IY+  G
Sbjct: 7   SSNPAVNLIAGGTAGLFEALCCHPLDTIKVRMQIYRRSALEGIKPPGFIKTGRNIYTEEG 66

Query: 264 FGGLWNGLPVRIFMIGTLTSFQWLIYDSFKAYIGLPTTG 302
              L+ GL   +  I    + ++  Y+ +++ +    TG
Sbjct: 67  LLALYKGLGAVVIGIIPKMAIRFSSYEFYRSALADKQTG 105

>ADL049W [1692] [Homologous to ScYPR021C - SH]
           complement(598135..600873) [2739 bp, 912 aa]
          Length = 912

 Score = 79.3 bits (194), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 75/303 (24%), Positives = 132/303 (43%), Gaps = 23/303 (7%)

Query: 8   PLFSPEYYAACTLGGVVACGPTHSSVTPLDLVKCRLQVNPQL--YRSNLDGWKTIVRSEG 65
           P+F   Y    TLG V  C      V P+D+VK R+Q       Y++++D    I+  EG
Sbjct: 520 PIFDSIY--NFTLGSVAGCIGA-MVVYPIDMVKTRMQAQRDFSKYKNSIDCLLKILSKEG 576

Query: 66  LSKVFTGVGATFIGYSLQGACKYGGYEYFKQTYSNLLSPETAHRHRTAVYLCASASAEFL 125
           +  +++G+G   IG + + A K    ++ + T +         +      + + A+A   
Sbjct: 577 VRGLYSGLGPQLIGVAPEKAIKLTVNDHMRATLAG-----RDGKLSLPCEIISGATAGAC 631

Query: 126 ADILLCPWEAIKVKQQTT---IPPFCKNFLEGWSKITAAEGLSGLYKGITPLWCRQIPYT 182
             +   P E +K++ Q     +    +N +   S I    GL GLY+G      R IP++
Sbjct: 632 QVVFTNPLEIVKIRLQVKSDYVADAARNSVNAISVIKNL-GLIGLYRGAGACLLRDIPFS 690

Query: 183 MCKFTSFERIVEMIYAKLPRS--KQEMSPSQQIGVSFVGGYLAGILCAVVSHPADVMVSK 240
              F ++  I   ++   P+   K+    + Q+ VS   G LAG+  A ++ P DV+ ++
Sbjct: 691 AIYFPTYAHIKSNVFNFDPKDSDKRNKLNTWQLLVS---GGLAGMPAAFLTTPFDVIKTR 747

Query: 241 VNADRKQGESMV----EASKRIYSRIGFGGLWNGLPVRIFMIGTLTSFQWLIYDSFKAYI 296
           +  D K+GES+     +A++ I    G    + G P R+        F    Y+ F    
Sbjct: 748 LQIDPKKGESVYNGIWDAARTILKEEGIKSFFKGGPARVLRSSPQFGFTLAAYEIFHNLF 807

Query: 297 GLP 299
             P
Sbjct: 808 PAP 810

 Score = 43.9 bits (102), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 28/95 (29%), Positives = 43/95 (45%), Gaps = 5/95 (5%)

Query: 20  LGGVVACGPTHSSVTPLDLVKCRLQVNPQ----LYRSNLDGWKTIVRSEGLSKVFTGVGA 75
           + G +A  P     TP D++K RLQ++P+    +Y    D  +TI++ EG+   F G  A
Sbjct: 725 VSGGLAGMPAAFLTTPFDVIKTRLQIDPKKGESVYNGIWDAARTILKEEGIKSFFKGGPA 784

Query: 76  TFIGYSLQGACKYGGYEYFKQTY-SNLLSPETAHR 109
             +  S Q       YE F   + +      T HR
Sbjct: 785 RVLRSSPQFGFTLAAYEIFHNLFPAPRYDDSTTHR 819

>YPR021C (AGC1) [5455] chr16 complement(600644..603352) Member of
           the mitochondrial carrier family (MCF) of membrane
           transporters [2709 bp, 902 aa]
          Length = 902

 Score = 79.3 bits (194), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 72/309 (23%), Positives = 134/309 (43%), Gaps = 30/309 (9%)

Query: 8   PLFSPEYYAACTLGGVVAC-GPTHSSVTPLDLVKCRLQVNPQL--YRSNLDGWKTIVRSE 64
           P+F   Y    +LG +  C G T   V P+D +K R+Q    L  Y++++D    I+  E
Sbjct: 526 PIFDSLY--NFSLGSIAGCIGAT--VVYPIDFIKTRMQAQRSLAQYKNSIDCLLKIISRE 581

Query: 65  GLSKVFTGVGATFIGYSLQGACKYGGYEYFKQTYSNL-----LSPETAHRHRTAVYLCAS 119
           G+  +++G+G   IG + + A K    ++ +   ++      L PE          + + 
Sbjct: 582 GIKGLYSGLGPQLIGVAPEKAIKLTVNDFMRNRLTDKNGKLSLFPE----------IISG 631

Query: 120 ASAEFLADILLCPWEAIKVKQQTTIPPFCKNFL---EGWSKITAAEGLSGLYKGITPLWC 176
           ASA     I   P E +K++ Q       +N     E  ++I    GL GLY G+     
Sbjct: 632 ASAGACQVIFTNPLEIVKIRLQVQSDYVGENIQQANETATQIVKKLGLRGLYNGVAACLM 691

Query: 177 RQIPYTMCKFTSFERIVEMIYAKLPRSKQEMSPSQQIGVSFVGGYLAGILCAVVSHPADV 236
           R +P++   F ++  + + ++   P  K + +  +   +    G +AG+  A ++ P DV
Sbjct: 692 RDVPFSAIYFPTYAHLKKDLFDFDPNDKTKRNRLKTWEL-LTAGAIAGMPAAFLTTPFDV 750

Query: 237 MVSKVNADRKQGES----MVEASKRIYSRIGFGGLWNGLPVRIFMIGTLTSFQWLIYDSF 292
           + +++  D ++GE+    +  A + I     F   + G   R+        F    Y+ F
Sbjct: 751 IKTRLQIDPRKGETKYNGIFHAIRTILKEESFRSFFKGGGARVLRSSPQFGFTLAAYELF 810

Query: 293 KAYIGLPTT 301
           K +I  P  
Sbjct: 811 KGFIPSPDN 819

>Kwal_26.8669
          Length = 296

 Score = 76.6 bits (187), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 73/296 (24%), Positives = 133/296 (44%), Gaps = 40/296 (13%)

Query: 1   MSTKQPIPLFSPEYYAACTLGGVVACGPTHSSVTPLDLVKCRLQVN------PQLYRSNL 54
           M+  +P+P F    +AA  + G+      +    PLD+VK R+Q+       PQ Y+  +
Sbjct: 1   MTDARPLPFFYQ--FAAGAVAGISEILVMY----PLDVVKTRMQLQVSGGLGPQ-YKGVV 53

Query: 55  DGWKTIVRSEGLSKVFTGVGATFIGYSLQGACKYGGYEYFKQTYSNLLSPETAHRHRTAV 114
           D  K IV  EG S+++ G+ +  +  + + A K+   + F++ Y      E   +   ++
Sbjct: 54  DCIKQIVAKEGASRLYKGISSPVLMEAPKRATKFACNDEFQKIYKREFGVE---KLTQSL 110

Query: 115 YLCASASAEFLADILLCPWEAIKVKQQTTIPPFCKNFLEGWSKITAAEGLSGLYKGITPL 174
            + + ASA      ++ P+E +K++ Q     + K  ++   KI A EG+  +Y G+   
Sbjct: 111 SILSGASAGCCEAFVVVPFELVKIRLQDVSSSY-KGPIDVVRKIIAQEGVLAMYNGLEST 169

Query: 175 WCRQIPYTMCKFTSFERIVEMIYAKLPRSKQEMSPSQQIGVSFVGGYLAGILCAVVSHPA 234
             R   +    F     I+  + A LP +K   S SQQ     + G + G + +++S P 
Sbjct: 170 LWRHGVWNAGYFG----IIFQVRALLPEAK---SKSQQTRNDLIAGSIGGTIGSLMSTPF 222

Query: 235 DVMVSKVNADRKQGESMVEASKR-----------IYSRIGFGGLWNGLPVRIFMIG 279
           DV+ S++     Q  ++V    R           IY   GF  L+ G   ++  +G
Sbjct: 223 DVVKSRI-----QNTAVVAGGARKYNWSWPSIFTIYKEEGFRALYKGFVPKVLRLG 273

>Kwal_26.7967
          Length = 297

 Score = 76.3 bits (186), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 69/284 (24%), Positives = 123/284 (43%), Gaps = 26/284 (9%)

Query: 4   KQPIPLFSPEYYAACTLGGVVACGPTHSSVTPLDLVKCRLQVNPQLYRSNLDGWKTIVRS 63
           KQ  PL S   + A +L G V    T+    P +  K RLQ+  +   ++ +    I R+
Sbjct: 5   KQVDPLHS---FLAGSLAGAVEASITY----PFEFAKTRLQLVDKSSTASRNPLTLIYRT 57

Query: 64  ---EGLSKVFTGVGATFIGYSLQGACKYGGYEYFKQTYSNLLSPETAHRHRTAVYLCASA 120
              +GL  V+ G  A  +G + +   ++ G++  K    N+L   T         + A  
Sbjct: 58  AKVQGLGAVYVGCPAFIVGNTAKAGVRFLGFDAIK----NILRDPTTGELSGPRGIVAGL 113

Query: 121 SAEFLADIL-LCPWEAIKV----KQQTTIPPFCKN---FLEGWSKITAAEGLSGLYKGIT 172
            A  L  ++ + P+EAIK      +Q+  P +  N    L  +S +   +G SGLY+G+ 
Sbjct: 114 GAGLLESVVAVTPFEAIKTALIDDKQSASPKYHNNGRGMLRNYSSLVYDKGFSGLYRGVL 173

Query: 173 PLWCRQIPYTMCKFTSFERIVEMIYAKLPRSKQEMSPSQQIGVSFVGGYLAGILCAVVSH 232
           P+  RQ      +   + +I  MI      +K +   S   G++FV G  +GI+    + 
Sbjct: 174 PVSMRQAANQAVRLGCYNKIKTMIQDYTNSAKDKPLSS---GMTFVVGAFSGIVTVYTTM 230

Query: 233 PADVMVSKVNA-DRKQGESMVEASKRIYSRIGFGGLWNGLPVRI 275
           P D + +++ + D  +  S +     ++   G    W G   R+
Sbjct: 231 PIDTVKTRMQSLDSSKYSSTINCFATVFREEGLKTFWKGATPRL 274

 Score = 37.4 bits (85), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 35/175 (20%), Positives = 71/175 (40%), Gaps = 8/175 (4%)

Query: 32  SVTPLDLVKCRLQVNPQ----LYRSN----LDGWKTIVRSEGLSKVFTGVGATFIGYSLQ 83
           +VTP + +K  L  + Q     Y +N    L  + ++V  +G S ++ GV    +  +  
Sbjct: 123 AVTPFEAIKTALIDDKQSASPKYHNNGRGMLRNYSSLVYDKGFSGLYRGVLPVSMRQAAN 182

Query: 84  GACKYGGYEYFKQTYSNLLSPETAHRHRTAVYLCASASAEFLADILLCPWEAIKVKQQTT 143
            A + G Y   K    +  +        + +     A +  +      P + +K + Q+ 
Sbjct: 183 QAVRLGCYNKIKTMIQDYTNSAKDKPLSSGMTFVVGAFSGIVTVYTTMPIDTVKTRMQSL 242

Query: 144 IPPFCKNFLEGWSKITAAEGLSGLYKGITPLWCRQIPYTMCKFTSFERIVEMIYA 198
                 + +  ++ +   EGL   +KG TP   R I      FT +E+++ ++ A
Sbjct: 243 DSSKYSSTINCFATVFREEGLKTFWKGATPRLGRLILSGGIVFTIYEKVLVVLGA 297

 Score = 30.0 bits (66), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 26/101 (25%), Positives = 45/101 (44%), Gaps = 5/101 (4%)

Query: 207 MSPSQQIG--VSFVGGYLAGILCAVVSHPADVMVSKVNADRKQGESMVEASKRIYSRI-- 262
           MS  +Q+    SF+ G LAG + A +++P +   +++    K   +       IY     
Sbjct: 1   MSQKKQVDPLHSFLAGSLAGAVEASITYPFEFAKTRLQLVDKSSTASRNPLTLIYRTAKV 60

Query: 263 -GFGGLWNGLPVRIFMIGTLTSFQWLIYDSFKAYIGLPTTG 302
            G G ++ G P  I         ++L +D+ K  +  PTTG
Sbjct: 61  QGLGAVYVGCPAFIVGNTAKAGVRFLGFDAIKNILRDPTTG 101

>Sklu_2432.5 YLR348C, Contig c2432 10310-11176 reverse complement
          Length = 288

 Score = 75.1 bits (183), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 65/258 (25%), Positives = 115/258 (44%), Gaps = 24/258 (9%)

Query: 3   TKQPIPLFSPEYYAACTLGGVVACGPTHSSVTPLDLVKCRLQVNPQLYRSNLDGWKTIVR 62
           +  P P+  P +Y     GG+VAC  TH    PLDL K RLQ  P    + +     I+R
Sbjct: 2   SSAPEPVKYPWWYGG--FGGIVACVATH----PLDLAKVRLQTAPAPKPTLVRMASQILR 55

Query: 63  SEGLSKVFTGVGATFIGYSLQGACKYGGYEYFKQTYSNLLSPETAHRHRTAVYLCASASA 122
           +EG+  +++G+ A  +        ++G Y++ K+ Y     P+        +  C+  S 
Sbjct: 56  NEGVPGLYSGLTAAILRQCTYTTARFGVYDFVKERY----IPKEYLNSMLYLLPCSMFSG 111

Query: 123 EFLADILLCPWEAIKVKQQ--TTIPPFC----KNFLEGWSKITAAEGLSGLYKGITPLWC 176
             +  ++  P + + ++ Q  +++P       KN  +G  KI + EG++ L+ G  P   
Sbjct: 112 A-VGGLIGNPADVVNIRMQNDSSLPAELRRNYKNAADGLYKICSGEGVAKLFTGWQPNLV 170

Query: 177 RQIPYTMCKFTSFERIVEMIYAKLPRSKQEMSPSQQIGVSFVGGYLAGILCAVVSHPADV 236
           R I  T  +  +++     +   +   K   S        F    LAG++   V  PADV
Sbjct: 171 RGILMTSSQVVTYDIAKNYLVQNVGLDKDNKS------THFASSLLAGLVATTVCSPADV 224

Query: 237 MVSKV-NADRKQGESMVE 253
           + ++V NA +   +S V 
Sbjct: 225 IKTRVMNAHKHSHDSAVR 242

 Score = 43.1 bits (100), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 44/172 (25%), Positives = 73/172 (42%), Gaps = 16/172 (9%)

Query: 132 PWEAIKVKQQTTIPPFCKNFLEGWSKITAAEGLSGLYKGITPLWCRQIPYTMCKFTSFER 191
           P +  KV+ QT   P     +   S+I   EG+ GLY G+T    RQ  YT  +F  ++ 
Sbjct: 28  PLDLAKVRLQTAPAP-KPTLVRMASQILRNEGVPGLYSGLTAAILRQCTYTTARFGVYDF 86

Query: 192 IVEMIYAKLPRSKQEMSPSQQIGVSFVGGYLAGILCAVVSHPADVMVSKVNAD------- 244
           + E    K    +   S    +  S   G + G+    + +PADV+  ++  D       
Sbjct: 87  VKERYIPK----EYLNSMLYLLPCSMFSGAVGGL----IGNPADVVNIRMQNDSSLPAEL 138

Query: 245 RKQGESMVEASKRIYSRIGFGGLWNGLPVRIFMIGTLTSFQWLIYDSFKAYI 296
           R+  ++  +   +I S  G   L+ G    +     +TS Q + YD  K Y+
Sbjct: 139 RRNYKNAADGLYKICSGEGVAKLFTGWQPNLVRGILMTSSQVVTYDIAKNYL 190

 Score = 34.7 bits (78), Expect = 0.069,   Method: Compositional matrix adjust.
 Identities = 20/74 (27%), Positives = 35/74 (47%)

Query: 220 GYLAGILCAVVSHPADVMVSKVNADRKQGESMVEASKRIYSRIGFGGLWNGLPVRIFMIG 279
           G   GI+  V +HP D+   ++        ++V  + +I    G  GL++GL   I    
Sbjct: 15  GGFGGIVACVATHPLDLAKVRLQTAPAPKPTLVRMASQILRNEGVPGLYSGLTAAILRQC 74

Query: 280 TLTSFQWLIYDSFK 293
           T T+ ++ +YD  K
Sbjct: 75  TYTTARFGVYDFVK 88

>YJL133W (MRS3) [2785] chr10 (160537..161481) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters, overexpression suppresses mitochondrial
           splicing defects [945 bp, 314 aa]
          Length = 314

 Score = 75.1 bits (183), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 73/312 (23%), Positives = 132/312 (42%), Gaps = 39/312 (12%)

Query: 7   IPLFSPEYYAACT--------LGGVVACGPTHSSVTPLDLVKCRLQ-VNPQLY--RSNLD 55
           IP+  P+Y A  T        + G  A    HS + P+D +K R+Q  N +    ++ L 
Sbjct: 17  IPMDLPDYEALPTHAPLYHQLIAGAFAGIMEHSVMFPIDALKTRIQSANAKSLSAKNMLS 76

Query: 56  GWKTIVRSEGLSKVFTGVGATFIGYSLQGACKYGGYEYFKQTYSNLLSPETAHRHRTAVY 115
               I  SEG   ++ GV +  +G     A  +G YE+ K+   +    +T H  +TA+ 
Sbjct: 77  QISHISTSEGTLALWKGVQSVILGAGPAHAVYFGTYEFCKKNLIDSSDTQTHHPFKTAI- 135

Query: 116 LCASASAEFLADILLCPWEAIKVKQQTTIPPFCKNFLEGWSKITAAEGLSGLYKGITPLW 175
             + A A   +D L+ P++ IK + Q        +  +   +I  +EGL+  Y       
Sbjct: 136 --SGACATTASDALMNPFDTIKQRIQLNT---SASVWQTTKQIYQSEGLAAFYYSYPTTL 190

Query: 176 CRQIPYTMCKFTSFERIVEMIYAKLPRSKQEMSPSQQIG--VSFVGGYLAGILCAVVSHP 233
              IP+    F  +E            S + ++PS +    +  + G ++G  CA ++ P
Sbjct: 191 VMNIPFAAFNFVIYES-----------STKFLNPSNEYNPLIHCLCGSISGSTCAAITTP 239

Query: 234 ADVM--VSKVNADR-------KQGESMVEASKRIYSRIGFGGLWNGLPVRIFMIGTLTSF 284
            D +  V ++   +       ++ ++  +A+  IY   G+ G W G   RI      T+ 
Sbjct: 240 LDCIKTVLQIRGSQTVSLEIMRKADTFSKAASAIYQVYGWKGFWRGWKPRIVANMPATAI 299

Query: 285 QWLIYDSFKAYI 296
            W  Y+  K ++
Sbjct: 300 SWTAYECAKHFL 311

>KLLA0E18810g 1663220..1664353 some similarities with sp|P38152
           Saccharomyces cerevisiae YBR291c CTP1 citrate transport
           protein, mitochondrial (MCF), hypothetical start
          Length = 377

 Score = 75.5 bits (184), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 62/271 (22%), Positives = 124/271 (45%), Gaps = 25/271 (9%)

Query: 20  LGGVVACGPTHSSVT-PLDLVKCRLQVNPQLYRSNLDGWKTIV---RSEGLSKVFTGVGA 75
           L G +A G   +S+T P +  K RLQ+  +  +++ +    I    ++ G+S ++ G  A
Sbjct: 95  LAGSIA-GAIEASITYPFEFAKTRLQLVDKASKASRNPLVLIYNTGKNYGISSIYVGCPA 153

Query: 76  TFIGYSLQGACKYGGYEYFKQTYSNLLSPETAHRHRTAVYLCASASAEFLADIL-LCPWE 134
             +G + +   ++ G++    T  NLL  +          + A   A  L  ++ + P+E
Sbjct: 154 FIVGNTAKAGIRFLGFD----TIKNLLRDKKTGELSGFRGVVAGLGAGLLESVVAVTPFE 209

Query: 135 AIKV----KQQTTIPPFCKN---FLEGWSKITAAEGLSGLYKGITPLWCRQIPYTMCKFT 187
           AIK      +Q  +P +  N    +  ++K+ + +G SGLY+G+ P+  RQ      +  
Sbjct: 210 AIKTALIDDKQAAVPKYQNNGKGMVSNYAKLLSDQGFSGLYRGVLPVSMRQAANQAVRLG 269

Query: 188 SFERIVEMI--YAKLPRSKQEMSPSQQIGVSFVGGYLAGILCAVVSHPADVMVSKVNA-D 244
            + +I  ++  Y  +P+ K   S     G++F+ G  +GI+    + P D + +++ + +
Sbjct: 270 CYNKIKTLVQDYTNVPKDKPLSS-----GLTFIVGAFSGIVTVYTTMPIDTVKTRMQSLN 324

Query: 245 RKQGESMVEASKRIYSRIGFGGLWNGLPVRI 275
             Q  S +     I+   G    W G   R+
Sbjct: 325 AGQYSSTINCFATIFKEEGLKTFWKGATPRL 355

 Score = 35.4 bits (80), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 38/176 (21%), Positives = 75/176 (42%), Gaps = 14/176 (7%)

Query: 32  SVTPLDLVKCRLQVNPQL----YRSNLDG----WKTIVRSEGLSKVFTGVGATFIGYSLQ 83
           +VTP + +K  L  + Q     Y++N  G    +  ++  +G S ++ GV    +  +  
Sbjct: 204 AVTPFEAIKTALIDDKQAAVPKYQNNGKGMVSNYAKLLSDQGFSGLYRGVLPVSMRQAAN 263

Query: 84  GACKYGGYEYFK---QTYSNLLSPETAHRHRTAVYLCASASAEFLADILLCPWEAIKVKQ 140
            A + G Y   K   Q Y+N+  P+         ++  + S   +      P + +K + 
Sbjct: 264 QAVRLGCYNKIKTLVQDYTNV--PKDKPLSSGLTFIVGAFSG-IVTVYTTMPIDTVKTRM 320

Query: 141 QTTIPPFCKNFLEGWSKITAAEGLSGLYKGITPLWCRQIPYTMCKFTSFERIVEMI 196
           Q+       + +  ++ I   EGL   +KG TP   R I      FT +E+++ ++
Sbjct: 321 QSLNAGQYSSTINCFATIFKEEGLKTFWKGATPRLGRLILSGGIVFTIYEKVLTVL 376

>Scas_379.2
          Length = 301

 Score = 74.3 bits (181), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 71/287 (24%), Positives = 112/287 (39%), Gaps = 25/287 (8%)

Query: 20  LGGVVACGPTHSSVTPLDLVKCRLQVNPQLYRSN-LDGWKTIVRSEGLSKVFTGVGATFI 78
           L G  A    HS + P+D +K R+Q       SN L     I  +EG   ++ GV +  +
Sbjct: 28  LAGAFAGIMEHSVMFPIDALKTRIQSTSAKSTSNMLSQMAKISTAEGSLALWKGVQSVIL 87

Query: 79  GYSLQGACKYGGYEYFKQTYSNLLSPETAHRHRTAVYLCASASAEFLADILLCPWEAIKV 138
           G     A  +  YEY K+    L+  +    H+      +   A   AD L+ P++ +K 
Sbjct: 88  GAGPAHAVYFATYEYTKKY---LIDEKDMQTHQPLKTALSGTVATIAADALMNPFDTLKQ 144

Query: 139 KQQTTIPPFCKNFLEGWSKITAAEGLSGLYKGITPLWCRQIPYTMCKFTSFERIVEMIYA 198
           + Q        N  +   +I   EG S  Y          IP+    F  +E        
Sbjct: 145 RMQLNTNTTVWNVTK---QIYKNEGFSAFYYSYPTTLAMNIPFAAFNFMIYESAT----- 196

Query: 199 KLPRSKQEMSPSQQIGVSFVGGYLAGILCAVVSHPADVM--VSKVNADR-------KQGE 249
           K      + +P     V  + G L+G  CA ++ P D +  V +V           K+  
Sbjct: 197 KFFNPTNDYNPL----VHCLSGGLSGATCAAITTPLDCIKTVLQVRGSESVSLQVMKEAN 252

Query: 250 SMVEASKRIYSRIGFGGLWNGLPVRIFMIGTLTSFQWLIYDSFKAYI 296
           +  +A+K IY   G  G W GL  R+F     T+  W  Y+  K ++
Sbjct: 253 TFQKATKAIYQVHGAKGFWRGLQPRVFANMPATAIAWTAYECAKHFL 299

 Score = 54.3 bits (129), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 40/176 (22%), Positives = 79/176 (44%), Gaps = 8/176 (4%)

Query: 116 LCASASAEFLADILLCPWEAIKVKQQTTIPPFCKNFLEGWSKITAAEGLSGLYKGITPLW 175
           L A A A  +   ++ P +A+K + Q+T      N L   +KI+ AEG   L+KG+  + 
Sbjct: 27  LLAGAFAGIMEHSVMFPIDALKTRIQSTSAKSTSNMLSQMAKISTAEGSLALWKGVQSVI 86

Query: 176 CRQIPYTMCKFTSFERIVEMIYAKLPRSKQEMSPSQQIGVSFVGGYLAGILCAVVSHPAD 235
               P     F ++E   + +       +++M   Q +  + + G +A I    + +P D
Sbjct: 87  LGAGPAHAVYFATYEYTKKYLI-----DEKDMQTHQPLKTA-LSGTVATIAADALMNPFD 140

Query: 236 VMVSKVNADRKQGESMVEASKRIYSRIGFGGLWNGLPVRIFMIGTLTSFQWLIYDS 291
            +  ++  +     ++   +K+IY   GF   +   P  + M     +F ++IY+S
Sbjct: 141 TLKQRMQLNT--NTTVWNVTKQIYKNEGFSAFYYSYPTTLAMNIPFAAFNFMIYES 194

>CAGL0K08250g complement(820185..821078) highly similar to sp|P23500
           Saccharomyces cerevisiae YKR052c Mitochondrial RNA
           splicing protein, hypothetical start
          Length = 297

 Score = 73.6 bits (179), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 66/290 (22%), Positives = 114/290 (39%), Gaps = 30/290 (10%)

Query: 20  LGGVVACGPTHSSVTPLDLVKCRLQVNPQLYRSN--LDGWKTIVRSEGLSKVFTGVGATF 77
           L G  A    HS + P+D +K R+Q +     +   +     I  +EG   ++ GV +  
Sbjct: 21  LAGAFAGIMEHSVLFPVDAIKTRIQSSSSGAATQGLIKQISKITTAEGSLALWKGVQSVI 80

Query: 78  IGYSLQGACKYGGYEYFKQTYSNLLSPETAHRHRTAVYLCASASAEFLADILLCPWEAIK 137
           +G     A  +  YE+ K   S L+ P+  H H+      +  +A  +AD L+ P++ IK
Sbjct: 81  LGAGPAHAVYFATYEFSK---SKLIDPQDMHTHQPIKTAISGMAATTVADALMNPFDVIK 137

Query: 138 VKQQTTIPPFCKNFLEGWSKITAAEGLSGLYKGITPLWCRQIPYTMCKFTSFERIVEMIY 197
            + Q       ++       I   EG +  Y          IP+    F  +E   +   
Sbjct: 138 QRMQLNTR---ESVWHVTKNIYHKEGFAAFYYSYPTTLVMNIPFAAFNFAIYESATKF-- 192

Query: 198 AKLPRSKQEMSPSQQIG--VSFVGGYLAGILCAVVSHPADVMVSKV---------NADRK 246
                    M+PS +    +  + G L+G  CA ++ P D + + +         N   K
Sbjct: 193 ---------MNPSNEYNPFIHCISGGLSGATCAAITTPLDCIKTVLQVRGSETVSNEIMK 243

Query: 247 QGESMVEASKRIYSRIGFGGLWNGLPVRIFMIGTLTSFQWLIYDSFKAYI 296
           Q  +   A+  IY   G+ G   GL  R+      T+  W  Y+  K ++
Sbjct: 244 QANTFQRAASAIYKIHGWKGFLRGLKPRVIANMPATAISWTSYECAKHFL 293

>Scas_489.4
          Length = 297

 Score = 70.9 bits (172), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 65/308 (21%), Positives = 129/308 (41%), Gaps = 29/308 (9%)

Query: 4   KQPI-PLFSPEYYAACTLGGVVACGPTHSSVTPLDLVKCRLQV---NPQLYRSNLDGWKT 59
           K+P+ PL S   + A  L G +    T+    P +  K RLQ+        R+ L     
Sbjct: 5   KKPVDPLHS---FIAGALAGAIEASITY----PFEFAKTRLQLIDKTSTASRNPLVLIYN 57

Query: 60  IVRSEGLSKVFTGVGATFIGYSLQGACKYGGYEYFKQTYSNLLSPETAHRHRTAVYLCAS 119
             +++G   ++ G  A  +G + +   ++ G++  K    + ++ E +        L A 
Sbjct: 58  TAKTQGTGAIYVGCPAFIVGNTAKAGIRFLGFDTIKNMLRDPVTGELSGPRGVVAGLGAG 117

Query: 120 ASAEFLADILLCPWEAIKV----KQQTTIPPFCKN---FLEGWSKITAAEGLSGLYKGIT 172
                +A   + P+EAIK      +Q   P +  N    L  +  +   +G+ GLY+G+ 
Sbjct: 118 LLESVVA---VTPFEAIKTALIDDKQALKPKYQNNGRGMLRNYGSLVRDQGIMGLYRGVL 174

Query: 173 PLWCRQIPYTMCKFTSFERIVEMI--YAKLPRSKQEMSPSQQIGVSFVGGYLAGILCAVV 230
           P+  RQ      +   + +I  M+  Y   P+ +   S     G++F+ G  +G++    
Sbjct: 175 PVSMRQAANQAVRLGCYNKIKTMVQDYTNAPKDRPLSS-----GLTFIVGAFSGVVTVYT 229

Query: 231 SHPADVMVSKVNA-DRKQGESMVEASKRIYSRIGFGGLWNGLPVRIFMIGTLTSFQWLIY 289
           + P D + +++ + D  +  S V    +I+   G    W G   R+  +       + IY
Sbjct: 230 TMPIDTVKTRMQSLDATKYTSTVNCFAKIFKEEGLKTFWKGATPRLGRLILSGGIVFTIY 289

Query: 290 DSFKAYIG 297
           ++   ++G
Sbjct: 290 ENVLVFLG 297

 Score = 29.3 bits (64), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 25/101 (24%), Positives = 44/101 (43%), Gaps = 4/101 (3%)

Query: 205 QEMSPSQQIGVSFVGGYLAGILCAVVSHPADVMVSKVNADRKQGESMVEASKRIYSRI-- 262
           QE  P   +  SF+ G LAG + A +++P +   +++    K   +       IY+    
Sbjct: 3   QEKKPVDPLH-SFIAGALAGAIEASITYPFEFAKTRLQLIDKTSTASRNPLVLIYNTAKT 61

Query: 263 -GFGGLWNGLPVRIFMIGTLTSFQWLIYDSFKAYIGLPTTG 302
            G G ++ G P  I         ++L +D+ K  +  P TG
Sbjct: 62  QGTGAIYVGCPAFIVGNTAKAGIRFLGFDTIKNMLRDPVTG 102

>YOR222W (ODC2) [5014] chr15 (758330..759253) 2-Oxodicarboxylate
           transporter, specific for 2-oxoadipate and
           2-oxoglutarate, member of the mitochondrial carrier
           family (MCF) of membrane transporters [924 bp, 307 aa]
          Length = 307

 Score = 70.5 bits (171), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 65/275 (23%), Positives = 122/275 (44%), Gaps = 39/275 (14%)

Query: 20  LGGVVACGPTHSSVTPLDLVKCRLQ----------VNPQLYRSN--LDGWKTIVRSEGLS 67
           + G VA     + + PLD+VK R Q          V  Q+ R N  +D  K IV+ EG S
Sbjct: 17  ISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYNGVIDCLKKIVKKEGFS 76

Query: 68  KVFTGVGATFIGYSLQGACKYGGYEYFKQTYSNLLSP-ETAHRHRTAVYLCASASAEFLA 126
           +++ G+ +  +  + + A K+   + +++ + NL +  ET  +    + + A ASA    
Sbjct: 77  RLYRGISSPMLMEAPKRATKFACNDQYQKIFKNLFNTNETTQK----ISIAAGASAGMTE 132

Query: 127 DILLCPWEAIKVKQQTTIPPFCKNFLEGWSKITAAEGLSGLYKGITPLWCRQIPYTMCKF 186
             ++ P+E IK++ Q     +    ++   K    EG+ GLYKGI     R   +    F
Sbjct: 133 AAVIVPFELIKIRMQDVKSSYLGP-MDCLKKTIKNEGIMGLYKGIESTMWRNALWNGGYF 191

Query: 187 TSFERIVEMIYAKLPRSKQEMSPSQQIGVSFVGGYLAGILCAVVSHPADVMVSKVNADRK 246
                ++  +   +P +K   +  Q+     + G + G +  +++ P DV+ S++ +   
Sbjct: 192 G----VIYQVRNSMPVAK---TKGQKTRNDLIAGAIGGTVGTMLNTPFDVVKSRIQSV-- 242

Query: 247 QGESMVEASKR----------IYSRIGFGGLWNGL 271
             +++  A K+          IY   GF  L+ G 
Sbjct: 243 --DAVSSAVKKYNWCLPSLLVIYREEGFRALYKGF 275

 Score = 47.4 bits (111), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 41/162 (25%), Positives = 68/162 (41%), Gaps = 10/162 (6%)

Query: 25  ACGPTHSSV-TPLDLVKCRLQVNPQLYRSNLDGWKTIVRSEGLSKVFTGVGATFIGYSLQ 83
           + G T ++V  P +L+K R+Q     Y   +D  K  +++EG+  ++ G+ +T      +
Sbjct: 127 SAGMTEAAVIVPFELIKIRMQDVKSSYLGPMDCLKKTIKNEGIMGLYKGIESTM----WR 182

Query: 84  GACKYGGYEYFKQTYSNLLSPETAHRHRTAVYLCASASAEFLADILLCPWEAIKVKQQTT 143
            A   GGY        N +        +T   L A A    +  +L  P++ +K + Q+ 
Sbjct: 183 NALWNGGYFGVIYQVRNSMPVAKTKGQKTRNDLIAGAIGGTVGTMLNTPFDVVKSRIQSV 242

Query: 144 --IPPFCKNF---LEGWSKITAAEGLSGLYKGITPLWCRQIP 180
             +    K +   L     I   EG   LYKG  P  CR  P
Sbjct: 243 DAVSSAVKKYNWCLPSLLVIYREEGFRALYKGFVPKVCRLAP 284

>KLLA0D07073g 606857..607750 similar to sp|Q03028 Saccharomyces
           cerevisiae YPL134c ODC1, start by similarity
          Length = 297

 Score = 69.7 bits (169), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 70/292 (23%), Positives = 125/292 (42%), Gaps = 32/292 (10%)

Query: 1   MSTKQPIPLFSPEYYAACTLGGVVACGPTHSSVTPLDLVKCRLQVN------PQLYRSNL 54
           MS ++P+P      +    + G VA       + PLD+VK  +Q+       PQ Y+   
Sbjct: 1   MSDQKPLP------FVYQFMAGAVAGVSEILVMYPLDMVKTVMQLQVSGGSGPQ-YKGVF 53

Query: 55  DGWKTIVRSEGLSKVFTGVGATFIGYSLQGACKYGGYEYFKQTYSNLLSPETAHRHRTAV 114
           D  K I   EG S+++ G+ +  +  + + A K+   + F++ Y +L     A +    +
Sbjct: 54  DCLKQIAAKEGPSRLYKGISSPILMEAPKRATKFACNDEFQKIYKDLFG---AEKLTQPL 110

Query: 115 YLCASASAEFLADILLCPWEAIKVKQQTTIPPFCKNFLEGWSKITAAEGLSGLYKGITPL 174
            + + ASA      ++ P+E +K++ Q     F    +     I   EG+  +Y G+   
Sbjct: 111 SILSGASAGICESFVVVPFELVKIRLQDVSSKFTSP-IAVVKNIVEKEGILAMYNGLEST 169

Query: 175 WCRQIPYTMCKFTSFERIVEMIYAKLPRSKQEMSPSQQIGVSFVGGYLAGILCAVVSHPA 234
             R   +    F     I+  + A LP++  +   S+Q     + G + G L +++S P 
Sbjct: 170 MWRHGIWNAGYFG----IIFQVRALLPKASTK---SEQTRNDLLAGTVGGTLSSLLSTPF 222

Query: 235 DVMVSKVN-------ADRKQGESMVEASKRIYSRIGFGGLWNGLPVRIFMIG 279
           DV+ S+V          RK   S   A   IY   GF  L+ G   ++  +G
Sbjct: 223 DVVKSRVQNTAVIPGVPRKYNWSW-PALATIYKEEGFKALYKGFVPKVLRLG 273

>KLLA0E23705g complement(2099965..2101071) highly similar to
           sp|P38127 Saccharomyces cerevisiae YBR192w RIM2
           mitochondrial carrier protein (MCF), start by similarity
          Length = 368

 Score = 68.6 bits (166), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 47/195 (24%), Positives = 96/195 (49%), Gaps = 19/195 (9%)

Query: 20  LGGVVACGPTHSSVTPLDLVKCRLQVNP---QLYRSNLDGWKTIVRSEGLSKVFTGVGAT 76
           L    A   T +   P+ LVK RLQ++    + Y+++LD  K++V++EG+  ++ G+ A+
Sbjct: 174 LAAATAGWATSTVTNPIWLVKTRLQLDKAGTKTYKNSLDCIKSVVKNEGVLGLYKGLSAS 233

Query: 77  FIGYSLQGACKYGGYEYFKQTYSNLLSPETAHRHRTAVYLC-----------ASASAEFL 125
           ++G S++G  ++  YE  K+        +  H H  A               ++  A+F+
Sbjct: 234 YLG-SVEGILQWILYEQMKRIIKERSIEKFGHIHEDAKSTSDKVKEWCQRSGSAGLAKFV 292

Query: 126 ADILLCPWEAIKVKQQTTIPPFCK----NFLEGWSKITAAEGLSGLYKGITPLWCRQIPY 181
           A I+  P E ++ + +       K      ++ +  I   EGL  +Y G+TP   R +P 
Sbjct: 293 ASIVTYPHEVVRTRLRQAPTENGKLKYTGLVQSFRVIIKEEGLVSMYSGLTPHLLRTVPN 352

Query: 182 TMCKFTSFERIVEMI 196
           ++  F ++E +++++
Sbjct: 353 SIIMFGTWELVIKLL 367

 Score = 40.8 bits (94), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 53/244 (21%), Positives = 99/244 (40%), Gaps = 25/244 (10%)

Query: 59  TIVRSEGLSKVFTGVGATFIGYSLQGACKYGGYEYFKQTYSNLLSPETAHRHRTAVYLCA 118
            + R EG   +F G+G   +G     +  +  Y   K  YS  L+     +    ++L A
Sbjct: 119 NVYRQEGFRSLFKGLGPNLVGVIPARSINFLTYGTTKDIYSRTLN---NGQEAPWIHLLA 175

Query: 119 SASAEFLADILLCPWEAIKVKQQTTIP--PFCKNFLEGWSKITAAEGLSGLYKGITPLW- 175
           +A+A +    +  P   +K + Q         KN L+    +   EG+ GLYKG++  + 
Sbjct: 176 AATAGWATSTVTNPIWLVKTRLQLDKAGTKTYKNSLDCIKSVVKNEGVLGLYKGLSASYL 235

Query: 176 ------CRQIPYTMCKFTSFERIVEMIYAKLPRSKQEMSPSQQIGVSFVGGYLAGILCAV 229
                  + I Y   K    ER +E        +K      ++         LA  + ++
Sbjct: 236 GSVEGILQWILYEQMKRIIKERSIEKFGHIHEDAKSTSDKVKEWCQRSGSAGLAKFVASI 295

Query: 230 VSHPADVMVSKV-NADRKQGE----SMVEASKRIYSRIGFGGLWNGL--------PVRIF 276
           V++P +V+ +++  A  + G+     +V++ + I    G   +++GL        P  I 
Sbjct: 296 VTYPHEVVRTRLRQAPTENGKLKYTGLVQSFRVIIKEEGLVSMYSGLTPHLLRTVPNSII 355

Query: 277 MIGT 280
           M GT
Sbjct: 356 MFGT 359

>YBR291C (CTP1) [469] chr2 complement(783631..784530) Mitochondrial
           inner membrane citrate transport protein, member of the
           mitochondrial carrier family (MCF) of membrane
           transporters [900 bp, 299 aa]
          Length = 299

 Score = 67.8 bits (164), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 60/270 (22%), Positives = 117/270 (43%), Gaps = 23/270 (8%)

Query: 20  LGGVVACGPTHSSVT-PLDLVKCRLQVNPQLYRSNLDGWKTI---VRSEGLSKVFTGVGA 75
           L G +A G   + +T P +  K RLQ+  +  +++ +    I    +++G+  ++ G  A
Sbjct: 17  LAGSLA-GAAEACITYPFEFAKTRLQLIDKASKASRNPLVLIYKTAKTQGIGSIYVGCPA 75

Query: 76  TFIGYSLQGACKYGGYEYFKQTYSNLLSPETAHRHRTAVYLCASASAEFLADILLCPWEA 135
             IG + +   ++ G++  K     L   ET     T   +    +    +   + P+EA
Sbjct: 76  FIIGNTAKAGIRFLGFDTIKDM---LRDSETGELSGTRGVIAGLGAGLLESVAAVTPFEA 132

Query: 136 IKV----KQQTTIPPFCKN---FLEGWSKITAAEGLSGLYKGITPLWCRQIPYTMCKFTS 188
           IK      +Q+  P +  N    +  +S +   +G SGLY+G+ P+  RQ      +   
Sbjct: 133 IKTALIDDKQSATPKYHNNGRGVVRNYSSLVRDKGFSGLYRGVLPVSMRQAANQAVRLGC 192

Query: 189 FERIVEMI--YAKLPRSKQEMSPSQQIGVSFVGGYLAGILCAVVSHPADVMVSKVNA-DR 245
           + +I  +I  Y   P+ K   S     G++F+ G  +GI+    + P D + +++ + D 
Sbjct: 193 YNKIKTLIQDYTDSPKDKPLSS-----GLTFLVGAFSGIVTVYSTMPLDTVKTRMQSLDS 247

Query: 246 KQGESMVEASKRIYSRIGFGGLWNGLPVRI 275
            +  S +     I+   G    W G   R+
Sbjct: 248 TKYSSTMNCFATIFKEEGLKTFWKGATPRL 277

 Score = 41.6 bits (96), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 41/177 (23%), Positives = 77/177 (43%), Gaps = 14/177 (7%)

Query: 31  SSVTPLDLVKCRLQVNPQ----LYRSNLDG----WKTIVRSEGLSKVFTGVGATFIGYSL 82
           ++VTP + +K  L  + Q     Y +N  G    + ++VR +G S ++ GV    +  + 
Sbjct: 125 AAVTPFEAIKTALIDDKQSATPKYHNNGRGVVRNYSSLVRDKGFSGLYRGVLPVSMRQAA 184

Query: 83  QGACKYGGYEYFK---QTYSNLLSPETAHRHRTAVYLCASASAEFLADILLCPWEAIKVK 139
             A + G Y   K   Q Y++  SP+         +L  + S   +      P + +K +
Sbjct: 185 NQAVRLGCYNKIKTLIQDYTD--SPKDKPLSSGLTFLVGAFSG-IVTVYSTMPLDTVKTR 241

Query: 140 QQTTIPPFCKNFLEGWSKITAAEGLSGLYKGITPLWCRQIPYTMCKFTSFERIVEMI 196
            Q+       + +  ++ I   EGL   +KG TP   R +      FT +E+++ M+
Sbjct: 242 MQSLDSTKYSSTMNCFATIFKEEGLKTFWKGATPRLGRLVLSGGIVFTIYEKVLVML 298

>YMR166C (YMR166C) [4121] chr13 complement(593366..594472) Member of
           the mitochondrial carrier (MCF) protein family of
           membrane transporters [1107 bp, 368 aa]
          Length = 368

 Score = 67.8 bits (164), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 57/245 (23%), Positives = 105/245 (42%), Gaps = 19/245 (7%)

Query: 18  CTLGGVVACGPTHSSVTPLDLVKCRLQVNPQL--YRSNLDGWKTIVRSEGLSK-VFTGVG 74
           C + G +      S++  LD VK R Q  P +  YR+ +  ++TI   EG+ + ++ G  
Sbjct: 56  CVVSGGIGGKIGDSAMHSLDTVKTRQQGAPNVKKYRNMISAYRTIWLEEGVRRGLYGGYM 115

Query: 75  ATFIGYSLQGACKYGGYEYFKQTYSNLLSPETAHRHRTAVYLCASASAEFLADILLCPWE 134
           A  +G     A  +G YEY K+T       E    + T  +L A    +F++  +  P E
Sbjct: 116 AAMLGSFPSAAIFFGTYEYTKRTMI-----EDWQINDTITHLSAGFLGDFISSFVYVPSE 170

Query: 135 AIKVKQQTT---IPPFCK------NFLEGWSKITAAEGLSGLYKGITPLWCRQIPYTMCK 185
            +K + Q       PF +      N       +   EG   L+ G      R +P++  +
Sbjct: 171 VLKTRLQLQGRFNNPFFQSGYNYSNLRNAIKTVIKEEGFRSLFFGYKATLARDLPFSALQ 230

Query: 186 FTSFERIVEMIYAKLPRSKQEMSPSQQIGVSFVGGYLAGILCAVVSHPADVMVSKVNADR 245
           F  +E+  ++ +    +  ++   S  I    + G  AG L  +++ P DV+ ++V   +
Sbjct: 231 FAFYEKFRQLAFKIEQKDGRDGELS--IPNEILTGACAGGLAGIITTPMDVVKTRVQTQQ 288

Query: 246 KQGES 250
              +S
Sbjct: 289 PPSQS 293

 Score = 38.5 bits (88), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 33/127 (25%), Positives = 54/127 (42%), Gaps = 11/127 (8%)

Query: 35  PLDLVKCRLQVNPQLYR---------SNL-DGWKTIVRSEGLSKVFTGVGATFIGYSLQG 84
           P +++K RLQ+  +            SNL +  KT+++ EG   +F G  AT        
Sbjct: 168 PSEVLKTRLQLQGRFNNPFFQSGYNYSNLRNAIKTVIKEEGFRSLFFGYKATLARDLPFS 227

Query: 85  ACKYGGYEYFKQTYSNLLSPETAHRHRT-AVYLCASASAEFLADILLCPWEAIKVKQQTT 143
           A ++  YE F+Q    +   +      +    +   A A  LA I+  P + +K + QT 
Sbjct: 228 ALQFAFYEKFRQLAFKIEQKDGRDGELSIPNEILTGACAGGLAGIITTPMDVVKTRVQTQ 287

Query: 144 IPPFCKN 150
            PP   N
Sbjct: 288 QPPSQSN 294

 Score = 30.0 bits (66), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 24/89 (26%), Positives = 36/89 (40%), Gaps = 22/89 (24%)

Query: 20  LGGVVACGPTHSSVTPLDLVKCRLQVNPQLYRSNLD----------------------GW 57
           L G  A G      TP+D+VK R+Q      +SN                          
Sbjct: 261 LTGACAGGLAGIITTPMDVVKTRVQTQQPPSQSNKSYSVTHPHVTNGRPAALSNSISLSL 320

Query: 58  KTIVRSEGLSKVFTGVGATFIGYSLQGAC 86
           +T+ +SEG+   F+GVG  F+  S+Q + 
Sbjct: 321 RTVYQSEGVLGFFSGVGPRFVWTSVQSSI 349

>AFL196W [2999] [Homologous to ScYMR166C - SH]
           complement(66955..68040) [1086 bp, 361 aa]
          Length = 361

 Score = 67.4 bits (163), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 70/312 (22%), Positives = 125/312 (40%), Gaps = 35/312 (11%)

Query: 5   QPIPLFSPEYYAACTLGGVVACGPTHSSVTPLDLVKCRLQVNPQ--LYRSNLDGWKTIVR 62
           +P    SP  +  C L G +      S +  LD VK R Q  P    YR  +  ++T+  
Sbjct: 45  EPSSAHSPLLH--CVLAGGIGGAIGDSVMHSLDTVKTRQQGAPGEVKYRHMISAYRTLAL 102

Query: 63  SEGLSK-VFTGVGATFIGYSLQGACKYGGYEYFKQTYSNLLSPETAHRHRTAVYLCASAS 121
            EG+ + ++ G GA  +G     A  +G YE+ K+   N         H T  +L A   
Sbjct: 103 EEGVRRGLYGGYGAAMLGSFPSAAVFFGTYEWVKRQMIN-----EWQIHETYSHLAAGFL 157

Query: 122 AEFLADILLCPWEAIKVKQQTTIPPFCKNFLEGWS---------KITAAEGLSGLYKGIT 172
            +  + ++  P E +K + Q       ++F  G++          I   EG+S L+ G  
Sbjct: 158 GDLFSSVVYVPSEVLKTRLQLQGCYNNRHFQSGYNYRGLSDAVRTIVRTEGVSALFFGYK 217

Query: 173 PLWCRQIPYTMCKFTSFERIVEMIYAKLPRSKQEMSPSQQIGVSFVGGYLAGILCAVVSH 232
               R +P++  +F  +ER  +  +      ++ +          V G  AG L  +++ 
Sbjct: 218 ATLSRDLPFSALQFAFYERFRKWAFLL---ERKPVDGHLSFTAEVVTGASAGGLAGIITT 274

Query: 233 PADVMVSKVNADRKQGESMVEAS--KRIYSRI-----------GFGGLWNGLPVRIFMIG 279
           P DV+ +++    +      +AS   R+   I           G GG ++G+  R     
Sbjct: 275 PLDVVKTRIQTQPRGSAGTPDASAPARLNGSIFRSLLVVLRYEGLGGAFSGVGPRFIWTS 334

Query: 280 TLTSFQWLIYDS 291
             +S   L+Y +
Sbjct: 335 IQSSIMLLLYQT 346

>YKR052C (MRS4) [3303] chr11 complement(532192..533106) Member of
           the mitochondrial carrier (MCF) family of membrane
           transporters, overexpression suppresses defects in
           splicing of mitochondrial introns [915 bp, 304 aa]
          Length = 304

 Score = 66.2 bits (160), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 69/292 (23%), Positives = 113/292 (38%), Gaps = 33/292 (11%)

Query: 20  LGGVVACGPTHSSVTPLDLVKCRLQ---VNPQLYRSNLDGWKTIVRSEGLSKVFTGVGAT 76
           L G  A    HS + P+D +K R+Q   +N       +     I   EG   ++ GV + 
Sbjct: 28  LAGAFAGIMEHSLMFPIDALKTRVQAAGLNKAASTGMISQISKISTMEGSMALWKGVQSV 87

Query: 77  FIGYSLQGACKYGGYEYFKQTYSNLLSPETAHRHRTAVYLCASASAEFLADILLCPWEAI 136
            +G     A  +G YE+ K   + L+SPE    H+      +   A   AD L+ P++ +
Sbjct: 88  ILGAGPAHAVYFGTYEFCK---ARLISPEDMQTHQPMKTALSGTIATIAADALMNPFDTV 144

Query: 137 KVKQQTTIPPFCKNFLEGWS---KITAAEGLSGLYKGITPLWCRQIPYTMCKFTSFERIV 193
           K + Q          L  W+   +I   EG +  Y          IP+    F  +E   
Sbjct: 145 KQRLQ------LDTNLRVWNVTKQIYQNEGFAAFYYSYPTTLAMNIPFAAFNFMIYESA- 197

Query: 194 EMIYAKLPRSKQEMSPSQQIGVSFVGGYLAGILCAVVSHPADVM--VSKVNADR------ 245
               +K    +   +P     +  + G ++G  CA ++ P D +  V +V          
Sbjct: 198 ----SKFFNPQNSYNPL----IHCLCGGISGATCAALTTPLDCIKTVLQVRGSETVSIEI 249

Query: 246 -KQGESMVEASKRIYSRIGFGGLWNGLPVRIFMIGTLTSFQWLIYDSFKAYI 296
            K   +   AS+ I    G+ G W GL  RI      T+  W  Y+  K ++
Sbjct: 250 MKDANTFGRASRAILEVHGWKGFWRGLKPRIVANIPATAISWTAYECAKHFL 301

>KLLA0F03212g 302915..303832 highly similar to sp|P33303
           Saccharomyces cerevisiae YJR095w ACR1 succinate-fumarate
           transporter, start by similarity
          Length = 305

 Score = 66.2 bits (160), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 65/276 (23%), Positives = 118/276 (42%), Gaps = 33/276 (11%)

Query: 35  PLDLVKCRLQVNPQLYRSNLDG---WKT---IVRSEGLSKVFTGVGATFIGYSLQGACKY 88
           PLD +K R+Q+      S +      KT   I R+EG    + G+GA  IG + + A ++
Sbjct: 30  PLDTIKVRMQIYKNAVGSGVKAPGFIKTGGEIYRNEGFLAFYKGLGAVVIGITPKMAIRF 89

Query: 89  GGYEYFKQTYSNLLSPETAHRHRTAVYLCASASA---EFLADILLCPWEAIKVKQQTTIP 145
             YE+    Y  LL+ +   +  T     A   A   E +  +       I+++ Q   P
Sbjct: 90  SSYEF----YRTLLADKETGKVSTGNTFIAGVGAGITEAVVVVNPMEVVKIRLQAQHLNP 145

Query: 146 ----PFCKNFLEGWSKITAAEGLSGLYKGITPLWCRQIPYTMCKFTSFERIVEMIYAKLP 201
               P  KN ++    I   EG S LY+G++    RQ       FT + ++ E +     
Sbjct: 146 VEGAPKYKNAVQACYTIVKEEGFSALYRGVSLTAARQATNQGANFTVYSKLKEFLQG--- 202

Query: 202 RSKQEMSPSQQIGVSFVGGYLAGILCAVVSHPADVMVSKVNADRKQG-----ESMVEASK 256
              QEM PS +   S + G ++G +    + P D + +++  D+        + +    K
Sbjct: 203 YHNQEMLPSWE--TSLI-GLISGAIGPFSNAPLDTIKTRLQKDKSTKNMSGLKRITIIGK 259

Query: 257 RIYSRIGFGGLWNGLPVRIFMIG-----TLTSFQWL 287
           ++    GF  L+ G+  R+  +      T T+++++
Sbjct: 260 QLIQEEGFRALYKGITPRVMRVAPGQAVTFTAYEFI 295

>CAGL0L02079g 243467..244360 highly similar to sp|P38152
           Saccharomyces cerevisiae YBR291c CTP1 citrate transport
           protein, hypothetical start
          Length = 297

 Score = 66.2 bits (160), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 62/286 (21%), Positives = 120/286 (41%), Gaps = 24/286 (8%)

Query: 26  CGPTHSSVT-PLDLVKCRLQV---NPQLYRSNLDGWKTIVRSEGLSKVFTGVGATFIGYS 81
            G   +S+T P +  K RLQ+   + +  R+ L       +++G+  ++ G  A  +G +
Sbjct: 20  AGAVEASITYPFEFAKTRLQLIDKSSKASRNPLVLIYNTAKTQGVGAIYVGCPAFIVGNT 79

Query: 82  LQGACKYGGYEYFKQTYSNLLSPETAHRHRTAVYLCASASAEFLADIL-LCPWEAIKV-- 138
            + A ++ GY+    T  NLL  +          + A   A  L  ++ + P+EAIK   
Sbjct: 80  AKAATRFLGYD----TIRNLLKDKKTGELSGPRGVLAGLGAGLLESVVAVTPFEAIKTVL 135

Query: 139 --KQQTTIPPFCKN---FLEGWSKITAAEGLSGLYKGITPLWCRQIPYTMCKFTSFERIV 193
              +Q+  P +  N       +  +   EG  GLY G+ P+  RQ      +   + +I 
Sbjct: 136 IDDKQSVRPKYQNNGRSMARNYISLVKDEGFRGLYGGVLPVSMRQAANQAVRLGCYNKIK 195

Query: 194 EMI--YAKLPRSKQEMSPSQQIGVSFVGGYLAGILCAVVSHPADVMVSKVNA-DRKQGES 250
            ++  Y   P+ K   S     G++F+ G  +G++    + P D + +++ +    +  S
Sbjct: 196 VLVQDYTGAPKDKPLTS-----GLTFIVGAFSGVVTVYATMPIDTVKTRMQSLTASKYSS 250

Query: 251 MVEASKRIYSRIGFGGLWNGLPVRIFMIGTLTSFQWLIYDSFKAYI 296
            +     IY   G    W G   R+  +       + IY++   Y+
Sbjct: 251 TLNCFTTIYKEEGLKTFWKGATPRLGRLILSGGIVFTIYENVLLYL 296

 Score = 28.9 bits (63), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 23/106 (21%), Positives = 49/106 (46%), Gaps = 7/106 (6%)

Query: 200 LPRSKQEMSPSQQIGVSFVGGYLAGILCAVVSHPADVMVSKVNADRKQGESMVEASKRIY 259
           + +  +++ P++    SFV G LAG + A +++P +   +++    K  ++       IY
Sbjct: 1   MSKDSKKVDPTK----SFVAGALAGAVEASITYPFEFAKTRLQLIDKSSKASRNPLVLIY 56

Query: 260 SRI---GFGGLWNGLPVRIFMIGTLTSFQWLIYDSFKAYIGLPTTG 302
           +     G G ++ G P  I       + ++L YD+ +  +    TG
Sbjct: 57  NTAKTQGVGAIYVGCPAFIVGNTAKAATRFLGYDTIRNLLKDKKTG 102

>AGL311C [4001] [Homologous to ScYJR095W (SFC1) - SH]
           (119645..120733) [1089 bp, 362 aa]
          Length = 362

 Score = 65.1 bits (157), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 60/285 (21%), Positives = 117/285 (41%), Gaps = 39/285 (13%)

Query: 35  PLDLVKCRLQVNPQLYRSNLDGWK---------TIVRSEGLSKVFTGVGATFIGYSLQGA 85
           PLD +K R+Q+    YR   +G K          I   EGL   + G+GA  IG   + A
Sbjct: 77  PLDTIKVRMQI----YRRANEGTKPPGFLRTGANIYSGEGLLAFYKGLGAVVIGIIPKMA 132

Query: 86  CKYGGYEYFKQTYSNLLSPETAHRHRTAVYLCASASAEFLADILLCPWEAIKVKQQ---- 141
            ++  YE+++   + L   +T        +L    +    A +++ P E +K++ Q    
Sbjct: 133 IRFSSYEFYR---TLLADRQTGVVSTGNTFLAGVGAGVTEAVLVVNPMEVVKIRLQAQHL 189

Query: 142 --TTIPPFCKNFLEGWSKITAAEGLSGLYKGITPLWCRQIPYTMCKFTSFERIVEMIYAK 199
                    +N ++    I   EG+  LY+G++    RQ       FT        +Y+K
Sbjct: 190 HGAAEQQKYRNAIQAAYLIVKEEGIGALYRGVSLTAARQATNQGANFT--------VYSK 241

Query: 200 LPRSKQEMSPSQQI---GVSFVGGYLAGILCAVVSHPADVMVSKVNADRKQGE-----SM 251
           L    QE   SQ +     S + G ++G +    + P D + +++  D+          +
Sbjct: 242 LMERLQEYHGSQNLPSWETSLI-GLVSGAIGPFSNAPLDTIKTRLQKDKSTRNLSNWVRI 300

Query: 252 VEASKRIYSRIGFGGLWNGLPVRIFMIGTLTSFQWLIYDSFKAYI 296
               +++    GF  L+ G+  R+  +    +  + +Y+  + ++
Sbjct: 301 TTIGRQLVQEEGFRALYKGITPRVMRVAPGQAVTFTVYEFVRRHL 345

 Score = 48.1 bits (113), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 54/185 (29%), Positives = 75/185 (40%), Gaps = 46/185 (24%)

Query: 33  VTPLDLVKCRLQVN-------PQLYRSNLDGWKTIVRSEGLSKVFTGV-----------G 74
           V P+++VK RLQ          Q YR+ +     IV+ EG+  ++ GV           G
Sbjct: 174 VNPMEVVKIRLQAQHLHGAAEQQKYRNAIQAAYLIVKEEGIGALYRGVSLTAARQATNQG 233

Query: 75  ATFIGYS--LQGACKYGGYEYFKQTYSNLLSPETAHRHRTAVYLCASASAEFLADILLCP 132
           A F  YS  ++   +Y G +       NL S ET     + + L + A   F       P
Sbjct: 234 ANFTVYSKLMERLQEYHGSQ-------NLPSWET-----SLIGLVSGAIGPFSN----AP 277

Query: 133 WEAIKVKQQTTIPPFCKNFLEGWSKITA-------AEGLSGLYKGITPLWCRQIPYTMCK 185
            + IK + Q       +N L  W +IT         EG   LYKGITP   R  P     
Sbjct: 278 LDTIKTRLQKD--KSTRN-LSNWVRITTIGRQLVQEEGFRALYKGITPRVMRVAPGQAVT 334

Query: 186 FTSFE 190
           FT +E
Sbjct: 335 FTVYE 339

 Score = 30.0 bits (66), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 24/105 (22%), Positives = 44/105 (41%), Gaps = 9/105 (8%)

Query: 203 SKQEMSPSQQIGVSFVGGYLAGILCAVVSHPADVMVSKVNADRKQGE-----SMVEASKR 257
           SK+  +P+    V+ V G  AG+  A+  HP D +  ++   R+  E       +     
Sbjct: 51  SKKSTNPA----VNLVAGGTAGLFEALCCHPLDTIKVRMQIYRRANEGTKPPGFLRTGAN 106

Query: 258 IYSRIGFGGLWNGLPVRIFMIGTLTSFQWLIYDSFKAYIGLPTTG 302
           IYS  G    + GL   +  I    + ++  Y+ ++  +    TG
Sbjct: 107 IYSGEGLLAFYKGLGAVVIGIIPKMAIRFSSYEFYRTLLADRQTG 151

>Scas_721.129
          Length = 323

 Score = 64.7 bits (156), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 71/302 (23%), Positives = 126/302 (41%), Gaps = 52/302 (17%)

Query: 15  YAACTLGGVVACGPTHSSVTPLDLVKCRLQVNPQL-------YRSNLDGWKTIVRSEGLS 67
           + +   GG+ AC    +   P++LVK R+Q+  +L       YR+ + G   I R+EG+ 
Sbjct: 22  FGSFIAGGMAACIAV-TFTNPIELVKIRMQLQGELAAVGQKVYRNPIQGMGVIFRNEGIR 80

Query: 68  KVFTGVGATFIGYSLQGACKYGGYEYFKQTYSNLLSP-ETAHR-HRTAVYLCASASAEFL 125
            +  G+ A +I        + G YE  +   ++   P E +H+  + ++ + A AS+  +
Sbjct: 81  GLQKGLVAAYIYQIGLNGSRLGFYEPIRNALNSTFYPNEESHKIQKVSINVAAGASSGII 140

Query: 126 ADILLCPW-----------EAIKVKQQTTIPPFCKNFLEGWSKITAAEGLSGLYKGITPL 174
             ++  P            +AIK+ +QT      +N   G S I   EG  GL++GI   
Sbjct: 141 GAVIGSPLFLVKTRMQSYSDAIKIGEQT----HYRNVWNGLSTIARTEGFKGLFRGIDAA 196

Query: 175 WCRQIPYTMCKFTSFERIVEMIYAKLPRSKQEMSPSQQIGVSFVGGYLAGILCAVVSHPA 234
             R    +  +   +      +   L     +  P    G+      ++G+  AVV +P 
Sbjct: 197 ILRTGAGSSVQLPIYNTAKNFL---LKNDLMKDGP----GLHLTASTISGLGVAVVMNPW 249

Query: 235 DVMVSKVNADRKQGESMVEASKRIYSRIGFGGLWNGLPVRIFMIGTLTSFQWLIYDSFKA 294
           DV+++                 RIY++   G L+ G PV  F+    T     +Y  F+A
Sbjct: 250 DVILT-----------------RIYNQ--KGNLYKG-PVDCFVKTVRTEGISALYKGFQA 289

Query: 295 YI 296
            I
Sbjct: 290 QI 291

 Score = 59.7 bits (143), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 44/173 (25%), Positives = 76/173 (43%), Gaps = 12/173 (6%)

Query: 34  TPLDLVKCRLQ-------VNPQL-YRSNLDGWKTIVRSEGLSKVFTGVGATFIGYSLQGA 85
           +PL LVK R+Q       +  Q  YR+  +G  TI R+EG   +F G+ A  +      +
Sbjct: 146 SPLFLVKTRMQSYSDAIKIGEQTHYRNVWNGLSTIARTEGFKGLFRGIDAAILRTGAGSS 205

Query: 86  CKYGGYEYFKQTYSNLLSPETAHRHRTAVYLCASASAEFLADILLCPWEAIKVKQQTTIP 145
            +   Y     T  N L      +    ++L AS  +     +++ PW+ I  +      
Sbjct: 206 VQLPIYN----TAKNFLLKNDLMKDGPGLHLTASTISGLGVAVVMNPWDVILTRIYNQKG 261

Query: 146 PFCKNFLEGWSKITAAEGLSGLYKGITPLWCRQIPYTMCKFTSFERIVEMIYA 198
              K  ++ + K    EG+S LYKG      R  P+T+   T  E+ ++++Y+
Sbjct: 262 NLYKGPVDCFVKTVRTEGISALYKGFQAQILRIAPHTIICLTFMEQTMKLVYS 314

>KLLA0B12826g 1121106..1122065 similar to sp|P32332 Saccharomyces
           cerevisiae YKL120w PMT, start by similarity
          Length = 319

 Score = 64.7 bits (156), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 56/203 (27%), Positives = 86/203 (42%), Gaps = 17/203 (8%)

Query: 13  EYYAACTLGGVVACGPTHSSV-----TPLDLVKCRLQ-------VNPQL-YRSNLDGWKT 59
           E +    +G  VA G T   V     +PL LVK R+Q       +  Q  Y S  +G  T
Sbjct: 119 ESHKVQHIGINVAAGATSGVVGAFIGSPLFLVKTRMQSYSNAIHIGQQTHYTSAFNGLAT 178

Query: 60  IVRSEGLSKVFTGVGATFIGYSLQGACKYGGYEYFKQTYSNLLSPETAHRHRTAVYLCAS 119
           I RSEG+  +F GV A  +   +  A +   Y   K    N L         T ++L +S
Sbjct: 179 IFRSEGIKGLFRGVDAAMLRTGIGSAVQLPIYNICK----NFLLKHDLMNDGTGLHLLSS 234

Query: 120 ASAEFLADILLCPWEAIKVKQQTTIPPFCKNFLEGWSKITAAEGLSGLYKGITPLWCRQI 179
             A F   + + PW+ +  +            ++ + K    EGLS LYKG      R  
Sbjct: 235 TIAGFGVGVAMNPWDVVLTRVYNQKGNLYSGPIDCFIKTVRNEGLSALYKGFGAQILRIG 294

Query: 180 PYTMCKFTSFERIVEMIYAKLPR 202
           P+T+   T  E+ ++++Y+   R
Sbjct: 295 PHTVLCLTFMEQTLKLVYSVESR 317

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 42/213 (19%), Positives = 82/213 (38%), Gaps = 22/213 (10%)

Query: 105 ETAHRHRTAVY-------LCASASAEFLADILLCPWEAIKVKQQ------TTIPPFCKNF 151
           E  H  +TA +         A   A  +A  +  P++ +K + Q              N 
Sbjct: 6   EEKHNQKTAAHKVSKFGSFVAGGLAACIAVTVTNPFDCVKTRMQLQGELHANAAKVYTNP 65

Query: 152 LEGWSKITAAEGLSGLYKGITPLWCRQIPYTMCKFTSFERIVEMIYAKLPRSKQEMSPSQ 211
           ++ +  I   EG++GL KG+   +  QI     +   +E I   I   +     E    Q
Sbjct: 66  IQAFGVIFKNEGIAGLQKGLASAYLYQIALNGSRLGFYEPI-RGILNNVFYPNVESHKVQ 124

Query: 212 QIGVSFVGGYLAGILCAVVSHPADVMVSKVNA--------DRKQGESMVEASKRIYSRIG 263
            IG++   G  +G++ A +  P  ++ +++ +         +    S       I+   G
Sbjct: 125 HIGINVAAGATSGVVGAFIGSPLFLVKTRMQSYSNAIHIGQQTHYTSAFNGLATIFRSEG 184

Query: 264 FGGLWNGLPVRIFMIGTLTSFQWLIYDSFKAYI 296
             GL+ G+   +   G  ++ Q  IY+  K ++
Sbjct: 185 IKGLFRGVDAAMLRTGIGSAVQLPIYNICKNFL 217

>CAGL0G08910g complement(853693..854562) similar to sp|P40464
           Saccharomyces cerevisiae YIL134w FLX1, hypothetical
           start
          Length = 289

 Score = 64.3 bits (155), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 72/292 (24%), Positives = 126/292 (43%), Gaps = 30/292 (10%)

Query: 20  LGGVVACGPTHSSVTPLDLVKCRLQV-----NPQLYRSNLDGWKTIVRSE-GLSK-VFTG 72
           + G+ A   T   V PLDL K RLQ+       + YR NL  W  IV S+  L++ ++ G
Sbjct: 13  ISGLTAGSVTTLIVHPLDLFKVRLQLLITSTTKKGYR-NL--WSEIVGSDLSLTRELYRG 69

Query: 73  VGATFIGYSLQGACKYGGYEYFKQTYSNLLSPETAHRHRTA------VYLCASASAEFLA 126
           +    +G ++     +  Y   K    N       HR R        +YL ASAS+  L 
Sbjct: 70  LTVNLVGNTIAWGLYFASYRVAKDYLINY-----NHRIRNDKDLSSWMYLSASASSGMLT 124

Query: 127 DILLCPWEAIKVKQQTTIPPFCKNFLEGWSKITAAEGLSGLYKGITPLWCRQIPYTMCKF 186
            +L  P   IK +  +       + ++    +   +G+ GL+KG+ P     +      F
Sbjct: 125 TVLTNPLWVIKTRMMSKANSDLTS-MKVLRDLIKNDGVQGLWKGLVPALV-GVSQGALHF 182

Query: 187 TSFERIVEMIYAKLPRSKQEMSPSQQIGVSFVGGYLAGILCAVVSHPADVMVSKVNADRK 246
           T ++ +   +  K  R   E++  + I V+ V    + +L     +P  ++ S + + + 
Sbjct: 183 TCYDTLKHKLVLK-NRDSDEITNLETIAVTSV----SKMLSTSAVYPFQLLKSNLQSFQA 237

Query: 247 QGES--MVEASKRIYSRIGFGGLWNGLPVRIFMIGTLTSFQWLIYDSFKAYI 296
                 ++  SK IYSR G  G + GL   +      T   + IY++FK+++
Sbjct: 238 SENDFKLLPLSKMIYSRSGLLGFYKGLSANLLRSVPSTCITFCIYENFKSFL 289

>Kwal_33.14050
          Length = 314

 Score = 64.3 bits (155), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 66/286 (23%), Positives = 114/286 (39%), Gaps = 38/286 (13%)

Query: 30  HSSVTPLDLVKCRLQV----------NPQLYRSNLDGWKTIVRSEGLSKVFTGVGATFIG 79
           HS + P+D +K R+Q             +L  + +     I  +EG   ++ GV +  +G
Sbjct: 31  HSIMFPIDAIKTRMQALSATIGSANAAAKLPSNIVQQIARISTTEGSMALWKGVQSVILG 90

Query: 80  YSLQGACKYGGYEYFKQTYSNLLSPETAHRHRTAVYLCASASAEFLADILLCPWEAIKVK 139
                A  +  YE  K   S L+ P+    H+      +  +A   AD+L+ P++ IK +
Sbjct: 91  AGPAHAVYFATYEMCK---SYLIDPQDFQTHQPLKTAASGIAATVAADLLMNPFDTIKQR 147

Query: 140 QQTTIPPFCKNFLEGWS---KITAAEGLSGLYKGITPLWCRQIPYTMCKFTSFERIVEMI 196
            Q  +  F K+ +  WS   +I   EGL+  +          IP+    F  +E      
Sbjct: 148 MQ--LRTFSKDRM--WSVASRIYRNEGLAAFFYSYPTTIAMNIPFAAFNFAIYESAT--- 200

Query: 197 YAKLPRSKQEMSPSQQIGVSFVGGYLAGILCAVVSHPADVM---------VSKVNADRKQ 247
             K    +   +P     +  + G ++G  CA ++ P D +          S V+   +Q
Sbjct: 201 --KFFNPENTYNPL----IHCLCGGISGATCAAITTPLDCIKTVLQVRGSESVVDPLFRQ 254

Query: 248 GESMVEASKRIYSRIGFGGLWNGLPVRIFMIGTLTSFQWLIYDSFK 293
            ++   A+  I    G+ G W GL  RI      T+  W  Y+  K
Sbjct: 255 ADTFSRAASAISKVYGWSGFWRGLKPRIISNMPATAISWTAYECAK 300

 Score = 28.5 bits (62), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 22/93 (23%), Positives = 38/93 (40%), Gaps = 10/93 (10%)

Query: 217 FVGGYLAGILCAVVSHPADVMVSKV----------NADRKQGESMVEASKRIYSRIGFGG 266
              G  AGI+   +  P D + +++          NA  K   ++V+   RI +  G   
Sbjct: 20  LAAGAFAGIMEHSIMFPIDAIKTRMQALSATIGSANAAAKLPSNIVQQIARISTTEGSMA 79

Query: 267 LWNGLPVRIFMIGTLTSFQWLIYDSFKAYIGLP 299
           LW G+   I   G   +  +  Y+  K+Y+  P
Sbjct: 80  LWKGVQSVILGAGPAHAVYFATYEMCKSYLIDP 112

>Scas_602.8
          Length = 885

 Score = 64.7 bits (156), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 67/292 (22%), Positives = 129/292 (44%), Gaps = 22/292 (7%)

Query: 19  TLGGVVAC-GPTHSSVTPLDLVKCRLQVNPQL--YRSNLDGWKTIVRSEGLSKVFTGVGA 75
           +LG V  C G T   V P+D +K R+Q    L  Y++++D    I   EG+  +++G+G 
Sbjct: 503 SLGSVAGCIGAT--LVYPIDFIKTRMQAQRSLTKYKNSIDCLVKIFGKEGIRGLYSGLGP 560

Query: 76  TFIGYSLQGACKYGGYEYFKQTYSNLLSPETAHRHRTAVYLCASASAEFLADILLCPWEA 135
             IG + + A K    ++ +++   L+  +   +    V   A+A A     +   P E 
Sbjct: 561 QLIGVAPEKAIKLTVNDFMRKS---LVDKKGNLQLGAEVLSGATAGA--CQVVFTNPLEI 615

Query: 136 IKVKQQTTIPPFCKNFLEGWSKITAAE-----GLSGLYKGITPLWCRQIPYTMCKFTSFE 190
           +K++ Q  +     N +   S++TA +      L GLYKG+     R +P++   F ++ 
Sbjct: 616 VKIRLQ--VKSEYTNAMIPKSQLTAFQIIKELKLIGLYKGVGACLLRDVPFSAIYFPTYA 673

Query: 191 RIVEMIYAKLPRSKQEMSPSQQIGVSFVGGYLAGILCAVVSHPADVMVSKVNADRKQGES 250
            + + ++   P  K +    +   +    G LAG+  A ++ P DV+ +++  +   GE+
Sbjct: 674 HLKKNVFQFDPNDKDKRDRLKTWEL-LTAGALAGVPAAFLTTPFDVIKTRLQIEPGVGET 732

Query: 251 ----MVEASKRIYSRIGFGGLWNGLPVRIFMIGTLTSFQWLIYDSFKAYIGL 298
               ++ A + I     F   + G   R+        F    Y+ FK    +
Sbjct: 733 RYTGILHAVRTILKEESFRSFFKGGAARVMRSSPQFGFTLAAYELFKNMFNI 784

>Sklu_2431.5 YBR192W, Contig c2431 8526-9638
          Length = 370

 Score = 63.9 bits (154), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 46/196 (23%), Positives = 96/196 (48%), Gaps = 20/196 (10%)

Query: 20  LGGVVACGPTHSSVTPLDLVKCRLQVNP----QLYRSNLDGWKTIVRSEGLSKVFTGVGA 75
           +    A   T ++  P+ LVK RLQ++     + Y+++ D  K +V+ EG+  ++ G+ A
Sbjct: 175 MAAATAGWATSTATNPIWLVKTRLQLDKAGTTKKYKNSWDCLKNVVQKEGILGLYKGLSA 234

Query: 76  TFIGYSLQGACKYGGYEYFK--------QTYSNLLSPETAHRHRTAVYLCASASA---EF 124
           +++G S++G  ++  YE  K        + + N+   E +   +   +   S SA   +F
Sbjct: 235 SYLG-SVEGILQWVLYEQMKHIIKQRSMEKFGNISEVEKSTSDKIKEWCQRSGSAGLAKF 293

Query: 125 LADILLCPWEAIKVKQQTTIPPFCK----NFLEGWSKITAAEGLSGLYKGITPLWCRQIP 180
           +A I+  P E ++ + +       K      ++    I   EGL+ +Y G+TP   R +P
Sbjct: 294 VASIITYPHEVVRTRLRQAPLENGKLKYTGLVQSIRVIIKEEGLASMYGGLTPHLLRTVP 353

Query: 181 YTMCKFTSFERIVEMI 196
            ++  F ++E ++ ++
Sbjct: 354 NSIIMFGTWELVIRLL 369

 Score = 45.1 bits (105), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 53/247 (21%), Positives = 106/247 (42%), Gaps = 30/247 (12%)

Query: 59  TIVRSEGLSKVFTGVGATFIGYSLQGACKYGGYEYFKQTYSNLLSPETAHRHRTAVYLCA 118
            + R+EG   +F G+G   +G     +  +  Y   K+ YS  L+     +    ++L A
Sbjct: 120 NVYRNEGFRSLFKGLGPNLVGVIPARSINFFTYGTTKEIYSKTLN---NGQEAVWIHLMA 176

Query: 119 SASAEFLADILLCPWEAIKVKQQTTIPPFCKNFLEGWS---KITAAEGLSGLYKGITPLW 175
           +A+A +       P   +K + Q       K +   W     +   EG+ GLYKG++  +
Sbjct: 177 AATAGWATSTATNPIWLVKTRLQLDKAGTTKKYKNSWDCLKNVVQKEGILGLYKGLSASY 236

Query: 176 CRQIPYTMCKFTSFERIVEMIYAKLPR-----SKQEMSPSQQIGV----SFVGGYLAGIL 226
              +   + ++  +E++  +I  +        S+ E S S +I      S   G LA  +
Sbjct: 237 LGSVE-GILQWVLYEQMKHIIKQRSMEKFGNISEVEKSTSDKIKEWCQRSGSAG-LAKFV 294

Query: 227 CAVVSHPADVMVSKV-NADRKQGE----SMVEASKRIYSRIGFGGLWNGL--------PV 273
            +++++P +V+ +++  A  + G+     +V++ + I    G   ++ GL        P 
Sbjct: 295 ASIITYPHEVVRTRLRQAPLENGKLKYTGLVQSIRVIIKEEGLASMYGGLTPHLLRTVPN 354

Query: 274 RIFMIGT 280
            I M GT
Sbjct: 355 SIIMFGT 361

 Score = 36.6 bits (83), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 38/171 (22%), Positives = 75/171 (43%), Gaps = 16/171 (9%)

Query: 134 EAIKVKQQTTIPPFCKNFLEGW---SKITAAEGLSGLYKGITPLWCRQIPYTMCKFTSFE 190
           ++I   Q   I    ++F E +   S +   EG   L+KG+ P     IP     F ++ 
Sbjct: 94  KSIGPNQANVIAQGVRHFKETFGIISNVYRNEGFRSLFKGLGPNLVGVIPARSINFFTYG 153

Query: 191 RIVEMIYAKLPRSKQEMSPSQQIGVSFVGGYLAGILCAVVSHPADVMVSKVNADR----K 246
              E IY+K   + QE      + +  +    AG   +  ++P  ++ +++  D+    K
Sbjct: 154 TTKE-IYSKTLNNGQEA-----VWIHLMAAATAGWATSTATNPIWLVKTRLQLDKAGTTK 207

Query: 247 QGESMVEASKRIYSRIGFGGLWNGLPVRIFMIGTLTS-FQWLIYDSFKAYI 296
           + ++  +  K +  + G  GL+ GL      +G++    QW++Y+  K  I
Sbjct: 208 KYKNSWDCLKNVVQKEGILGLYKGLSAS--YLGSVEGILQWVLYEQMKHII 256

>AEL253W [2253] [Homologous to ScYBR192W (RIM2) - SH]
           complement(164665..165762) [1098 bp, 365 aa]
          Length = 365

 Score = 63.5 bits (153), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 46/198 (23%), Positives = 94/198 (47%), Gaps = 22/198 (11%)

Query: 20  LGGVVACGPTHSSVTPLDLVKCRLQVNP------QLYRSNLDGWKTIVRSEGLSKVFTGV 73
           L G  A   T ++  P+ LVK RLQ++       + Y+++ D  K ++R+EG+  ++ G+
Sbjct: 168 LAGATAGWATSTATNPIWLVKTRLQLDKAADGRSRRYKNSWDCLKGVMRNEGILGLYKGL 227

Query: 74  GATFIGYSLQGACKYGGYEYFKQTYSNL-------LSPETAHRHRTAVYLC----ASASA 122
            A+++G S++   ++  YE  K             +S E    +      C    ++ +A
Sbjct: 228 SASYLG-SVESILQWVLYEQMKHIIRQRSIEEFGDISEENKTTYMKVKEWCQRSGSAGAA 286

Query: 123 EFLADILLCPWEAIKVKQQTTIPPFCK----NFLEGWSKITAAEGLSGLYKGITPLWCRQ 178
           +  A IL  P E ++ + +       K       + +S I   EG + +Y G+TP   R 
Sbjct: 287 KLFASILTYPHEVVRTRLRQAPKENGKLKYTGLFQSFSLIIKEEGFASMYSGLTPHLMRT 346

Query: 179 IPYTMCKFTSFERIVEMI 196
           +P ++  F ++E +++++
Sbjct: 347 VPNSIIMFGTWELVIKLL 364

 Score = 36.2 bits (82), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 53/292 (18%), Positives = 113/292 (38%), Gaps = 50/292 (17%)

Query: 35  PLDLVKCRLQVNP--------------------QLYRSNLDGWKTIVRSEGLSKVFTGVG 74
           P D+VK RLQ +                       +R  +   + +   EG   +F G+G
Sbjct: 69  PFDVVKTRLQSDVFHGAYKTQATARTNVVYQGLMHFRETVGIIQNVYTQEGFRSLFKGLG 128

Query: 75  ATFIGYSLQGACKYGGYEYFKQTYSNLLSPETAHRHRTAVYLCASASAEFLADILLCPWE 134
              +G     +  +  Y   K T S LL+     +    ++  A A+A +       P  
Sbjct: 129 PNLVGVIPARSINFFTYGVTKDTASRLLND---GQEAPWIHFLAGATAGWATSTATNPIW 185

Query: 135 AIKVKQQ--TTIPPFCKNFLEGWS---KITAAEGLSGLYKGITPLWCRQIPYTMCKFTSF 189
            +K + Q         + +   W     +   EG+ GLYKG++  +   +  ++ ++  +
Sbjct: 186 LVKTRLQLDKAADGRSRRYKNSWDCLKGVMRNEGILGLYKGLSASYLGSVE-SILQWVLY 244

Query: 190 ERIVEMIYAKLPRSKQEMSPSQQIGVSFVGGY--------LAGILCAVVSHPADVMVSKV 241
           E++  +I  +      ++S   +     V  +         A +  +++++P +V+ +++
Sbjct: 245 EQMKHIIRQRSIEEFGDISEENKTTYMKVKEWCQRSGSAGAAKLFASILTYPHEVVRTRL 304

Query: 242 -NADRKQGE----SMVEASKRIYSRIGFGGLWNGL--------PVRIFMIGT 280
             A ++ G+     + ++   I    GF  +++GL        P  I M GT
Sbjct: 305 RQAPKENGKLKYTGLFQSFSLIIKEEGFASMYSGLTPHLMRTVPNSIIMFGT 356

>YJR095W (SFC1) [2987] chr10 (609690..610658) Mitochondrial membrane
           succinate-fumarate transporter, member of the
           mitochondrial carrier family (MCF) of membrane
           transporters [969 bp, 322 aa]
          Length = 322

 Score = 63.2 bits (152), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 56/288 (19%), Positives = 122/288 (42%), Gaps = 39/288 (13%)

Query: 35  PLDLVKCRLQVNPQLYRSN-----------LDGWKTIVRSEGLSKVFTGVGATFIGYSLQ 83
           PLD +K R+Q+    YR             +   +TI + EG   ++ G+GA  IG   +
Sbjct: 30  PLDTIKVRMQI----YRRVAGIEHVKPPGFIKTGRTIYQKEGFLALYKGLGAVVIGIIPK 85

Query: 84  GACKYGGYEYFKQTYSNLLSPETAHRHRTAVYLCASASAEFLADILLCPWEAIKVKQQT- 142
            A ++  YE+++   + L++ E+        ++    +    A +++ P E +K++ Q  
Sbjct: 86  MAIRFSSYEFYR---TLLVNKESGIVSTGNTFVAGVGAGITEAVLVVNPMEVVKIRLQAQ 142

Query: 143 -------TIPPFCKNFLEGWSKITAAEGLSGLYKGITPLWCRQIPYTMCKFTSFERIVEM 195
                     P   N +     I   EG+S LY+G++    RQ       FT + ++ E 
Sbjct: 143 HLTPSEPNAGPKYNNAIHAAYTIVKEEGVSALYRGVSLTAARQATNQGANFTVYSKLKEF 202

Query: 196 IYAKLPRSKQEMSPSQQIGVSFVGGYLAGILCAVVSHPADVMVSKVNADR-----KQG-- 248
           +       + ++ PS +       G ++G +    + P D + +++  D+     KQ   
Sbjct: 203 LQN---YHQMDVLPSWETSCI---GLISGAIGPFSNAPLDTIKTRLQKDKSISLEKQSGM 256

Query: 249 ESMVEASKRIYSRIGFGGLWNGLPVRIFMIGTLTSFQWLIYDSFKAYI 296
           + ++    ++    GF  L+ G+  R+  +    +  + +Y+  + ++
Sbjct: 257 KKIITIGAQLLKEEGFRALYKGITPRVMRVAPGQAVTFTVYEYVREHL 304

 Score = 34.7 bits (78), Expect = 0.078,   Method: Compositional matrix adjust.
 Identities = 22/84 (26%), Positives = 37/84 (44%), Gaps = 9/84 (10%)

Query: 25  ACGPTHSSVTPLDLVKCRLQVNPQLYRSNLDGWKTIV-------RSEGLSKVFTGVGATF 77
           A GP  ++  PLD +K RLQ +  +      G K I+       + EG   ++ G+    
Sbjct: 226 AIGPFSNA--PLDTIKTRLQKDKSISLEKQSGMKKIITIGAQLLKEEGFRALYKGITPRV 283

Query: 78  IGYSLQGACKYGGYEYFKQTYSNL 101
           +  +   A  +  YEY ++   NL
Sbjct: 284 MRVAPGQAVTFTVYEYVREHLENL 307

>Kwal_27.12081
          Length = 369

 Score = 63.2 bits (152), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 46/198 (23%), Positives = 97/198 (48%), Gaps = 24/198 (12%)

Query: 20  LGGVVACGPTHSSVTPLDLVKCRLQVNP----QLYRSNLDGWKTIVRSEGLSKVFTGVGA 75
           +    A   T ++  P+ L+K RLQ++     + Y+++ D  K I++ EG   ++ G+ A
Sbjct: 172 ISAATAGWATSTATNPIWLIKTRLQLDKAGHTRQYKNSWDCLKHIIQKEGFFGLYKGLSA 231

Query: 76  TFIGYSLQGACKYGGYEYFKQ--------TYSNLLSPETAHRHRTAVYLCASASA---EF 124
           +++G S++G  ++  YE  KQ         + ++   E     +   +   S SA   +F
Sbjct: 232 SYLG-SVEGILQWLLYEQMKQMIKMRSIEKFGHISEGEKNTSEKIKEWCQRSGSAGLAKF 290

Query: 125 LADILLCPWEAIKVKQQTTIPPFCKN------FLEGWSKITAAEGLSGLYKGITPLWCRQ 178
           LA I+  P E ++ + +    P   +       ++ +  I   EGL+ +Y G+TP   R 
Sbjct: 291 LASIVTYPHEVVRTRLRQA--PLENDKLKYTGLIQSFRVIIKEEGLASMYGGLTPHLLRT 348

Query: 179 IPYTMCKFTSFERIVEMI 196
           +P ++  F ++E +++++
Sbjct: 349 VPNSIIMFGTWELVIKLL 366

 Score = 46.2 bits (108), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 65/293 (22%), Positives = 120/293 (40%), Gaps = 53/293 (18%)

Query: 35  PLDLVKCRLQVNP-QLYRSNLDGWKT--------------------IVRSEGLSKVFTGV 73
           P D+VK RLQ +  Q   +NL   K+                    + + EG   +F G+
Sbjct: 72  PFDVVKTRLQSDVFQSTYANLSHNKSSNVVSSGIRHFRETFGIISNLYKLEGFRSLFKGL 131

Query: 74  GATFIGYSLQGACKYGGYEYFKQTYSNLLSP-ETAHRHRTAVYLCASASAEFLADILLCP 132
           G   +G     +  +  Y   KQ YS   +  E A      ++L ++A+A +       P
Sbjct: 132 GPNLVGVIPARSINFFTYGTTKQIYSRAFNNGEEA----PWIHLISAATAGWATSTATNP 187

Query: 133 WEAIKVKQQTTIPPFCKNFLEGWS---KITAAEGLSGLYKGITPLWCRQIPYTMCKFTSF 189
              IK + Q       + +   W     I   EG  GLYKG++  +   +   + ++  +
Sbjct: 188 IWLIKTRLQLDKAGHTRQYKNSWDCLKHIIQKEGFFGLYKGLSASYLGSVE-GILQWLLY 246

Query: 190 ERIVEMIYAKLPR-----SKQEMSPSQQIGV----SFVGGYLAGILCAVVSHPADVMVSK 240
           E++ +MI  +        S+ E + S++I      S   G LA  L ++V++P +V+ ++
Sbjct: 247 EQMKQMIKMRSIEKFGHISEGEKNTSEKIKEWCQRSGSAG-LAKFLASIVTYPHEVVRTR 305

Query: 241 VNA-----DRKQGESMVEASKRIYSRIGFGGLWNGL--------PVRIFMIGT 280
           +       D+ +   ++++ + I    G   ++ GL        P  I M GT
Sbjct: 306 LRQAPLENDKLKYTGLIQSFRVIIKEEGLASMYGGLTPHLLRTVPNSIIMFGT 358

>KLLA0D09889g complement(834904..835998) similar to sp|Q03829
           Saccharomyces cerevisiae YMR166c, start by similarity
          Length = 364

 Score = 63.2 bits (152), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 70/299 (23%), Positives = 126/299 (42%), Gaps = 36/299 (12%)

Query: 18  CTLGGVVACGPTHSSVTPLDLVKCRLQVNPQL--YRSNLDGWKTIVRSEGLSK-VFTGVG 74
           C L G +      S++  LD VK R Q  P    Y++ +  ++TI+  EGL K ++ G  
Sbjct: 58  CMLAGGIGGAIGDSAMHSLDTVKTRQQGAPSTVKYKNMIGAYRTIILEEGLRKGLYGGYS 117

Query: 75  ATFIGYSLQGACKYGGYEYFKQTYSNLLSPETAHRHRTAVYLCASASAEFLADILLCPWE 134
              +G     A  +  YEY K+             H TA +L      +F++  +  P E
Sbjct: 118 GAMLGSFPSAAIFFATYEYTKRKMIGEWGINETFSHLTAGFL-----GDFISSFVYVPSE 172

Query: 135 AIKVKQQTT---IPPFC------KNFLEGWSKITAAEGLSGLYKGITPLWCRQIPYTMCK 185
            +K + Q       PF       KN  +  + I   EG   L+ G      R +P++  +
Sbjct: 173 VLKTRLQLQGRYNNPFFRSGYNYKNLTDAVTTIVRREGWPTLFFGYKATLSRDLPFSGLQ 232

Query: 186 FTSFERIVEMIYAKLPRS-KQEMSPSQQIGVSFVGGYLAGILCAVVSHPADVMVSKVNA- 243
           F  +E+  ++ +A   ++  +++S S +I    + G  AG L  +++ P DV+ +++   
Sbjct: 233 FAFYEKFRQLAFAVENKTFDEDLSLSNEI----ITGAAAGGLAGIITTPLDVVKTRIQTQ 288

Query: 244 ----------DRKQ---GESMVEASKRIYSRIGFGGLWNGLPVRIFMIGTLTSFQWLIY 289
                     + KQ     S+ +    +Y   G  GL++G+  R       +S   L+Y
Sbjct: 289 LPDIPENSSQNLKQQTLTNSITKGMMTVYKTEGLAGLFSGVGPRFIWTSIQSSIMLLLY 347

 Score = 41.6 bits (96), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 29/87 (33%), Positives = 43/87 (49%), Gaps = 14/87 (16%)

Query: 33  VTPLDLVKCRLQVN----PQLYRSNLD----------GWKTIVRSEGLSKVFTGVGATFI 78
            TPLD+VK R+Q      P+    NL           G  T+ ++EGL+ +F+GVG  FI
Sbjct: 275 TTPLDVVKTRIQTQLPDIPENSSQNLKQQTLTNSITKGMMTVYKTEGLAGLFSGVGPRFI 334

Query: 79  GYSLQGACKYGGYEYFKQTYSNLLSPE 105
             S+Q +     Y+   +T  + LS E
Sbjct: 335 WTSIQSSIMLLLYQVALKTLDSKLSDE 361

>Scas_721.27
          Length = 374

 Score = 62.8 bits (151), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 44/197 (22%), Positives = 97/197 (49%), Gaps = 22/197 (11%)

Query: 20  LGGVVACGPTHSSVTPLDLVKCRLQVNP----QLYRSNLDGWKTIVRSEGLSKVFTGVGA 75
           +    A   T ++  P+ ++K R+Q++     + Y+++ D  KT+++SEG+  ++ G+ A
Sbjct: 179 MSAATAGWATSTATNPIWMIKTRVQLDKAGTTRKYKNSWDCLKTVLKSEGIYGLYRGLSA 238

Query: 76  TFIGYSLQGACKYGGYEYFKQTYSNLLSPETAH-------RHRTAVYLC----ASASAEF 124
           +++G S++G  ++  YE  K         +  H       R       C    ++  A+F
Sbjct: 239 SYLG-SIEGILQWLLYEQMKHLIKQRSIEKFGHEGQLTKSRTEKIKEWCQRSGSAGVAKF 297

Query: 125 LADILLCPWEAIKVKQQTTIP-----PFCKNFLEGWSKITAAEGLSGLYKGITPLWCRQI 179
           +A I+  P E ++ + +  +P     P     ++ +  I   EGL+ +Y G+TP   R +
Sbjct: 298 IASIVTYPHEVVRTRLRQ-MPMENGKPKYTGLVQSFRVIIKEEGLASMYSGLTPHLMRTV 356

Query: 180 PYTMCKFTSFERIVEMI 196
           P ++  F ++E ++ ++
Sbjct: 357 PNSIIMFGTWELVIRLL 373

 Score = 40.8 bits (94), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 50/249 (20%), Positives = 101/249 (40%), Gaps = 34/249 (13%)

Query: 59  TIVRSEGLSKVFTGVGATFIGYSLQGACKYGGYEYFKQTYSNLLSPETAHRHRTAVYLCA 118
            + + EG   +F G+G   +G     +  +  Y   K+ YS   +     +    ++L +
Sbjct: 124 NVYKREGFRSLFKGLGPNLVGVIPARSINFFTYGTTKEIYSKAFN---NGQETPLIHLMS 180

Query: 119 SASAEFLADILLCPWEAIKVKQQTTIPPFCKNFLEGWS---KITAAEGLSGLYKGITPLW 175
           +A+A +       P   IK + Q       + +   W     +  +EG+ GLY+G++  +
Sbjct: 181 AATAGWATSTATNPIWMIKTRVQLDKAGTTRKYKNSWDCLKTVLKSEGIYGLYRGLSASY 240

Query: 176 CRQIP-------YTMCKFTSFERIVEMI--YAKLPRSKQEMSPS--QQIGVSFVGGYLAG 224
              I        Y   K    +R +E      +L +S+ E      Q+ G + V  ++A 
Sbjct: 241 LGSIEGILQWLLYEQMKHLIKQRSIEKFGHEGQLTKSRTEKIKEWCQRSGSAGVAKFIAS 300

Query: 225 ILCAVVSHPADVMVSKVNA-----DRKQGESMVEASKRIYSRIGFGGLWNGL-------- 271
           I    V++P +V+ +++        + +   +V++ + I    G   +++GL        
Sbjct: 301 I----VTYPHEVVRTRLRQMPMENGKPKYTGLVQSFRVIIKEEGLASMYSGLTPHLMRTV 356

Query: 272 PVRIFMIGT 280
           P  I M GT
Sbjct: 357 PNSIIMFGT 365

 Score = 32.0 bits (71), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 46/229 (20%), Positives = 90/229 (39%), Gaps = 44/229 (19%)

Query: 102 LSPETAHRHRTAVYLCASASAEFLADILLCPWEAIKVKQQTTIPPFCKNFLEGWSKITAA 161
           + PE+    +  V+  A         ++ CP++ +K + Q+ I  +   +    + +TAA
Sbjct: 42  IKPESHPNVKPWVHFVAGGIGGMAGAVVTCPFDLVKTRLQSDI--YQSVYKSKAATVTAA 99

Query: 162 -----------------------------EGLSGLYKGITPLWCRQIPYTMCKFTSFERI 192
                                        EG   L+KG+ P     IP     F ++   
Sbjct: 100 HNSKIANSLVQAGTHFKETFGILGNVYKREGFRSLFKGLGPNLVGVIPARSINFFTYGTT 159

Query: 193 VEMIYAKLPRSKQEMSPSQQIGVSFVGGYLAGILCAVVSHPADVMVSKVNADR----KQG 248
            E IY+K   + QE +P     +  +    AG   +  ++P  ++ ++V  D+    ++ 
Sbjct: 160 KE-IYSKAFNNGQE-TPL----IHLMSAATAGWATSTATNPIWMIKTRVQLDKAGTTRKY 213

Query: 249 ESMVEASKRIYSRIGFGGLWNGLPVRIFMIGTLTS-FQWLIYDSFKAYI 296
           ++  +  K +    G  GL+ GL      +G++    QWL+Y+  K  I
Sbjct: 214 KNSWDCLKTVLKSEGIYGLYRGLSAS--YLGSIEGILQWLLYEQMKHLI 260

>KLLA0A09383g complement(818752..819852) similar to sp|P53320
           Saccharomyces cerevisiae YGR257c, start by similarity
          Length = 366

 Score = 62.8 bits (151), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 60/257 (23%), Positives = 106/257 (41%), Gaps = 33/257 (12%)

Query: 50  YRSNLDGWKTIVRSEGLSKVFTGVGATFIGYSLQGACKYGGYEYFKQTYSNLLSPETAHR 109
           + S  + +  I   EGL+ ++ G+  T +         + GYE F+       SP     
Sbjct: 97  FNSTWEAFTKISEVEGLATLWRGLSITLLMAIPANVVYFSGYEMFRDH-----SPMRDSY 151

Query: 110 HRTAVYLCASASAEFLADILLCPWEAIKVKQQ--------TTIPPFCKNFLEGWSKITAA 161
                  C  A+A  +A   + P E IK + Q        TT     K+ L+       +
Sbjct: 152 PSLNPLFCG-ATARMVAATTVAPLELIKTRLQSIPRSRKDTTTQMMFKDLLKETRNEIRS 210

Query: 162 EGLSGLYKGITPLWCRQIPYTMCKFTSFERIVEMIYAKLPRS--KQEMSPSQQIGV-SFV 218
            G   L+KG+     R +P++   + S+E   +  +        +  +SP+    + SF+
Sbjct: 211 GGYKVLFKGLEITLWRDVPFSAIYWGSYEFYKKNFWIDFSEQCLRWNLSPNWDFFINSFI 270

Query: 219 GGYLAGILCAVVSHPADV----MVSKVNADRKQGESMVEASKRIYSR------------I 262
           GG ++G   A+++HP DV    M   ++ + KQ  ++V   KR+ +R             
Sbjct: 271 GGSVSGSSAALLTHPFDVGKTRMQITMDIENKQRNTLVSPKKRVSARGMFKFLYNIKQTE 330

Query: 263 GFGGLWNGLPVRIFMIG 279
           G+G L+ GL  R+  I 
Sbjct: 331 GYGALYTGLIPRVMKIA 347

 Score = 36.2 bits (82), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 24/87 (27%), Positives = 41/87 (47%), Gaps = 14/87 (16%)

Query: 26  CGPTH-----SSVTPLDLVKCRLQVNPQ---------LYRSNLDGWKTIVRSEGLSKVFT 71
           CG T      ++V PL+L+K RLQ  P+         +++  L   +  +RS G   +F 
Sbjct: 159 CGATARMVAATTVAPLELIKTRLQSIPRSRKDTTTQMMFKDLLKETRNEIRSGGYKVLFK 218

Query: 72  GVGATFIGYSLQGACKYGGYEYFKQTY 98
           G+  T        A  +G YE++K+ +
Sbjct: 219 GLEITLWRDVPFSAIYWGSYEFYKKNF 245

>ADL009W [1733] [Homologous to ScYIL006W - SH; ScYEL006W - SH]
           complement(693078..694217) [1140 bp, 379 aa]
          Length = 379

 Score = 61.6 bits (148), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 50/201 (24%), Positives = 87/201 (43%), Gaps = 18/201 (8%)

Query: 4   KQPIPLFSPEYYAACTLGGVVACGPTHSSVTPLDLVKCRLQVNPQL------YRSNLDGW 57
           KQ  P + P  + +     + A   + +   P+ +VK RL +   +      YRS LD +
Sbjct: 169 KQRYPSYLPGGFVSHAASALTAGAISTALTNPIWVVKTRLMIQSDVSRDSTNYRSTLDAF 228

Query: 58  KTIVRSEGLSKVFTGVGATFIGYSLQGACKYGGYEYFKQ-TYSNLLSPETAHRHRTAVYL 116
           + + RSEGL   ++G+  +  G     A  +  YE  K   + N  + +        + L
Sbjct: 229 RKMYRSEGLKVFYSGLVPSLFGL-FHVAIHFPVYEKLKIWLHRNTPAADGQRLDHNKLQL 287

Query: 117 ----CASASAEFLADILLCPWEAIKVKQQ---TTIPPFCKNFLEGWSKITAAEGLSGLYK 169
                AS  ++ +A ++  P E ++ + Q   + +PP   N L    +I A+EG  G Y 
Sbjct: 288 DRLIVASCLSKVVASVITYPHEILRTRMQVRHSGVPPSLLNLL---GRIRASEGYVGFYS 344

Query: 170 GITPLWCRQIPYTMCKFTSFE 190
           G      R +P ++    SFE
Sbjct: 345 GFATNLVRTVPASVITLVSFE 365

 Score = 55.5 bits (132), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 63/289 (21%), Positives = 127/289 (43%), Gaps = 32/289 (11%)

Query: 33  VTPLDLVKCRLQVN-----PQLYRSNLDGWKTIVRSEGLSKVFTGVGATFIGYSLQGACK 87
           V PLD+ K RLQ        + YR  +     I+R EG++ ++ G+    +GY       
Sbjct: 102 VCPLDVAKTRLQAQGAGSGERYYRGIVGTLSAILRDEGVAGLYKGLAPIVLGYFPTWMLY 161

Query: 88  YGGYEYFKQTYSNLLSPETAHRHRTAVYLCASASAEFLADILLCPWEAIKVKQ--QTTIP 145
           +  YE  KQ Y + L         +A+   A ++A      L  P   +K +   Q+ + 
Sbjct: 162 FSVYEKCKQRYPSYLPGGFVSHAASALTAGAISTA------LTNPIWVVKTRLMIQSDVS 215

Query: 146 PFCKNF---LEGWSKITAAEGLSGLYKGITPLWCRQIPYTMCKFTSFERIVEMIYAKLPR 202
               N+   L+ + K+  +EGL   Y G+ P     + +    F  +E++   ++   P 
Sbjct: 216 RDSTNYRSTLDAFRKMYRSEGLKVFYSGLVPSLF-GLFHVAIHFPVYEKLKIWLHRNTPA 274

Query: 203 SK-QEMSPSQ-QIGVSFVGGYLAGILCAVVSHPADVMVSKVNADRKQG--ESMVEASKRI 258
           +  Q +  ++ Q+    V   L+ ++ +V+++P +++ +++   R  G   S++    RI
Sbjct: 275 ADGQRLDHNKLQLDRLIVASCLSKVVASVITYPHEILRTRMQV-RHSGVPPSLLNLLGRI 333

Query: 259 YSRIGFGGLWNGLPVRIFM-----IGTLTSFQWLIYDSFKAYIGLPTTG 302
            +  G+ G ++G    +       + TL SF++     F+ Y+ +   G
Sbjct: 334 RASEGYVGFYSGFATNLVRTVPASVITLVSFEY-----FRKYLRMWNEG 377

 Score = 46.6 bits (109), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 44/195 (22%), Positives = 86/195 (44%), Gaps = 20/195 (10%)

Query: 112 TAVYLCASASAEFLADILLCPWEAIKVKQQTTIPPFCKNFLEG----WSKITAAEGLSGL 167
           T V   + A A F++ I++CP +  K + Q       + +  G     S I   EG++GL
Sbjct: 84  TQVTAVSGALAGFVSGIMVCPLDVAKTRLQAQGAGSGERYYRGIVGTLSAILRDEGVAGL 143

Query: 168 YKGITPLWCRQIPYTMCKFTSFERIVEMIYAKLPRSKQEMSPSQQIGVSFVGGYLAGILC 227
           YKG+ P+     P  M  F+ +E+  +   + LP      + S            AG + 
Sbjct: 144 YKGLAPIVLGYFPTWMLYFSVYEKCKQRYPSYLPGGFVSHAAS---------ALTAGAIS 194

Query: 228 AVVSHP-----ADVMV-SKVNADRKQGESMVEASKRIYSRIGFGGLWNGLPVRIFMIGTL 281
             +++P       +M+ S V+ D     S ++A +++Y   G    ++GL   +F +  +
Sbjct: 195 TALTNPIWVVKTRLMIQSDVSRDSTNYRSTLDAFRKMYRSEGLKVFYSGLVPSLFGLFHV 254

Query: 282 TSFQWLIYDSFKAYI 296
            +  + +Y+  K ++
Sbjct: 255 -AIHFPVYEKLKIWL 268

>Kwal_23.4731
          Length = 314

 Score = 61.2 bits (147), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 69/302 (22%), Positives = 128/302 (42%), Gaps = 30/302 (9%)

Query: 20  LGGVVACGPTHSSVTPLDLVKCRLQ--VNPQLYRSNLDGWKTIVR-SEGLSKVF----TG 72
           + G+ A   T  +  PLDLVK RLQ  VN        +  KTI+R S+  S VF     G
Sbjct: 18  IAGLAAGTLTTIATHPLDLVKLRLQLLVNTTHSHGYKEVIKTIIRDSKADSNVFREAYRG 77

Query: 73  VGATFIGYSLQGACKYGGYEYFKQT-----YSNLLSPETAHRHRT-----AVYLCASASA 122
           +G   IG S+     +G Y + K        + + +P  +   +      ++YL ++A +
Sbjct: 78  LGVNLIGNSIAWGLYFGLYRFTKDMVYRYGVAQMKTPTQSSFQKDKAMGPSLYLASAALS 137

Query: 123 EFLADILLCPWEAIKVKQQTTIPPFCKNFLEGWS---KITAAEGLSGLYKGITPLWCRQI 179
                IL  P   IK +  +T     + +   W    K+ A EG SG ++G+ P     +
Sbjct: 138 GLGTAILTNPIWVIKTRIMSTSSQASERYKTTWDGIRKVYAHEGFSGFWRGLVPS-LFGV 196

Query: 180 PYTMCKFTSFERIVEMIYAKLPRSKQE-MSPSQQIGVSFVGGYLAGILCAVVSHPADVMV 238
                 FT ++ +    +A+   ++ E M   + I ++ V    + +L     +P  ++ 
Sbjct: 197 AQGAIYFTIYDSLRHQYFARRGITEDEKMGNLENIAITSV----SKMLSVTAVYPFQLLK 252

Query: 239 SKVNA----DRKQGESMVEASKRIYSRIGFGGLWNGLPVRIFMIGTLTSFQWLIYDSFKA 294
           S + +    +++         K I+ + G  GL+ GL   +      T   + IY++ + 
Sbjct: 253 SNLQSFAAVEKRDSYRFWNLVKSIHQKEGLQGLYKGLSANLLRAIPSTCITFCIYENLRH 312

Query: 295 YI 296
           ++
Sbjct: 313 WL 314

 Score = 45.8 bits (107), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 41/186 (22%), Positives = 79/186 (42%), Gaps = 12/186 (6%)

Query: 14  YYAACTLGGVVACGPTHSSVTPLDLVKCRLQVNP----QLYRSNLDGWKTIVRSEGLSKV 69
           Y A+  L G+     T+    P+ ++K R+        + Y++  DG + +   EG S  
Sbjct: 130 YLASAALSGLGTAILTN----PIWVIKTRIMSTSSQASERYKTTWDGIRKVYAHEGFSGF 185

Query: 70  FTGVGATFIGYSLQGACKYGGYEYFKQTYSNLLSPETAHRHRTAVYLCASASAEFLADIL 129
           + G+  +  G + QGA  +  Y+  +  Y          +      +  ++ ++ L+   
Sbjct: 186 WRGLVPSLFGVA-QGAIYFTIYDSLRHQYFARRGITEDEKMGNLENIAITSVSKMLSVTA 244

Query: 130 LCPWEAIKVKQQTTIPPFCKNFLEGWS---KITAAEGLSGLYKGITPLWCRQIPYTMCKF 186
           + P++ +K   Q+      ++    W+    I   EGL GLYKG++    R IP T   F
Sbjct: 245 VYPFQLLKSNLQSFAAVEKRDSYRFWNLVKSIHQKEGLQGLYKGLSANLLRAIPSTCITF 304

Query: 187 TSFERI 192
             +E +
Sbjct: 305 CIYENL 310

>Scas_702.10
          Length = 302

 Score = 60.8 bits (146), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 67/293 (22%), Positives = 124/293 (42%), Gaps = 34/293 (11%)

Query: 21  GGVVACGPTHSSVTPLDLVKCRLQVNPQLYRSNLDGWKTIVRSEGLSKVFTGVGATFIGY 80
            G+ AC  TH    PLDL K RLQ  P    +      TI+R+E +  +++G+ A  +  
Sbjct: 19  AGIFACVMTH----PLDLAKVRLQAAPLPKPTLGRMLTTILRNENVMGLYSGLSAAVLRQ 74

Query: 81  SLQGACKYGGYEYFKQTYSNLLSPETAHRHRTAVYLCASASAEF------LADILLCPWE 134
                 ++G Y+  K+     L P+        +  C+  S          AD++     
Sbjct: 75  CTYTTVRFGAYDLMKEN----LIPQGHINDMVYLLPCSMFSGAIGGLVGNFADVV----- 125

Query: 135 AIKVKQQTTIPPFC----KNFLEGWSKITAAE-GLSGLYKGITPLWCRQIPYTMCKFTSF 189
            I+++  + + P      +N ++G  KI   E G+  L  G  P   R +  T  +  ++
Sbjct: 126 NIRMQNDSALKPELRRNYRNAIDGVYKIYMHEGGIKTLLTGWKPNMVRGVLMTASQVVTY 185

Query: 190 ERIVEMIYAKLPRSKQEMSPSQQIGVSFVGGYLAGILCAVVSHPADVMVSKV-NADRKQG 248
           +     +  KL  S      S  +  S + G +A  +C+    PADV+ +++ NA + + 
Sbjct: 186 DVFKNYLVTKL--SFDPKKNSTHLSASLLAGLVATTICS----PADVIKTRIMNAHKTES 239

Query: 249 ESMVEASKRIYSRIGFGGLWNG-LPVRIFMIGTLTSFQWLIYDSFKAY-IGLP 299
           ES ++       + G   ++ G LP+    +G  T   +   +  K + +G+P
Sbjct: 240 ESAIKILTSAIKKEGPSFMFRGWLPI-FTRLGPFTMLIFFAIEQLKKHRVGMP 291

 Score = 34.7 bits (78), Expect = 0.074,   Method: Compositional matrix adjust.
 Identities = 42/188 (22%), Positives = 75/188 (39%), Gaps = 25/188 (13%)

Query: 121 SAEFLADILLCPWEAIKVKQQTTIPPFCKNFL-EGWSKITAAEGLSGLYKGITPLWCRQI 179
           +A   A ++  P +  KV+ Q    P  K  L    + I   E + GLY G++    RQ 
Sbjct: 18  AAGIFACVMTHPLDLAKVRLQAA--PLPKPTLGRMLTTILRNENVMGLYSGLSAAVLRQC 75

Query: 180 PYTMCKFTSFERIVEMIYAKLPRSKQEMSPSQQIGVS---FVGGYLAGILCAVVSHPADV 236
            YT  +F +++ +           K+ + P   I            +G +  +V + ADV
Sbjct: 76  TYTTVRFGAYDLM-----------KENLIPQGHINDMVYLLPCSMFSGAIGGLVGNFADV 124

Query: 237 MVSKVNAD-------RKQGESMVEASKRIYSRI-GFGGLWNGLPVRIFMIGTLTSFQWLI 288
           +  ++  D       R+   + ++   +IY    G   L  G    +     +T+ Q + 
Sbjct: 125 VNIRMQNDSALKPELRRNYRNAIDGVYKIYMHEGGIKTLLTGWKPNMVRGVLMTASQVVT 184

Query: 289 YDSFKAYI 296
           YD FK Y+
Sbjct: 185 YDVFKNYL 192

 Score = 32.3 bits (72), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 23/86 (26%), Positives = 39/86 (45%)

Query: 208 SPSQQIGVSFVGGYLAGILCAVVSHPADVMVSKVNADRKQGESMVEASKRIYSRIGFGGL 267
           SP++QI   +  G  AGI   V++HP D+   ++ A      ++      I       GL
Sbjct: 4   SPTKQIKYPWWYGGAAGIFACVMTHPLDLAKVRLQAAPLPKPTLGRMLTTILRNENVMGL 63

Query: 268 WNGLPVRIFMIGTLTSFQWLIYDSFK 293
           ++GL   +    T T+ ++  YD  K
Sbjct: 64  YSGLSAAVLRQCTYTTVRFGAYDLMK 89

>CAGL0F07711g complement(751794..752900) similar to sp|Q03829
           Saccharomyces cerevisiae YMR166c, hypothetical start
          Length = 368

 Score = 60.8 bits (146), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 64/280 (22%), Positives = 117/280 (41%), Gaps = 46/280 (16%)

Query: 15  YAACTLGGVVACGPTHSSVTPLDLVKCRLQVNPQL--YRSNLDGWKTIVRSEGLSK-VFT 71
           + A  +GG++     HS    LD VK R Q  P +  Y+  L  ++T+   EG  + ++ 
Sbjct: 57  FLAGGVGGIIGDSAMHS----LDTVKTRQQGAPNVHKYKHMLQAYRTMFIEEGFRRGLYG 112

Query: 72  GVGATFIGYSLQGACKYGGYEYFKQTYSNLLSPETAHRHRTAVYLCASASAEFLADILLC 131
           G  A  +G     A  +  YE+ K+T  N       H + T  +L A    +F +  +  
Sbjct: 113 GYCAAMLGSFPSAAIFFSTYEFTKRTMIN-----DYHLNDTFSHLTAGFLGDFFSSFVYV 167

Query: 132 PWEAIKVKQQT----TIPPFC-----KNFLEGWSKITAAEGLSGLYKGITPLWCRQIPYT 182
           P E +K + Q       P F      K+     + I   EG++ L+ G      R +P++
Sbjct: 168 PSEVLKTRLQLQGCYNNPHFNSGYNYKSLRNAIATIYRTEGVAALFFGYKATLARDLPFS 227

Query: 183 MCKFTSFERIVEMIYAKLPRS--KQEMSPSQQIGVSFVGGYLAGILCAVVSHPADVMVSK 240
             +F  +E+  +  +    +   K ++S S +I    V G  AG L  +++ P DV+ ++
Sbjct: 228 ALQFAFYEKFRQWAFLLEGKDIYKHDLSISNEI----VTGACAGGLAGILTTPLDVVKTR 283

Query: 241 V----------NADRK---------QGESMVEASKRIYSR 261
           V          + D K            S+ ++ + +Y+ 
Sbjct: 284 VQTQLPSQIDISTDTKIKNVSKPVTLTNSIFKSLRTVYTS 323

>Scas_582.7
          Length = 329

 Score = 60.5 bits (145), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 67/292 (22%), Positives = 112/292 (38%), Gaps = 29/292 (9%)

Query: 20  LGGVVACGPTHSSVTPLDLVKCRLQVN-----PQLYRSNLDGWKTIVRSEGLSKVFTGVG 74
           L G  A    HS++ P+D +K R+Q        Q   S +     I   EG   ++ GV 
Sbjct: 41  LAGAFAGIMEHSTMFPIDALKTRIQSTTTKGTEQTSTSIIKQISKISTMEGSLALWKGVQ 100

Query: 75  ATFIGYSLQGACKYGGYEYFKQTYSNLLSPETAHRHRTAVYLCASASAEFLADILLCPWE 134
           +  +G     A  +  YE+   T ++L+       H+      + A+A   +D  + P++
Sbjct: 101 SVILGAGPAHAVYFATYEF---TKAHLIPDSQRETHQPIKVAVSGATATVASDFFMNPFD 157

Query: 135 AIKVKQQTTIPPFCKNFLEGWSK-ITAAEGLSGLYKGITPLWCRQIPYTMCKFTSFERIV 193
            IK + Q  I    K  +   +K I   EGLS  Y          IP+    F       
Sbjct: 158 TIKQRMQ--ISDLKKEKVYNVAKKIYNLEGLSAFYYSYPTTIAMNIPFAAFNF------- 208

Query: 194 EMIYAKLPRSKQEMSPSQQIGVSFVGGYLAGILCAVVSHPADVMVSKVNAD--------- 244
            MIY    +    +     +     GG ++G + A V+ P D + + +            
Sbjct: 209 -MIYESASKFFNPLHHYNPLIHCLCGG-ISGAIAAAVTTPLDCIKTVIQIRGSSVVSLEV 266

Query: 245 RKQGESMVEASKRIYSRIGFGGLWNGLPVRIFMIGTLTSFQWLIYDSFKAYI 296
            K+  +  +A+  I    G+ G W GL  RI      T+  W  Y+  K ++
Sbjct: 267 MKKANTFKKATSAILMVYGWKGFWRGLQPRILANMPATAISWTAYECAKHFL 318

 Score = 49.3 bits (116), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 41/180 (22%), Positives = 78/180 (43%), Gaps = 10/180 (5%)

Query: 116 LCASASAEFLADILLCPWEAIKVKQQTTIPPFCK----NFLEGWSKITAAEGLSGLYKGI 171
           L A A A  +    + P +A+K + Q+T     +    + ++  SKI+  EG   L+KG+
Sbjct: 40  LLAGAFAGIMEHSTMFPIDALKTRIQSTTTKGTEQTSTSIIKQISKISTMEGSLALWKGV 99

Query: 172 TPLWCRQIPYTMCKFTSFERIVEMIYAKLPRSKQEMSPSQQIGVSFVGGYLAGILCAVVS 231
             +     P     F ++E     +   +P S++E     ++ VS   G  A +      
Sbjct: 100 QSVILGAGPAHAVYFATYEFTKAHL---IPDSQRETHQPIKVAVS---GATATVASDFFM 153

Query: 232 HPADVMVSKVNADRKQGESMVEASKRIYSRIGFGGLWNGLPVRIFMIGTLTSFQWLIYDS 291
           +P D +  ++     + E +   +K+IY+  G    +   P  I M     +F ++IY+S
Sbjct: 154 NPFDTIKQRMQISDLKKEKVYNVAKKIYNLEGLSAFYYSYPTTIAMNIPFAAFNFMIYES 213

>KLLA0C13431g 1145919..1146905 similar to sgd|S0005626 Saccharomyces
           cerevisiae YOR100c CRC1 mitochondrial carnitine carrier,
           member of the mitochondrial carrier (MCF) family, start
           by similarity
          Length = 328

 Score = 60.5 bits (145), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 75/275 (27%), Positives = 122/275 (44%), Gaps = 34/275 (12%)

Query: 16  AACTLGGVVACGPTHSSVTPLDLVKCRLQVNPQLYRSNLDGWKTIVRS----------EG 65
           AA  +GGV A    H    P DLVK R Q N    RS +D    I+++            
Sbjct: 33  AAGGVGGVCAVLTGH----PFDLVKVRCQSNQA--RSAMDAVSHILQAARQAAGPTSLNA 86

Query: 66  LSKVFTGVGATFIGYSLQGACKYGGYEYFKQTYSNLLSPETAHRHRTAV----YLCASAS 121
           +   + GV    +G +   A  + GY+  K+  +++  P +A     AV     L   A+
Sbjct: 87  VRGFYKGVVPPLLGVTPIFAVSFWGYDVGKKLVTSV--PSSAASGAAAVEPELTLSQMAA 144

Query: 122 AEFLADI----LLCPWEAIKVKQQTTIPPFCKNFLEGWSKITAAEGLSGLYKGITPLWCR 177
           A F++ I    +  P E +KV  QTT      +FL+   +I   +G   L+KG      R
Sbjct: 145 AGFISAIPTTLVTAPTERVKVVLQTTQGK--ASFLDAAKQIVRTQGFQSLFKGSLATLSR 202

Query: 178 QIPYTMCKFTSFERIVEMIYAKLPRSKQEMSPSQQIGVSFVGGYLAGILCAVVSHPADVM 237
             P +   F S+E   E +      +  E+S    I    + G +AG+   VV  P D +
Sbjct: 203 DGPGSALYFASYEICKEYLNKASGHTSGELS----ITNVCISGGMAGVSMWVVVFPIDTV 258

Query: 238 VSKVNADRKQGESMVEASKRIY-SRIGFGGLWNGL 271
            +++ +  K+ +SM+E ++ IY +R G  G + G+
Sbjct: 259 KTQLQSSSKR-QSMLEVTRMIYNTRGGIKGFFPGV 292

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 46/184 (25%), Positives = 73/184 (39%), Gaps = 6/184 (3%)

Query: 22  GVVACGPTHSSVTPLDLVKCRLQVNPQLYRSNLDGWKTIVRSEGLSKVFTGVGATFIGYS 81
           G ++  PT     P + VK  LQ   Q   S LD  K IVR++G   +F G  AT     
Sbjct: 146 GFISAIPTTLVTAPTERVKVVLQTT-QGKASFLDAAKQIVRTQGFQSLFKGSLATLSRDG 204

Query: 82  LQGACKYGGYEYFKQTYSNLLSPETAHRHRTAVYLCASASAEFLADILLCPWEAIKVKQQ 141
              A  +  YE  K+ Y N  S  T+          +   A     +++ P + +K + Q
Sbjct: 205 PGSALYFASYEICKE-YLNKASGHTSGELSITNVCISGGMAGVSMWVVVFPIDTVKTQLQ 263

Query: 142 TTIPPFCKNFLEGWSKI-TAAEGLSGLYKGITPLWCRQIPYTMCKFTSFERIVEMIYAKL 200
           ++     ++ LE    I     G+ G + G+ P   R  P     F   E +   ++ K 
Sbjct: 264 SSSKR--QSMLEVTRMIYNTRGGIKGFFPGVGPAILRSFPANAATFLGVE-LTHSLFKKF 320

Query: 201 PRSK 204
            + K
Sbjct: 321 EQQK 324

>YPL134C (ODC1) [5311] chr16 complement(298570..299502)
           2-Oxodicarboxylate transporter, has specificity for
           2-oxoadipate and 2-oxoglutarate, member of the
           mitochondrial carrier (MCF) family of membrane
           transporters [933 bp, 310 aa]
          Length = 310

 Score = 60.1 bits (144), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 58/265 (21%), Positives = 110/265 (41%), Gaps = 31/265 (11%)

Query: 35  PLDLVKCRLQVN---------------PQLYRSNLDGWKTIVRSEGLSKVFTGVGATFIG 79
           PLD+VK R+Q+                   Y   +D    IV+ EG S ++ G+ +  + 
Sbjct: 31  PLDVVKTRMQLQVTTKGHPAVVAAKAAVDHYTGVMDCLTKIVKKEGFSHLYKGITSPILM 90

Query: 80  YSLQGACKYGGYEYFKQTYSNLL-SPETAHRHRTAVYLCASASAEFLADILLCPWEAIKV 138
            + + A K+ G + F+  Y  +  +P      + A+Y  ASA A  +   ++ P+E +K+
Sbjct: 91  EAPKRAIKFSGNDTFQTFYKKIFPTPNGEMTQKIAIYSGASAGA--VEAFVVAPFELVKI 148

Query: 139 KQQTTIPPFCKNFLEGWSKITAAEGLSGLYKGITPLWCRQIPYTMCKFTSFERIVEMIYA 198
           + Q     F K  +E         G+  L+ G+     R + +    F     I+  I  
Sbjct: 149 RLQDVNSQF-KTPIEVVKNSVVKGGVLSLFNGLEATIWRHVLWNAGYFG----IIFQIRK 203

Query: 199 KLPRSKQEMSPSQQIGVSFVGGYLAGILCAVVSHPADVMVSKVNAD----RKQGESMVEA 254
            LP +K     ++      + G + G +  +++ P DV+ S++       RK   S+  +
Sbjct: 204 LLPAAKTSTEKTRN---DLIAGAIGGTVGCLLNTPFDVVKSRIQRSSGPLRKYNWSL-PS 259

Query: 255 SKRIYSRIGFGGLWNGLPVRIFMIG 279
              +Y   GF  L+ G   ++  + 
Sbjct: 260 VLLVYREEGFKALYKGFAPKVMRLA 284

 Score = 43.5 bits (101), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 48/172 (27%), Positives = 72/172 (41%), Gaps = 19/172 (11%)

Query: 15  YAACTLGGVVACGPTHSSVTPLDLVKCRLQ-VNPQLYRSNLDGWKTIVRSEGLSKVFTGV 73
           Y+  + G V A       V P +LVK RLQ VN Q +++ ++  K  V   G+  +F G+
Sbjct: 127 YSGASAGAVEAF-----VVAPFELVKIRLQDVNSQ-FKTPIEVVKNSVVKGGVLSLFNGL 180

Query: 74  GATFIGYSLQGACKYGGYEYFKQTYSNLLSPETAHRHRTAVYLCASASAEFLADILLCPW 133
            AT   + L  A  +G     ++    LL        +T   L A A    +  +L  P+
Sbjct: 181 EATIWRHVLWNAGYFGIIFQIRK----LLPAAKTSTEKTRNDLIAGAIGGTVGCLLNTPF 236

Query: 134 EAIKVKQQTTIPPFCKNFLEGWS-----KITAAEGLSGLYKGITPLWCRQIP 180
           + +K + Q +  P  K     WS      +   EG   LYKG  P   R  P
Sbjct: 237 DVVKSRIQRSSGPLRK---YNWSLPSVLLVYREEGFKALYKGFAPKVMRLAP 285

>YBR192W (RIM2) [375] chr2 (607609..608742) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters, required for respiration [1134 bp, 377 aa]
          Length = 377

 Score = 60.1 bits (144), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 43/184 (23%), Positives = 92/184 (50%), Gaps = 22/184 (11%)

Query: 34  TPLDLVKCRLQVNP------QLYRSNLDGWKTIVRSEGLSKVFTGVGATFIGYSLQGACK 87
            P+ L+K R+Q++       + Y+++ D  K+++R+EG + ++ G+ A+++G S++G  +
Sbjct: 194 NPIWLIKTRVQLDKAGKTSVRQYKNSWDCLKSVIRNEGFTGLYKGLSASYLG-SVEGILQ 252

Query: 88  YGGYEYFKQT----------YSNLLSPETAHRHRTAVYLCASAS-AEFLADILLCPWEAI 136
           +  YE  K+           Y    +  T+ + +       SA  A+F+A I   P E +
Sbjct: 253 WLLYEQMKRLIKERSIEKFGYQAEGTKSTSEKVKEWCQRSGSAGLAKFVASIATYPHEVV 312

Query: 137 KVKQQTTIPPFCKN----FLEGWSKITAAEGLSGLYKGITPLWCRQIPYTMCKFTSFERI 192
           + + + T     K      ++ +  I   EGL  +Y G+TP   R +P ++  F ++E +
Sbjct: 313 RTRLRQTPKENGKRKYTGLVQSFKVIIKEEGLFSMYSGLTPHLMRTVPNSIIMFGTWEIV 372

Query: 193 VEMI 196
           + ++
Sbjct: 373 IRLL 376

 Score = 30.8 bits (68), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 59/301 (19%), Positives = 110/301 (36%), Gaps = 59/301 (19%)

Query: 35  PLDLVKCRLQVNPQL-----------------------------YRSNLDGWKTIVRSEG 65
           P DLVK RLQ +  L                             ++  L     + + EG
Sbjct: 72  PFDLVKTRLQSDIFLKAYKSQAVNISKGSTRPKSINYVIQAGTHFKETLGIIGNVYKQEG 131

Query: 66  LSKVFTGVGATFIGYSLQGACKYGGYEYFKQTYSNLLSPETAHRHRTAVYLCASASAEFL 125
              +F G+G   +G     +  +  Y   K  Y+   +     +    ++L A+A+A + 
Sbjct: 132 FRSLFKGLGPNLVGVIPARSINFFTYGTTKDMYAKAFN---NGQETPMIHLMAAATAGWA 188

Query: 126 ADILLCPWEAIKVKQQ------TTIPPFCKNFLEGWSKITAAEGLSGLYKGITPLWCRQI 179
                 P   IK + Q      T++  + KN  +    +   EG +GLYKG++  +   +
Sbjct: 189 TATATNPIWLIKTRVQLDKAGKTSVRQY-KNSWDCLKSVIRNEGFTGLYKGLSASYLGSV 247

Query: 180 P-------YTMCKFTSFERIVEMIYAKLPRSKQEMSPSQQIGVSFVGGYLAGILCAVVSH 232
                   Y   K    ER +E    +   +K      ++         LA  + ++ ++
Sbjct: 248 EGILQWLLYEQMKRLIKERSIEKFGYQAEGTKSTSEKVKEWCQRSGSAGLAKFVASIATY 307

Query: 233 PADVMVSKVNADRKQG-----ESMVEASKRIYSRIGFGGLWNGL--------PVRIFMIG 279
           P +V+ +++    K+        +V++ K I    G   +++GL        P  I M G
Sbjct: 308 PHEVVRTRLRQTPKENGKRKYTGLVQSFKVIIKEEGLFSMYSGLTPHLMRTVPNSIIMFG 367

Query: 280 T 280
           T
Sbjct: 368 T 368

>CAGL0M05225g 563163..564308 highly similar to sp|P38127
           Saccharomyces cerevisiae YBR192w RIM2 mitochondrial
           carrier protein, start by similarity
          Length = 381

 Score = 60.1 bits (144), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 43/182 (23%), Positives = 92/182 (50%), Gaps = 20/182 (10%)

Query: 34  TPLDLVKCRLQVNP----QLYRSNLDGWKTIVRSEGLSKVFTGVGATFIGYSLQGACKYG 89
            P+ +VK R+Q++     + Y+++ D  K+I+R+EG+  ++ G+ A+++G S++G  ++ 
Sbjct: 198 NPIWMVKTRVQLDKAGKTRTYKNSYDCLKSILRNEGIYGLYRGLSASYLG-SVEGILQWL 256

Query: 90  GYEYFKQTYSNL-LSPETAHRHRTAVYL------CASAS----AEFLADILLCPWEAIKV 138
            YE  K       +    AH   T          C  +     A+F+A I+  P E ++ 
Sbjct: 257 LYEQLKHLIKKRSIEKFGAHDESTMTTTDKIKQWCQRSGGAGLAKFMASIVTYPHEVVRT 316

Query: 139 KQQTTIPPFCK----NFLEGWSKITAAEGLSGLYKGITPLWCRQIPYTMCKFTSFERIVE 194
           + + +     K      ++ +  I   EGL+ +Y G+TP   R +P ++  F ++E +++
Sbjct: 317 RLRQSPLENGKVKYTGLVQSFRVIIKEEGLASMYSGLTPHLMRTVPNSIIMFGTWEVVIK 376

Query: 195 MI 196
           ++
Sbjct: 377 LL 378

 Score = 33.5 bits (75), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 57/298 (19%), Positives = 108/298 (36%), Gaps = 55/298 (18%)

Query: 35  PLDLVKCRLQVN--PQLYRSNLDGWK---------------------------TIVRSEG 65
           P DLVK RLQ +    +Y+S  +                               + R EG
Sbjct: 76  PFDLVKTRLQSDIYQNMYKSQAEALMMNTTRPRIVNLTLQAATHFKETVSIIGNVYRQEG 135

Query: 66  LSKVFTGVGATFIGYSLQGACKYGGYEYFKQTYSNLLSPETAHRHRTAVYLCASASAEFL 125
              +F G+G   +G     +  +  Y   K  YS   +     +    ++L A+A+A + 
Sbjct: 136 FRSLFKGLGPNLVGVIPARSINFFTYGTTKDIYSKAFN---NGQEAPWIHLMAAATAGWA 192

Query: 126 ADILLCPWEAIKVKQQTTIPPFCKNFLEGWS---KITAAEGLSGLYKGITPLWCRQIP-- 180
                 P   +K + Q       + +   +     I   EG+ GLY+G++  +   +   
Sbjct: 193 TATATNPIWMVKTRVQLDKAGKTRTYKNSYDCLKSILRNEGIYGLYRGLSASYLGSVEGI 252

Query: 181 -----YTMCKFTSFERIVEMIYAKLPRSKQEMSPSQQIGVSFVGGYLAGILCAVVSHPAD 235
                Y   K    +R +E   A    +       +Q      G  LA  + ++V++P +
Sbjct: 253 LQWLLYEQLKHLIKKRSIEKFGAHDESTMTTTDKIKQWCQRSGGAGLAKFMASIVTYPHE 312

Query: 236 VMVSKVNAD-----RKQGESMVEASKRIYSRIGFGGLWNGL--------PVRIFMIGT 280
           V+ +++        + +   +V++ + I    G   +++GL        P  I M GT
Sbjct: 313 VVRTRLRQSPLENGKVKYTGLVQSFRVIIKEEGLASMYSGLTPHLMRTVPNSIIMFGT 370

>YDL198C (GGC1) [676] chr4 complement(103650..104552) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters, overexpression suppresses loss of Abf2p
           [903 bp, 300 aa]
          Length = 300

 Score = 59.3 bits (142), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 69/274 (25%), Positives = 109/274 (39%), Gaps = 29/274 (10%)

Query: 35  PLDLVKCRLQVNPQLYRSNLDGWKTIVR---SEGLSK----VFTGVGATFIGYSLQGACK 87
           P+D +  RL  N     S  +  + I R   SE L K    +F G+G       LQ   K
Sbjct: 30  PVDTISKRLMSNHTKITSGQELNRVIFRDHFSEPLGKRLFTLFPGLGYAASYKVLQRVYK 89

Query: 88  YGGY--------EYFKQTYSNLLSPETAHRHRTAVYLCASASAEFLADILLCPWEAIKVK 139
           YGG         +++K+ + NL   +T    R+A    A+ S   + +I+L P + +K+K
Sbjct: 90  YGGQPFANEFLNKHYKKDFDNLFGEKTGKAMRSA----AAGSLIGIGEIVLLPLDVLKIK 145

Query: 140 QQTTIPPFCKNFLEGWSKITAAEGLSGLYKGITPLWCRQIPYTMCKFTSFERIVEMIYAK 199
           +QT    F      G+ KI   EGL  LY+G      R  P +   F       E I   
Sbjct: 146 RQTNPESFKG---RGFIKILRDEGLFNLYRGWGWTAARNAPGSFALFGGNAFAKEYILGL 202

Query: 200 LPRSKQEMSPSQQIGVSFVGGYLAGILCAVVSHPADVMVSKV-NADRKQGESMVEASKRI 258
              S+   S       +F+   +      +VS P DV+ +++ N +    ES +   K  
Sbjct: 203 KDYSQATWSQ------NFISSIVGACSSLIVSAPLDVIKTRIQNRNFDNPESGLRIVKNT 256

Query: 259 YSRIGFGGLWNGLPVRIFMIGTLTSFQWLIYDSF 292
               G    + GL  ++   G    F + +  S 
Sbjct: 257 LKNEGVTAFFKGLTPKLLTTGPKLVFSFALAQSL 290

>CAGL0L05742g complement(630844..631761) similar to sp|P10566
           Saccharomyces cerevisiae YJL133w MRS3 or sp|P23500
           Saccharomyces cerevisiae YKR052c MRS4, start by
           similarity
          Length = 305

 Score = 59.3 bits (142), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 70/303 (23%), Positives = 121/303 (39%), Gaps = 49/303 (16%)

Query: 20  LGGVVACGPTHSSVTPLDLVKCRLQVNPQLYRSN--------LDGWKTIVRSEGLSKVFT 71
           + G  A    HS + PLD +K RLQ    +  +         L    +I   EG   ++ 
Sbjct: 23  MAGAFAGIAEHSVIFPLDALKTRLQAMHAISTTGGQPIPSTMLRQLSSISAQEGSMVLWK 82

Query: 72  GVGATFIGYSLQGACKYGGYEYFKQTYSNLLSPETA----HRHRTAVYLCASASAEFLAD 127
           GV +  +G     A  +  YE  K   S L+   T+    H  +TA    + A+A   AD
Sbjct: 83  GVQSVLLGAGPAHAVYFATYEMVK---SFLIDEATSTSKYHFFKTAF---SGATATIAAD 136

Query: 128 ILLCPWEAIKVKQQTTIPPFCKNFLEGWS---KITAAEGLSGLYKGITPLWCRQIPYTMC 184
            L+ P++ IK + Q          +  W    +I + EG    Y          IP+   
Sbjct: 137 ALMNPFDVIKQRIQ------LNTNISVWDTAKRIYSKEGFQAFYSSYPTTLAINIPFAAF 190

Query: 185 KFTSFERIVEMIYAKLPRSKQEMSPSQQIG--VSFVGGYLAGILCAVVSHPADVMVS--- 239
            F  ++            + +  +PS      +  + G ++G  CA ++ P D + +   
Sbjct: 191 NFGIYDT-----------ATRYFNPSGVYNPFIHCLCGGISGAACAGLTTPLDCIKTALQ 239

Query: 240 -----KVNADR-KQGESMVEASKRIYSRIGFGGLWNGLPVRIFMIGTLTSFQWLIYDSFK 293
                KV+ +  KQ ++  +A++ IY   G+ G W+G+  RI      T+  W  Y+  K
Sbjct: 240 VRGSEKVSMEVFKQADTFKKATRAIYQVYGWRGFWSGVKPRILANMPATAISWTAYEFAK 299

Query: 294 AYI 296
            ++
Sbjct: 300 HFL 302

 Score = 32.0 bits (71), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 40/187 (21%), Positives = 71/187 (37%), Gaps = 14/187 (7%)

Query: 11  SPEYYAACTLGGVVACGPTHSSVTPLDLVKCRLQVNPQLYRSNLDGWKTIVRSEGLSKVF 70
           S  ++      G  A     + + P D++K R+Q+N  +  S  D  K I   EG    +
Sbjct: 117 SKYHFFKTAFSGATATIAADALMNPFDVIKQRIQLNTNI--SVWDTAKRIYSKEGFQAFY 174

Query: 71  TGVGATFIGYSLQGACKYGGYEYFKQTYSNLLSPETAHRHRTAVYLCASASAEFLADI-- 128
           +    T        A  +G Y+    T +   +P   +       LC   S    A +  
Sbjct: 175 SSYPTTLAINIPFAAFNFGIYD----TATRYFNPSGVYNPFIHC-LCGGISGAACAGLTT 229

Query: 129 -LLCPWEAIKVK--QQTTIPPF--CKNFLEGWSKITAAEGLSGLYKGITPLWCRQIPYTM 183
            L C   A++V+  ++ ++  F     F +    I    G  G + G+ P     +P T 
Sbjct: 230 PLDCIKTALQVRGSEKVSMEVFKQADTFKKATRAIYQVYGWRGFWSGVKPRILANMPATA 289

Query: 184 CKFTSFE 190
             +T++E
Sbjct: 290 ISWTAYE 296

>ACR260W [1307] [Homologous to ScYJL133W (MRS3) - SH; ScYKR052C
           (MRS4) - SH] complement(823895..824830) [936 bp, 311 aa]
          Length = 311

 Score = 59.3 bits (142), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 68/307 (22%), Positives = 123/307 (40%), Gaps = 42/307 (13%)

Query: 5   QPIPLFSPEYY--AACTLGGVVACGPTHSSVTPLDLVKCRLQ--------VNPQLYRSNL 54
           + +P  +P  Y  AA    G++     HS + P+D +K R+Q           +L  + L
Sbjct: 9   EALPENAPLVYQLAAGAFAGIM----EHSIMFPIDAIKTRMQAVSTTGSSAATRLPSNML 64

Query: 55  DGWKTIVRSEGLSKVFTGVGATFIGYSLQGACKYGGYEYFKQTYSNLLSPETAHRHRTAV 114
                I  +EG   ++ GV +  +G     A  +  YE  K   S L+ PE    H+   
Sbjct: 65  AQIAKISTTEGSLALWKGVQSVVLGAGPAHAVYFATYEMCK---SRLIDPEDRQTHQPLK 121

Query: 115 YLCASASAEFLADILLCPWEAIKVKQQTTIPPFCKNFLEGWSKITAAEGLSGLYKGITPL 174
              +   A   AD L+ P++ I  KQ+  + P   +  +   ++   EG++  +      
Sbjct: 122 TALSGTLATVAADALMNPFDTI--KQRLQLHP-SDSMTKCAVRMYQREGIAAFFYSYPTT 178

Query: 175 WCRQIPYTMCKFTSFERIVEMIYAKLPRSKQEMSPSQQIG--VSFVGGYLAGILCAVVSH 232
               IP+    F  +E            S +  +PS      +  + G ++G  CA ++ 
Sbjct: 179 IAMNIPFAALNFVIYE-----------SSTKIFNPSNNYNPWIHCLCGGISGATCAAITT 227

Query: 233 PADVMVSKVN---ADR------KQGESMVEASKRIYSRIGFGGLWNGLPVRIFMIGTLTS 283
           P D + + +    AD       K+ ++  +A+  I+   G+ G + GL  RI      T+
Sbjct: 228 PLDCVKTVLQIRGADSVQSQLFKEADTFRKAASAIHKTYGWSGFFRGLKPRIISNMPATA 287

Query: 284 FQWLIYD 290
             W  Y+
Sbjct: 288 ISWTSYE 294

 Score = 48.5 bits (114), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 44/190 (23%), Positives = 79/190 (41%), Gaps = 29/190 (15%)

Query: 116 LCASASAEFLADILLCPWEAIKVKQQ----------TTIPPFCKNFLEGWSKITAAEGLS 165
           L A A A  +   ++ P +AIK + Q          T +P    N L   +KI+  EG  
Sbjct: 21  LAAGAFAGIMEHSIMFPIDAIKTRMQAVSTTGSSAATRLP---SNMLAQIAKISTTEGSL 77

Query: 166 GLYKGITPLWCRQIPYTMCKFTSFE----RIVEMIYAKLPRSKQEMSPSQQIGVSFVGGY 221
            L+KG+  +     P     F ++E    R+++      P  +Q   P +    + + G 
Sbjct: 78  ALWKGVQSVVLGAGPAHAVYFATYEMCKSRLID------PEDRQTHQPLK----TALSGT 127

Query: 222 LAGILCAVVSHPADVMVSKVNADRKQGESMVEASKRIYSRIGFGGLWNGLPVRIFMIGTL 281
           LA +    + +P D +  ++       +SM + + R+Y R G    +   P  I M    
Sbjct: 128 LATVAADALMNPFDTIKQRLQL--HPSDSMTKCAVRMYQREGIAAFFYSYPTTIAMNIPF 185

Query: 282 TSFQWLIYDS 291
            +  ++IY+S
Sbjct: 186 AALNFVIYES 195

 Score = 32.3 bits (72), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 40/186 (21%), Positives = 76/186 (40%), Gaps = 16/186 (8%)

Query: 20  LGGVVACGPTHSSVTPLDLVKCRLQVNPQLYRSNLDGWKTIVRSEGLSKVFTGVGATFIG 79
           L G +A     + + P D +K RLQ++P    S       + + EG++  F     T   
Sbjct: 124 LSGTLATVAADALMNPFDTIKQRLQLHPS--DSMTKCAVRMYQREGIAAFFYSYPTTIAM 181

Query: 80  YSLQGACKYGGYEYFKQTYSNLLSPETAHRHRTAVY-LCASASAEFLADI---LLCPWEA 135
                A  +  YE    + + + +P  ++ +   ++ LC   S    A I   L C    
Sbjct: 182 NIPFAALNFVIYE----SSTKIFNP--SNNYNPWIHCLCGGISGATCAAITTPLDCVKTV 235

Query: 136 IKVKQ----QTTIPPFCKNFLEGWSKITAAEGLSGLYKGITPLWCRQIPYTMCKFTSFER 191
           ++++     Q+ +      F +  S I    G SG ++G+ P     +P T   +TS+E 
Sbjct: 236 LQIRGADSVQSQLFKEADTFRKAASAIHKTYGWSGFFRGLKPRIISNMPATAISWTSYEF 295

Query: 192 IVEMIY 197
              +++
Sbjct: 296 AKHLLF 301

>Sklu_2127.5 YOR130C, Contig c2127 7354-8190 reverse complement
          Length = 278

 Score = 58.5 bits (140), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 62/249 (24%), Positives = 107/249 (42%), Gaps = 24/249 (9%)

Query: 35  PLDLVKCRLQVNP-QLYRSNLDGWKTIVRSEGLSKVF-TGVGATFIGYSLQGACKYGGYE 92
           P D VK RLQ  P  ++ +     K    +EGL + F  G+G+   G +L+ A  +  + 
Sbjct: 26  PFDTVKVRLQTQPAHMFPTTWSCIKFTYDNEGLWRGFYQGIGSPLAGAALENAVLFVSFN 85

Query: 93  YFKQ--TYSNLLSPETAHRHRTAVYLCASASAEFLADILLCPWEAIKVKQQ----TTIPP 146
             K+     +LLSP +         + A A A   A  +L P E IK K Q    +T   
Sbjct: 86  QAKRLLDVESLLSPLSKT-------VWAGAFAGACASFVLTPVELIKCKLQVSNLSTTKT 138

Query: 147 FCKNFLEGWSKITAAEGLSGLYKGITPLWCRQIPYTMCKFTSFERIVEMIYAKLPRSKQE 206
                L     + +  G  GL++G +  + R+       FT++E +   + +   R + E
Sbjct: 139 SHTKILPTIKSVLSERGFLGLWQGQSGTFIRESGGGAAWFTTYEVVKNYLAS---RRQAE 195

Query: 207 MSPSQQIGVSFVGGYLAGILCAVVSHPADVMVSKVNADRKQGESMVEASKRIYSRIGFGG 266
            + + ++      G  AG+       PAD + S +  D      +  A+++IY+R G  G
Sbjct: 196 QNTTWEL---LASGASAGLAFNASIFPADTIKSTMQTDHID---LSSATRKIYARQGIAG 249

Query: 267 LWNGLPVRI 275
            + GL + +
Sbjct: 250 FYRGLGITL 258

 Score = 54.3 bits (129), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 46/165 (27%), Positives = 77/165 (46%), Gaps = 12/165 (7%)

Query: 33  VTPLDLVKCRLQV-NPQLYRSN----LDGWKTIVRSEGLSKVFTGVGATFIGYSLQGACK 87
           +TP++L+KC+LQV N    +++    L   K+++   G   ++ G   TFI  S  GA  
Sbjct: 118 LTPVELIKCKLQVSNLSTTKTSHTKILPTIKSVLSERGFLGLWQGQSGTFIRESGGGAAW 177

Query: 88  YGGYEYFKQTYSNLLSPETAHRHRTAVYLCASASAEFLADILLCPWEAIKVKQQTTIPPF 147
           +  YE  K   + L S   A ++ T   L + ASA    +  + P + IK   QT     
Sbjct: 178 FTTYEVVK---NYLASRRQAEQNTTWELLASGASAGLAFNASIFPADTIKSTMQTD---- 230

Query: 148 CKNFLEGWSKITAAEGLSGLYKGITPLWCRQIPYTMCKFTSFERI 192
             +      KI A +G++G Y+G+     R +P     F ++E +
Sbjct: 231 HIDLSSATRKIYARQGIAGFYRGLGITLIRAVPANAAIFYTYETL 275

>Scas_669.6
          Length = 373

 Score = 58.9 bits (141), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 58/245 (23%), Positives = 105/245 (42%), Gaps = 29/245 (11%)

Query: 18  CTLGGVVACGPTHSSVTPLDLVKCRLQVNPQL--YRSNLDGWKTIVRSEGLSK-VFTGVG 74
           C L G +      SS+  LD VK R Q  P    Y++    ++TI   EG+++ ++ G  
Sbjct: 54  CVLAGGIGGIIGDSSMHSLDTVKTRQQGAPMTPKYKNMTTAYRTIFLEEGIARGLYGGYF 113

Query: 75  ATFIGYSLQGACKYGGYEYFKQTYSNLLSPETAHRHRTAVYLCASASAEFLADILLCPWE 134
           A  +G     A  +G YE+ K+     L       + T  +L A    +F++  +  P E
Sbjct: 114 AAMLGSFPSAAIFFGTYEWCKRKMIGDLG-----FNDTVSHLSAGLLGDFVSSFVYVPSE 168

Query: 135 AIKVK---QQTTIPPFCKNFLEGWSK---------ITAAEGLSGLYKGITPLWCRQIPYT 182
            +K +   Q     PF   F  G++          I   EG+  L+ G      R +P++
Sbjct: 169 VLKTRLQLQGRVNNPF---FQSGYNYRSLRTAIRIIVNTEGVKALFFGYKATLARDLPFS 225

Query: 183 MCKFTSFERIVEMIY--AKLPRSKQEMSPSQQIGVSFVGGYLAGILCAVVSHPADVMVSK 240
             +F  +E+  +  +   K   +K  +S   +I      G +AG L  +++ P DV+ ++
Sbjct: 226 ALQFGFYEKFRQTAFKLEKKDITKHNLSIPNEI----FTGAIAGGLAGIITTPMDVIKTR 281

Query: 241 VNADR 245
           +   +
Sbjct: 282 LQTQQ 286

 Score = 32.3 bits (72), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 25/90 (27%), Positives = 37/90 (41%), Gaps = 25/90 (27%)

Query: 22  GVVACGPTHSSVTPLDLVKCRLQ-----VNPQ--------------------LYRSNLDG 56
           G +A G      TP+D++K RLQ     +NP                     L  S    
Sbjct: 261 GAIAGGLAGIITTPMDVIKTRLQTQQADINPNSATTVGAISAKTNKKSRPIVLSNSIFRS 320

Query: 57  WKTIVRSEGLSKVFTGVGATFIGYSLQGAC 86
            K + +SEG+   F+GVG  F+  S+Q + 
Sbjct: 321 LKLVYQSEGVIGFFSGVGPRFVWTSVQSSI 350

>Scas_691.4
          Length = 334

 Score = 58.2 bits (139), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 60/294 (20%), Positives = 114/294 (38%), Gaps = 43/294 (14%)

Query: 35  PLDLVKCRLQVNPQLYRSNLDGWKTIVRS----EGLSKVFTGVGATFIGYSLQGACKYGG 90
           PLD +K R+Q+  +       G+ T  R+    EG   ++ G+GA  IG   + A ++  
Sbjct: 33  PLDTIKVRMQIAKRTEGMRPHGFITTGRNIYSHEGFLALYKGLGAVVIGIIPKMAIRFSS 92

Query: 91  YEYFKQTYSNLLSPETAHRHRTAVYLCASASAEFLADILLCPWEAIKVKQQ--------- 141
           YE+++     L   ET        +L    +    A +++ P E +K++ Q         
Sbjct: 93  YEFYRNA---LTDKETRTITTGNTFLAGVGAGITEAVLVVNPMEVVKIRLQAQHLNDLIP 149

Query: 142 ------------TTIPPFCKNFLEGWSKITAAEGLSGLYKGITPLWCRQIPYTMCKFTSF 189
                       T   P   N +     I   EG   LY+G++    RQ       FT +
Sbjct: 150 QPAGVSAAGTAATVTKPKYANAIHAAYTIVKEEGAGALYRGVSLTAARQATNQGANFTVY 209

Query: 190 ERIVEMIYAKLPRSKQEMSPSQQIGVSFVGGYLAGILCAVVSHPADVMVSKVNADRKQGE 249
             + + +     R   E  PS +       G ++G +    + P D + +++  D+    
Sbjct: 210 SYLKDYLQKYHNR---ESLPSWETSCI---GLISGAIGPFSNAPLDTIKTRLQKDKSISS 263

Query: 250 SMVEASKRIY-------SRIGFGGLWNGLPVRIFMIGTLTSFQWLIYDSFKAYI 296
           +   A K+IY          GF  L+ G+  R+  +    +  + +Y+  + ++
Sbjct: 264 N--SAWKKIYIIGTQLIKEEGFRALYKGITPRVMRVAPGQAVTFTVYEFVRKHL 315

 Score = 41.2 bits (95), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 53/193 (27%), Positives = 69/193 (35%), Gaps = 47/193 (24%)

Query: 33  VTPLDLVKCRLQVN------PQ----------------LYRSNLDGWKTIVRSEGLSKVF 70
           V P+++VK RLQ        PQ                 Y + +    TIV+ EG   ++
Sbjct: 129 VNPMEVVKIRLQAQHLNDLIPQPAGVSAAGTAATVTKPKYANAIHAAYTIVKEEGAGALY 188

Query: 71  TGVGATFIGYSLQGACKYGGYEYFK---QTYSN---LLSPETAHRHRTAVYLCASASAEF 124
            GV  T    +      +  Y Y K   Q Y N   L S ET     + + L + A   F
Sbjct: 189 RGVSLTAARQATNQGANFTVYSYLKDYLQKYHNRESLPSWET-----SCIGLISGAIGPF 243

Query: 125 LADILLCPWEAIKVKQQTTIPPFCKNFLEGWSKI-------TAAEGLSGLYKGITPLWCR 177
                  P + IK + Q        N    W KI          EG   LYKGITP   R
Sbjct: 244 SN----APLDTIKTRLQKD-KSISSN--SAWKKIYIIGTQLIKEEGFRALYKGITPRVMR 296

Query: 178 QIPYTMCKFTSFE 190
             P     FT +E
Sbjct: 297 VAPGQAVTFTVYE 309

 Score = 32.7 bits (73), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 21/83 (25%), Positives = 39/83 (46%), Gaps = 4/83 (4%)

Query: 215 VSFVGGYLAGILCAVVSHPADVMVSKVN-ADRKQG---ESMVEASKRIYSRIGFGGLWNG 270
           ++ V G  AG+  A+  HP D +  ++  A R +G      +   + IYS  GF  L+ G
Sbjct: 15  INLVAGGTAGLFEALCCHPLDTIKVRMQIAKRTEGMRPHGFITTGRNIYSHEGFLALYKG 74

Query: 271 LPVRIFMIGTLTSFQWLIYDSFK 293
           L   +  I    + ++  Y+ ++
Sbjct: 75  LGAVVIGIIPKMAIRFSSYEFYR 97

>ACR109W [1156] [Homologous to ScYOR222W (ODC2) - SH; ScYPL134C
           (ODC1) - SH] complement(546745..547644) [900 bp, 299 aa]
          Length = 299

 Score = 57.8 bits (138), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 60/257 (23%), Positives = 112/257 (43%), Gaps = 24/257 (9%)

Query: 35  PLDLVKCRLQVNPQ-----LYRSNLDGWKTIVRSEGLSKVFTGVGATFIGYSLQGACKYG 89
           PLD+VK R+Q+  Q      Y   +D  K IV  EG+ +++ G+ +  +  + + A K+ 
Sbjct: 31  PLDVVKTRMQLQVQGGAGPHYTGVVDCLKKIVAGEGVGRLYKGISSPILMEAPKRATKFA 90

Query: 90  GYEYFKQTYSNLLSPETAHRHRTAVYLCASASAEFLADILLCPWEAIKVKQQTTIPPFCK 149
             + F++ Y      E   +    + + A ASA  +   ++ P+E +K++ Q     + K
Sbjct: 91  CNDEFQKLYKQAFGVE---KLSQPLSMLAGASAGCVEAFVVVPFELVKIRLQDASSSY-K 146

Query: 150 NFLEGWSKITAAEGLSGLYKGITPLWCRQIPYTMCKFTSFERIVEMIYAKLPRSKQEMSP 209
             ++   KI A EG+  +Y G+     R   +    F     I+    A LP +  +   
Sbjct: 147 GPVDVVRKIVAREGVLAMYNGLESTLWRHALWNGGYFG----IIFQARALLPAAHNK--- 199

Query: 210 SQQIGVSFVGGYLAGILCAVVSHPADVMVSKVNAD-------RKQGESMVEASKRIYSRI 262
           +Q I    +   +   +  ++S P DV+ S++          RK   S+  +   IY   
Sbjct: 200 TQCITNDLISDSIGCSIGCMLSTPFDVVKSRIQNTAVIPGVVRKYNWSL-PSLLTIYREE 258

Query: 263 GFGGLWNGLPVRIFMIG 279
           GF  L+ G   ++  +G
Sbjct: 259 GFRALYKGFVPKVLRLG 275

 Score = 43.1 bits (100), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 43/157 (27%), Positives = 66/157 (42%), Gaps = 17/157 (10%)

Query: 33  VTPLDLVKCRLQVNPQLYRSNLDGWKTIVRSEGLSKVFTGVGATFIGYSLQGACKYGGYE 92
           V P +LVK RLQ     Y+  +D  + IV  EG+  ++ G+ +T   ++L      GG  
Sbjct: 128 VVPFELVKIRLQDASSSYKGPVDVVRKIVAREGVLAMYNGLESTLWRHALWN----GG-- 181

Query: 93  YFKQTYSNLLSPETAHRHRTAVY--LCASASAEFLADILLCPWEAIKVKQQTT--IPPFC 148
           YF   +        AH     +   L + +    +  +L  P++ +K + Q T  IP   
Sbjct: 182 YFGIIFQARALLPAAHNKTQCITNDLISDSIGCSIGCMLSTPFDVVKSRIQNTAVIPGVV 241

Query: 149 KNFLEGWS-----KITAAEGLSGLYKGITPLWCRQIP 180
           + +   WS      I   EG   LYKG  P   R  P
Sbjct: 242 RKY--NWSLPSLLTIYREEGFRALYKGFVPKVLRLGP 276

 Score = 40.0 bits (92), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 36/158 (22%), Positives = 69/158 (43%), Gaps = 10/158 (6%)

Query: 118 ASASAEFLADILLCPWEAIKVKQQTTIP----PFCKNFLEGWSKITAAEGLSGLYKGITP 173
           A A A     +++ P + +K + Q  +     P     ++   KI A EG+  LYKGI+ 
Sbjct: 17  AGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYTGVVDCLKKIVAGEGVGRLYKGISS 76

Query: 174 LWCRQIPYTMCKFTSFERIVEMIYAKLPRSKQEMSPSQQIGVSFVGGYLAGILCAVVSHP 233
               + P    KF   +   + +Y +    ++   P     +S + G  AG + A V  P
Sbjct: 77  PILMEAPKRATKFACNDEF-QKLYKQAFGVEKLSQP-----LSMLAGASAGCVEAFVVVP 130

Query: 234 ADVMVSKVNADRKQGESMVEASKRIYSRIGFGGLWNGL 271
            +++  ++       +  V+  ++I +R G   ++NGL
Sbjct: 131 FELVKIRLQDASSSYKGPVDVVRKIVAREGVLAMYNGL 168

 Score = 28.5 bits (62), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 20/82 (24%), Positives = 39/82 (47%), Gaps = 5/82 (6%)

Query: 217 FVGGYLAGILCAVVSHPADVMVSKVNADRKQGE-----SMVEASKRIYSRIGFGGLWNGL 271
           F  G +AG+   +V +P DV+ +++    + G       +V+  K+I +  G G L+ G+
Sbjct: 15  FFAGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYTGVVDCLKKIVAGEGVGRLYKGI 74

Query: 272 PVRIFMIGTLTSFQWLIYDSFK 293
              I M     + ++   D F+
Sbjct: 75  SSPILMEAPKRATKFACNDEFQ 96

>YGR257C (MTM1) [2204] chr7 complement(1006210..1007310) Member of
           the mitochondrial carrier family (MCF) of membrane
           transporters [1101 bp, 366 aa]
          Length = 366

 Score = 57.8 bits (138), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 59/248 (23%), Positives = 104/248 (41%), Gaps = 26/248 (10%)

Query: 50  YRSNLDGWKTIVRSEGLSKVFTGVGATFIGYSLQGACKYGGYEYFKQTYSNLLSPETAHR 109
           +   L+ +  I   EG++ ++ G+  T +         + GYEY +      +SP  A  
Sbjct: 102 FNGTLEAFTKIASVEGITSLWRGISLTLLMAIPANMVYFSGYEYIRD-----VSP-IAST 155

Query: 110 HRTAVYLCASASAEFLADILLCPWEAIKVKQQTTIPP---------FCKNFLEGWSKITA 160
           + T   L   A A   A   + P E +K K Q +IP            K+ L    +   
Sbjct: 156 YPTLNPLFCGAIARVFAATSIAPLELVKTKLQ-SIPRSSKSTKTWMMVKDLLNETRQEMK 214

Query: 161 AEGLS-GLYKGITPLWCRQIPYTMCKFTSFERIVEMIYAKLPRSKQEMSPSQQIGVSFVG 219
             G S  L+KG+     R +P++   ++S+E   E ++    R   + +       SF  
Sbjct: 215 MVGPSRALFKGLEITLWRDVPFSAIYWSSYELCKERLWLDSTRFASKDANWVHFINSFAS 274

Query: 220 GYLAGILCAVVSHPADVMVSK------VNADRKQGE---SMVEASKRIYSRIGFGGLWNG 270
           G ++G++ A+ +HP DV  ++       N+D K G    +M +  + I+   G   L+ G
Sbjct: 275 GCISGMIAAICTHPFDVGKTRWQISMMNNSDPKGGNRSRNMFKFLETIWRTEGLAALYTG 334

Query: 271 LPVRIFMI 278
           L  R+  I
Sbjct: 335 LAARVIKI 342

 Score = 37.7 bits (86), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 38/166 (22%), Positives = 65/166 (39%), Gaps = 49/166 (29%)

Query: 33  VTPLDLVKCRLQVNPQLYRSNLDGWKTI---VRSEGLSKVFTGVGATFIGYSLQGACKYG 89
           +TP+D+V+ RLQ    +   + DG   +   V S    K FT VG    G +L  A  + 
Sbjct: 30  LTPMDVVRIRLQQQQMIPDCSCDGAAEVPNAVSSGSKMKTFTNVG----GQNLNNAKIFW 85

Query: 90  GYEYFKQTYSNLLSPETAHRHRTAVYLCASASAEFLADILLCPWEAIKVKQQTTIPPFCK 149
               F++ +                  C ++S +F                         
Sbjct: 86  ESACFQELH------------------CKNSSLKF------------------------N 103

Query: 150 NFLEGWSKITAAEGLSGLYKGITPLWCRQIPYTMCKFTSFERIVEM 195
             LE ++KI + EG++ L++GI+      IP  M  F+ +E I ++
Sbjct: 104 GTLEAFTKIASVEGITSLWRGISLTLLMAIPANMVYFSGYEYIRDV 149

 Score = 36.6 bits (83), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 28/97 (28%), Positives = 46/97 (47%), Gaps = 13/97 (13%)

Query: 15  YAACTLGGVVACGPTHSSVTPLDLVKCRLQV------NPQ---LYRSNLDGWKTIVRSEG 65
           +A+  + G++A   TH    P D+ K R Q+      +P+     R+     +TI R+EG
Sbjct: 272 FASGCISGMIAAICTH----PFDVGKTRWQISMMNNSDPKGGNRSRNMFKFLETIWRTEG 327

Query: 66  LSKVFTGVGATFIGYSLQGACKYGGYEYFKQTYSNLL 102
           L+ ++TG+ A  I      A     YE  K+ + N L
Sbjct: 328 LAALYTGLAARVIKIRPSCAIMISSYEISKKVFGNKL 364

>Kwal_26.7653
          Length = 325

 Score = 57.8 bits (138), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 42/173 (24%), Positives = 78/173 (45%), Gaps = 12/173 (6%)

Query: 34  TPLDLVKCRLQ-------VNPQLYRSNL-DGWKTIVRSEGLSKVFTGVGATFIGYSLQGA 85
           +PL L+K R+Q       +  Q + +++ +G  +I R+EG   ++ GV A  +      +
Sbjct: 149 SPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLYRGVDAAILRTGAGSS 208

Query: 86  CKYGGYEYFKQTYSNLLSPETAHRHRTAVYLCASASAEFLADILLCPWEAIKVKQQTTIP 145
            +   Y     T  + L      +  T ++L AS  + F   +++ PW+ I  +      
Sbjct: 209 VQLPIYN----TAKHFLLKHDLMKEGTGLHLVASTVSGFGVGVVMNPWDVILTRVYNQKG 264

Query: 146 PFCKNFLEGWSKITAAEGLSGLYKGITPLWCRQIPYTMCKFTSFERIVEMIYA 198
              K  L+ + K    EG+  LYKG      R  P+T+   T  E+ ++++YA
Sbjct: 265 NLYKGPLDCFVKTVRIEGIGALYKGFEAQIFRIAPHTILCLTFMEQTMKVVYA 317

 Score = 56.2 bits (134), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 63/279 (22%), Positives = 115/279 (41%), Gaps = 33/279 (11%)

Query: 21  GGVVACGPTHSSVTPLDLVKCRLQVNPQL-------YRSNLDGWKTIVRSEGLSKVFTGV 73
           GG+ AC    +   P++LVK R+Q+  ++       Y++ +   K I ++EG+  +  G+
Sbjct: 31  GGMAACIAV-TVTNPIELVKTRMQLQGEMSADAQRIYKNPMQALKVIFKNEGIRGLQKGL 89

Query: 74  GATFIGYSLQGACKYGGYEYFKQTYSNLLSPETA-HR-HRTAVYLCASASAEFLADILLC 131
              +I        + G YE  +   +    P    H+    AV + + A++  +  I+  
Sbjct: 90  SCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPHKVQNVAVNVVSGATSGIIGAIMGS 149

Query: 132 PW-----------EAIKVKQQTTIPPFCKNFLEGWSKITAAEGLSGLYKGITPLWCRQIP 180
           P             AI++ QQT       +   G S I  AEG  GLY+G+     R   
Sbjct: 150 PLFLIKTRMQSYSNAIQIGQQT----HYTSIWNGLSSIYRAEGFKGLYRGVDAAILRTGA 205

Query: 181 YTMCKFTSFERIVEMIYAKLPRSKQEMSPSQQIGVSFVGGYLAGILCAVVSHPADVMVSK 240
            +  +   +        AK    K ++   +  G+  V   ++G    VV +P DV++++
Sbjct: 206 GSSVQLPIYNT------AKHFLLKHDLM-KEGTGLHLVASTVSGFGVGVVMNPWDVILTR 258

Query: 241 V-NADRKQGESMVEASKRIYSRIGFGGLWNGLPVRIFMI 278
           V N      +  ++   +     G G L+ G   +IF I
Sbjct: 259 VYNQKGNLYKGPLDCFVKTVRIEGIGALYKGFEAQIFRI 297

 Score = 45.8 bits (107), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 45/197 (22%), Positives = 81/197 (41%), Gaps = 19/197 (9%)

Query: 116 LCASASAEFLADILLCPWEAIKVKQQ------TTIPPFCKNFLEGWSKITAAEGLSGLYK 169
             A   A  +A  +  P E +K + Q             KN ++    I   EG+ GL K
Sbjct: 28  FIAGGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQALKVIFKNEGIRGLQK 87

Query: 170 GITPLWCRQIPYTMCKFTSFERIVEMIYAKLPRSKQEMSPS--QQIGVSFVGGYLAGILC 227
           G++  +  QI     +   +E I  ++      +   M P   Q + V+ V G  +GI+ 
Sbjct: 88  GLSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPA---MDPHKVQNVAVNVVSGATSGIIG 144

Query: 228 AVVSHPADVMVSKVNA--------DRKQGESMVEASKRIYSRIGFGGLWNGLPVRIFMIG 279
           A++  P  ++ +++ +         +    S+      IY   GF GL+ G+   I   G
Sbjct: 145 AIMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLYRGVDAAILRTG 204

Query: 280 TLTSFQWLIYDSFKAYI 296
             +S Q  IY++ K ++
Sbjct: 205 AGSSVQLPIYNTAKHFL 221

>Kwal_23.3965
          Length = 307

 Score = 57.4 bits (137), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 44/173 (25%), Positives = 82/173 (47%), Gaps = 12/173 (6%)

Query: 126 ADILLCPWEAIKVKQQTTIPPFCK--NFLEGWSKITAAEGLSGLYKGITPLWCRQIPYTM 183
           A I+  P + +K++ Q  +    +    L  + ++   EG+  L+KG  P     I Y  
Sbjct: 28  ARIVTAPLDTLKIRLQLQLANEAQYGGILVTFKRLVRQEGVRALWKGNVPAMAMYILYGS 87

Query: 184 CKFTSFERIVEMIYAKLPRSKQEMSPSQQIGVSFVGGYLAGILCAVVSHPADVMVSKVNA 243
            +FTS+  + +++      SK ++    QI    VG  L+G   A+ S+P DV+ ++  A
Sbjct: 88  TQFTSYAILNKLL------SKSQLPA--QIHTGMVGA-LSGTCSAIASYPCDVLRTRFIA 138

Query: 244 DR-KQGESMVEASKRIYSRIGFGGLWNGLPVRIFMIGTLTSFQWLIYDSFKAY 295
           +  ++  +M+  ++ I+   GF G + G+   I  I   TS     Y+S K +
Sbjct: 139 NHSRELSTMLSTAQEIWRHEGFRGFFKGVSSSIVSIAVATSSILATYESVKIF 191

 Score = 42.4 bits (98), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 47/172 (27%), Positives = 73/172 (42%), Gaps = 17/172 (9%)

Query: 5   QPIPLFSPEYYAACTLGGVVACGPTHSSVTPLDLVKCRLQV---NPQLYRSNLDGWKTIV 61
           Q +P+F     A C L G+ A   T     PLD +K RLQ+   N   Y   L  +K +V
Sbjct: 10  QEVPVFQ-SLVAGC-LSGISARIVT----APLDTLKIRLQLQLANEAQYGGILVTFKRLV 63

Query: 62  RSEGLSKVFTGVGATFIGYSLQGACKYGGYEYFKQTYSNLLSPETAHRHRT-AVYLCASA 120
           R EG+  ++ G       Y L G+ ++  Y    +  S    P   H     A+    SA
Sbjct: 64  RQEGVRALWKGNVPAMAMYILYGSTQFTSYAILNKLLSKSQLPAQIHTGMVGALSGTCSA 123

Query: 121 SAEFLADILLCPWEAIKVKQQTTIPPFCKNFLEGWSKITAAEGLSGLYKGIT 172
            A +  D+L   + A   ++ +T+       L    +I   EG  G +KG++
Sbjct: 124 IASYPCDVLRTRFIANHSRELSTM-------LSTAQEIWRHEGFRGFFKGVS 168

 Score = 33.1 bits (74), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 39/178 (21%), Positives = 65/178 (36%), Gaps = 27/178 (15%)

Query: 35  PLDLVKCRLQVNPQLYRSN-LDGWKTIVRSEGLSKVFTGVGATFIGYSLQGACKYGGYEY 93
           P D+++ R   N     S  L   + I R EG    F GV ++ +  ++  +     YE 
Sbjct: 128 PCDVLRTRFIANHSRELSTMLSTAQEIWRHEGFRGFFKGVSSSIVSIAVATSSILATYES 187

Query: 94  FKQTYSNLLSPETAHRHRTAVYL---CASASAEFLADILLCPWEAIKVK------QQTTI 144
            K     +   +   R  + + L    AS  A  ++  ++ P + ++ +      QQ   
Sbjct: 188 VK-----IFCEQRPDRDSSVIQLLESSASVIAGIVSKTIVFPIDTVRKRYQVIDWQQLGH 242

Query: 145 PPFCK------------NFLEGWSKITAAEGLSGLYKGITPLWCRQIPYTMCKFTSFE 190
           P                NFL     I   EGL  LY G T    + +P T+     +E
Sbjct: 243 PGHTNKAYKAYKSYTSTNFLRLALMIVEKEGLLALYHGYTLGIAKSVPSTVVSLGVYE 300

 Score = 28.9 bits (63), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 19/73 (26%), Positives = 35/73 (47%), Gaps = 5/73 (6%)

Query: 203 SKQEMSPSQQIGV--SFVGGYLAGILCAVVSHPADVMVSKVN---ADRKQGESMVEASKR 257
           ++  +   Q++ V  S V G L+GI   +V+ P D +  ++    A+  Q   ++   KR
Sbjct: 2   AEDHLRKGQEVPVFQSLVAGCLSGISARIVTAPLDTLKIRLQLQLANEAQYGGILVTFKR 61

Query: 258 IYSRIGFGGLWNG 270
           +  + G   LW G
Sbjct: 62  LVRQEGVRALWKG 74

>CAGL0F08305g complement(827705..828829) similar to sp|P53320
           Saccharomyces cerevisiae YGR257c, start by similarity
          Length = 374

 Score = 57.4 bits (137), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 63/261 (24%), Positives = 109/261 (41%), Gaps = 31/261 (11%)

Query: 43  LQVNPQLYRSNLDGWKTIVRSEGLSKVFTGVGATFIGYSLQGACKYGGYEYFKQTYSNLL 102
           L    Q +   L+ ++ I + EG++ ++ G+  T +         + GYEY +       
Sbjct: 103 LNCRNQKFNGTLEAFEKIAKFEGVTTLWRGISITLLMAIPANVVYFTGYEYVRDR----- 157

Query: 103 SPETAHRHRTAVYLCASASAEFLADILLCPWEAIKVKQQTTIPPFCKN-----FLEGWSK 157
           SP           +C  A A  LA   + P E IK K Q+      KN     + + +++
Sbjct: 158 SPLNGLYPTINPLICG-AFARTLAATSVAPLELIKTKLQSIPSSSMKNGSVIMYRDLFNE 216

Query: 158 ITAAEGLSG----LYKGITPLWCRQIPYTMCKFTSFERIVEMIYAKLPRSKQEMSPSQ-- 211
           I +   + G    ++KG+     R +P++   + S+E   +   A L  S  + + S   
Sbjct: 217 IKSEIAMRGVAQTMFKGLEITLWRDVPFSAIYWASYE-FYKTKVAYLSPSTFDKNSSNWF 275

Query: 212 QIGVSFVGGYLAGILCAVVSHPADVMVSK-----------VNADRKQGES--MVEASKRI 258
               SF+GG+++G L A+ +HP DV  ++            N++ K G S  M      I
Sbjct: 276 HFTNSFLGGFISGSLAAICTHPFDVGKTRQQISLVTDKKLANSNLKYGSSNTMFGFLNYI 335

Query: 259 YSRIGFGGLWNGLPVRIFMIG 279
               G G L+ GL  R+  I 
Sbjct: 336 RKTEGIGALYTGLAPRVAKIA 356

 Score = 42.0 bits (97), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 52/197 (26%), Positives = 80/197 (40%), Gaps = 30/197 (15%)

Query: 22  GVVACGPTHSSVTPLDLVKCRLQVNPQ---------LYRSNLDGWKTIVRSEGLSK-VFT 71
           G  A     +SV PL+L+K +LQ  P          +YR   +  K+ +   G+++ +F 
Sbjct: 173 GAFARTLAATSVAPLELIKTKLQSIPSSSMKNGSVIMYRDLFNEIKSEIAMRGVAQTMFK 232

Query: 72  GVGATFIGYSLQGACKYGGYEYFKQTYSNLLSPETAHR------HRTAVYLCASASAEFL 125
           G+  T        A  +  YE++K T    LSP T  +      H T  +L    S   L
Sbjct: 233 GLEITLWRDVPFSAIYWASYEFYK-TKVAYLSPSTFDKNSSNWFHFTNSFLGGFISGS-L 290

Query: 126 ADILLCPWEAIKVKQQTTIPPFCK----NFLEGWSK--------ITAAEGLSGLYKGITP 173
           A I   P++  K +QQ ++    K    N   G S         I   EG+  LY G+ P
Sbjct: 291 AAICTHPFDVGKTRQQISLVTDKKLANSNLKYGSSNTMFGFLNYIRKTEGIGALYTGLAP 350

Query: 174 LWCRQIPYTMCKFTSFE 190
              +  P      +S+E
Sbjct: 351 RVAKIAPSCAIMISSYE 367

>CAGL0G01166g complement(111298..112185) highly similar to tr|Q06143
           Saccharomyces cerevisiae YLR348c DIC1, hypothetical
           start
          Length = 295

 Score = 57.0 bits (136), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 66/291 (22%), Positives = 120/291 (41%), Gaps = 27/291 (9%)

Query: 21  GGVVACGPTHSSVTPLDLVKCRLQVNPQLYRSNLDGWKTIVRSEGLSKVFTGVGATFIGY 80
            G+ A   TH    PLDL K RLQ  P    + +   ++I+++EG+  ++ G+ A+ +  
Sbjct: 16  AGIFAVMNTH----PLDLTKVRLQAAPIPKPTIVQMLRSILKNEGIVGLYAGLSASLLRQ 71

Query: 81  SLQGACKYGGYEYFKQTY--SNLLSPETAHRHRTAVYLCASASAEFLADILLCPWEAIKV 138
                 ++G Y+  K+     + L+        + V       A   AD++      I++
Sbjct: 72  CTYTTARFGMYDALKEHVIPRDKLTNMWYLLGASMVSGALGGLAGNFADLI-----NIRM 126

Query: 139 KQQTTIP----PFCKNFLEGWSKITAAEGLSGLY-KGITPLWCRQIPYTMCKFTSFERIV 193
           +  + +P       KN ++G  KI  AEG   L+  G  P   R +  T  +  +++   
Sbjct: 127 QNDSALPLDKRRNYKNAIDGMVKIYKAEGAKSLFLTGWKPNMVRGVLMTASQVVTYD--- 183

Query: 194 EMIYAKLPRSKQEMSPSQQIGVSFVGGYLAGILCAVVSHPADVMVSKV-NADRKQGESMV 252
             ++     +K  M P +          LAG +   V  PADV+ + V NA +K G +  
Sbjct: 184 --MFKNFLVTKYNMDPKKN-STHLTSSLLAGFVATTVCSPADVIKTIVMNAHKKPGHNHD 240

Query: 253 EASKRIYSRIGFGG---LWNGLPVRIFMIGTLTSFQWLIYDSFKAY-IGLP 299
            + K +   I   G   ++ G       +   T   +   +  K Y +G+P
Sbjct: 241 SSFKILMEAINKEGPSFMFRGWVPSFTRLAPFTMLIFFAMEQLKKYRVGMP 291

 Score = 34.7 bits (78), Expect = 0.072,   Method: Compositional matrix adjust.
 Identities = 20/77 (25%), Positives = 38/77 (49%)

Query: 220 GYLAGILCAVVSHPADVMVSKVNADRKQGESMVEASKRIYSRIGFGGLWNGLPVRIFMIG 279
           G  AGI   + +HP D+   ++ A      ++V+  + I    G  GL+ GL   +    
Sbjct: 13  GGAAGIFAVMNTHPLDLTKVRLQAAPIPKPTIVQMLRSILKNEGIVGLYAGLSASLLRQC 72

Query: 280 TLTSFQWLIYDSFKAYI 296
           T T+ ++ +YD+ K ++
Sbjct: 73  TYTTARFGMYDALKEHV 89

>KLLA0D15015g 1267803..1268756 similar to sp|P53257 Saccharomyces
           cerevisiae YGR096w, start by similarity
          Length = 317

 Score = 57.0 bits (136), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 43/181 (23%), Positives = 85/181 (46%), Gaps = 14/181 (7%)

Query: 116 LCASASAEFLADILLCPWEAIKVKQQTTIPPFCKNFLEGWSK----ITAAEGLSGLYKGI 171
           + A + +   A +   P + +K++ Q  + P  ++  +G +     I   EGL  L+KG 
Sbjct: 22  VIAGSVSGVFARMATAPMDTVKIRYQ--LQPVQEDKYKGIASTVRTIMKEEGLRALWKGN 79

Query: 172 TPLWCRQIPYTMCKFTSFERIVEMIYAKLPRSKQEMSPSQQIGVSFVGGYLAGILCAVVS 231
            P     + Y   +F S+     +  AK PR  Q+       G +   G LAG+  +VVS
Sbjct: 80  IPATAMYVVYGAVQFGSYSWFNNVWSAKFPRFSQQ-------GQTLTVGALAGMTSSVVS 132

Query: 232 HPADVMVSKVNADR-KQGESMVEASKRIYSRIGFGGLWNGLPVRIFMIGTLTSFQWLIYD 290
           +P D++ +++ A+R     S+ E  ++++   G  G + G+   +  +   T+  +L Y+
Sbjct: 133 YPLDLLRTRLIANRTSHRTSVAEECRQMWLNEGVRGFFTGISTAMTTVTLSTAIMFLTYE 192

Query: 291 S 291
           +
Sbjct: 193 T 193

 Score = 46.6 bits (109), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 46/187 (24%), Positives = 80/187 (42%), Gaps = 21/187 (11%)

Query: 26  CGPTHSSVT-PLDLVKCRLQVNPQLYRSNL-DGWKTIVRSEGLSKVFTGVGATFIGYSLQ 83
            G T S V+ PLDL++ RL  N   +R+++ +  + +  +EG+   FTG+       +L 
Sbjct: 124 AGMTSSVVSYPLDLLRTRLIANRTSHRTSVAEECRQMWLNEGVRGFFTGISTAMTTVTLS 183

Query: 84  GACKYGGYEYFKQTYSNLLSPETAHRHRTAVYLCASASAEFLADILLCPWEAIKVKQQ-- 141
            A  +  YE       N    E     R  V   +   A F++  ++ P + ++ + Q  
Sbjct: 184 TAIMFLTYETVNIVCEN---HEKEFWSR-PVSASSGIIAGFVSKTMVFPIDTLRRRMQVM 239

Query: 142 --------TTIPPFCKNFLEGWS-----KITAAEGLSGLYKGITPLWCRQIPYTMCKFTS 188
                   T  P     +    S     KI   EG+S LY+G+T   C+ +P T      
Sbjct: 240 NSKRTVHFTKFPAVYHEYRYKSSTAIIYKILRQEGVSALYRGLTMGLCKSVPTTAISLFV 299

Query: 189 FERIVEM 195
           +ER +++
Sbjct: 300 YERTMDL 306

 Score = 45.8 bits (107), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 41/180 (22%), Positives = 75/180 (41%), Gaps = 15/180 (8%)

Query: 20  LGGVVACGPTHSSVTPLDLVKCRLQVNP---QLYRSNLDGWKTIVRSEGLSKVFTGVGAT 76
           + G V+      +  P+D VK R Q+ P     Y+      +TI++ EGL  ++ G    
Sbjct: 23  IAGSVSGVFARMATAPMDTVKIRYQLQPVQEDKYKGIASTVRTIMKEEGLRALWKGNIPA 82

Query: 77  FIGYSLQGACKYGGYEYFKQTYSNLLSPETAHRHRT----AVYLCASASAEFLADILLCP 132
              Y + GA ++G Y +F   +S    P  + + +T    A+    S+   +  D+L   
Sbjct: 83  TAMYVVYGAVQFGSYSWFNNVWSAKF-PRFSQQGQTLTVGALAGMTSSVVSYPLDLLRTR 141

Query: 133 WEAIKVKQQTTIPPFCKNFLEGWSKITAAEGLSGLYKGITPLWCRQIPYTMCKFTSFERI 192
             A +   +T++   C+     W      EG+ G + GI+         T   F ++E +
Sbjct: 142 LIANRTSHRTSVAEECRQM---WLN----EGVRGFFTGISTAMTTVTLSTAIMFLTYETV 194

>Scas_709.9
          Length = 365

 Score = 57.0 bits (136), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 58/289 (20%), Positives = 114/289 (39%), Gaps = 37/289 (12%)

Query: 20  LGGVVACGPTHSSVTPLDLVKCRLQV-------NPQLYRSNLDGWKTIVRSEGLSKVFTG 72
           L G++ C        PLD+ K RLQ        NP  YR  L    TIV  EG+  ++ G
Sbjct: 77  LSGIIVC--------PLDVTKTRLQAQGIQSIENP-YYRGVLGTMSTIVVDEGVRGLYKG 127

Query: 73  VGATFIGYSLQGACKYGGYEYFKQTYSNLLSPETAHRHRTAVYLCASASAEFLADILLCP 132
           +    +GY       +  YE+ K  Y  +L       H      C++ +A   + +L  P
Sbjct: 128 LIPIILGYFPTWMIYFSVYEFAKDLYPRVLPNSDFISHS-----CSAITAGAASTVLTNP 182

Query: 133 WEAIKVKQQTTIP-----PFCKNFLEGWSKITAAEGLSGLYKGITPLWCRQIPYTMCKFT 187
              +K +     P        +  ++ + KI   EG+  LY G+ P     + +    F 
Sbjct: 183 IWVVKTRLMLQTPLGESRTHYRGTIDAFKKIITQEGVRTLYTGLVPSMFGLL-HVAIHFP 241

Query: 188 SFERIVEMIYAK-LPRSKQEMSPSQQIGVSFVGGYLAGILCAVVSHPADVMVSKVNADRK 246
            +E++   ++   +         S  +    +    + +L +++++P +++ +++     
Sbjct: 242 VYEKLKNRLHCDTITGGHNSQEHSLHLTRLIIASSASKMLASILTYPHEILRTRMQLKSD 301

Query: 247 Q----GESMVEASKRIYSRIGFGGLWNGLPVRIFMIG-----TLTSFQW 286
           +       +++  KR Y   G  G ++G    +         TL SF++
Sbjct: 302 KLLISKHKLLDLIKRTYRYEGLLGFYSGFATNLLRTVPASAITLVSFEY 350

 Score = 50.8 bits (120), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 49/189 (25%), Positives = 83/189 (43%), Gaps = 22/189 (11%)

Query: 117 CASASAEFLADILLCPWEAIKVKQQ-----TTIPPFCKNFLEGWSKITAAEGLSGLYKGI 171
            + A A FL+ I++CP +  K + Q     +   P+ +  L   S I   EG+ GLYKG+
Sbjct: 69  LSGALAGFLSGIIVCPLDVTKTRLQAQGIQSIENPYYRGVLGTMSTIVVDEGVRGLYKGL 128

Query: 172 TPLWCRQIPYTMCKFTSFERIVEMIYAKLPRSKQEMSPSQQIGVSFVGGYLAGILCAVVS 231
            P+     P  M  F+ +E   ++    LP S         I         AG    V++
Sbjct: 129 IPIILGYFPTWMIYFSVYEFAKDLYPRVLPNSDFISHSCSAIT--------AGAASTVLT 180

Query: 232 HPADVMVSKVNADRKQGES------MVEASKRIYSRIGFGGLWNGLPVRIFMIGTL-TSF 284
           +P  V+ +++      GES       ++A K+I ++ G   L+ GL   +F  G L  + 
Sbjct: 181 NPIWVVKTRLMLQTPLGESRTHYRGTIDAFKKIITQEGVRTLYTGLVPSMF--GLLHVAI 238

Query: 285 QWLIYDSFK 293
            + +Y+  K
Sbjct: 239 HFPVYEKLK 247

>Scas_645.9
          Length = 391

 Score = 57.0 bits (136), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 56/254 (22%), Positives = 107/254 (42%), Gaps = 34/254 (13%)

Query: 50  YRSNLDGWKTIVRSEGLSKVFTGVGATFIGYSLQGACKYGGYEYFKQTYSNLLSPETAHR 109
           +   L+ +  I + EG++ ++ G+    +         + GYEY +       SP     
Sbjct: 129 FNGTLEAFNKIWKLEGITTLWRGISINLLMAIPANIVYFTGYEYLRDN-----SPLATSS 183

Query: 110 HRTAVYLCASASAEFLADILLCPWEAIKVKQQTTIPPFCKN----------FLEGWSKIT 159
                 +C  A A  LA   + P E +K K Q+ IP   K+            E   ++ 
Sbjct: 184 PTFNPLMCG-AIARILAASTVAPLELLKTKLQS-IPRVSKSTTSWMMVKELLKETRQEMR 241

Query: 160 AAEGLSGLYKGITPLWCRQIPYTMCKFTSFERIVEMIYAKLPRSKQEMSPSQQIGVSFVG 219
            +   + L+KG+     R +P++   + S+E     ++    +S   ++       SF+G
Sbjct: 242 ISGASNALFKGLEITLWRDVPFSAIYWGSYEFCKTHLWMDTSKSHSNLTFFIN---SFIG 298

Query: 220 GYLAGILCAVVSHPADVMVSKV------NADR--------KQGESMVEASKRIYSRIGFG 265
           G ++G + A+V+HP DV  ++       N D+        +Q ++M +  + I+   G+G
Sbjct: 299 GSISGTIAALVTHPFDVGKTRWQISFMGNNDKSVVKSPDIEQTKNMFKFLRNIWKLEGWG 358

Query: 266 GLWNGLPVRIFMIG 279
            L+ GL  R+  I 
Sbjct: 359 ALYTGLVPRMVKIA 372

 Score = 32.7 bits (73), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 48/210 (22%), Positives = 81/210 (38%), Gaps = 37/210 (17%)

Query: 8   PLFSPEYYAACTLGGVVACGPTHSSVTPLDLVKCRLQVNPQLYRSN---------LDGWK 58
           P F+P       + G +A     S+V PL+L+K +LQ  P++ +S          L   +
Sbjct: 184 PTFNP------LMCGAIARILAASTVAPLELLKTKLQSIPRVSKSTTSWMMVKELLKETR 237

Query: 59  TIVRSEGLSK-VFTGVGATFIGYSLQGACKYGGYEYFKQTYSNLLSPETAHRHRTAVYLC 117
             +R  G S  +F G+  T        A  +G YE+ K      L  +T+  H    +  
Sbjct: 238 QEMRISGASNALFKGLEITLWRDVPFSAIYWGSYEFCKTH----LWMDTSKSHSNLTFFI 293

Query: 118 AS----ASAEFLADILLCPWEAIKVKQQTTI-----------PPF--CKNFLEGWSKITA 160
            S    + +  +A ++  P++  K + Q +            P     KN  +    I  
Sbjct: 294 NSFIGGSISGTIAALVTHPFDVGKTRWQISFMGNNDKSVVKSPDIEQTKNMFKFLRNIWK 353

Query: 161 AEGLSGLYKGITPLWCRQIPYTMCKFTSFE 190
            EG   LY G+ P   +  P      +S+E
Sbjct: 354 LEGWGALYTGLVPRMVKIAPSCAIMISSYE 383

>CAGL0J09790g complement(957759..958661) highly similar to sp|P38988
           Saccharomyces cerevisiae YDL198c YHM1, start by
           similarity
          Length = 300

 Score = 56.6 bits (135), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 68/286 (23%), Positives = 111/286 (38%), Gaps = 33/286 (11%)

Query: 22  GVVACGPTHSSVTPLDLVKCRLQVNPQLYRSNLDGWKTIVR---SEGLSK----VFTGVG 74
           G++  G  H    P+D +  RL  N     S       I R   +E   K    +F G+G
Sbjct: 21  GILEIGVFH----PVDTISKRLMSNHTKITSGAQLNSVIFRDHAAEAFGKRVFTLFPGLG 76

Query: 75  ATFIGYSLQGACKYGGY--------EYFKQTYSNLLSPETAHRHRTAVYLCASASAEFLA 126
              +   LQ   KYGG         ++FK+ + +    +T    R+A     + S   + 
Sbjct: 77  YAAVYKILQRVYKYGGQPFANEFLNKHFKKDFDSAFGDKTGKALRSAT----AGSLIGIG 132

Query: 127 DILLCPWEAIKVKQQTTIPPFCKNFLEGWSKITAAEGLSGLYKGITPLWCRQIPYTMCKF 186
           +I+L P + +K+K+QT    F      G+ KI   EG+  LY+G      R  P +   F
Sbjct: 133 EIVLLPLDVLKIKRQTNPEAFKG---RGFLKILKDEGIFNLYRGWGWTAARNAPGSFALF 189

Query: 187 TSFERIVEMIYAKLPRSKQEMSPSQQIGVSFVGGYLAGILCAVVSHPADVMVSKV-NADR 245
                  E I      S+   S       +F+   +      +VS P DV+ +++ N + 
Sbjct: 190 GGNAFAKEYILGLQDYSQATWSQ------NFISSIVGASASLIVSAPLDVIKTRIQNRNF 243

Query: 246 KQGESMVEASKRIYSRIGFGGLWNGLPVRIFMIGTLTSFQWLIYDS 291
              ES  +  K      GF   + GL  ++   G    F + +  S
Sbjct: 244 DNPESGFKIVKNTLKNEGFTAFFKGLTPKLLTTGPKLVFSFALAQS 289

 Score = 45.1 bits (105), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 40/186 (21%), Positives = 76/186 (40%), Gaps = 7/186 (3%)

Query: 17  ACTLGGVVACGPTHSSVTPLDLVKCRLQVNPQLYRSNLDGWKTIVRSEGLSKVFTGVGAT 76
           + T G ++  G     + PLD++K + Q NP+ ++    G+  I++ EG+  ++ G G T
Sbjct: 122 SATAGSLIGIGEI--VLLPLDVLKIKRQTNPEAFKGR--GFLKILKDEGIFNLYRGWGWT 177

Query: 77  FIGYSLQGACKYGGYEYFKQTYSNLLSPETAHRHRTAVYLCASASAEFLADILLCPWEAI 136
               +      +GG  + K+    L     A   +  +     ASA     I+  P + I
Sbjct: 178 AARNAPGSFALFGGNAFAKEYILGLQDYSQATWSQNFISSIVGASASL---IVSAPLDVI 234

Query: 137 KVKQQTTIPPFCKNFLEGWSKITAAEGLSGLYKGITPLWCRQIPYTMCKFTSFERIVEMI 196
           K + Q       ++  +        EG +  +KG+TP      P  +  F   + ++ M 
Sbjct: 235 KTRIQNRNFDNPESGFKIVKNTLKNEGFTAFFKGLTPKLLTTGPKLVFSFALAQSLIPMF 294

Query: 197 YAKLPR 202
              L +
Sbjct: 295 DNMLKK 300

>CAGL0M09020g complement(896312..897358) highly similar to sp|P33303
           Saccharomyces cerevisiae YJR095w succinate-fumarate
           transporter, start by similarity
          Length = 348

 Score = 57.0 bits (136), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 49/254 (19%), Positives = 106/254 (41%), Gaps = 24/254 (9%)

Query: 58  KTIVRSEGLSKVFTGVGATFIGYSLQGACKYGGYEYFKQTYSNLLSPETAHRHRTAVYLC 117
           + I   EG   ++ G+GA  IG   + A ++  YE+++   + L   +T     +  ++ 
Sbjct: 87  RNIYAQEGFLALYKGLGAVVIGIIPKMAIRFSSYEFYR---TLLADKQTGVVSTSNTFIA 143

Query: 118 ASASAEFLADILLCPWEAIKVKQQTT--------IPPFCKNFLEGWSKITAAEGLSGLYK 169
              +    A +++ P E +K++ Q            P   N ++    I   EG+S LY+
Sbjct: 144 GVGAGVTEAVLVVNPMEVVKIRLQAQHLNPNHDLAKPKYTNAVQAGYTIIKEEGISALYR 203

Query: 170 GITPLWCRQIPYTMCKFTSFERIVEMIYAKLPRSKQEMSPSQQIGVSFVGGYLAGILCAV 229
           G++    RQ       FT + ++ E +         E  PS +       G ++G +   
Sbjct: 204 GVSLTAARQATNQGANFTVYSKLREFLQE---YHGTETLPSWETSCI---GLISGAIGPF 257

Query: 230 VSHPADVMVSKVNADRK---QGES----MVEASKRIYSRIGFGGLWNGLPVRIFMIGTLT 282
            + P D + +++  D+    +GES    +     ++    GF  L+ G+  R+  +    
Sbjct: 258 SNAPLDTIKTRLQKDKSTSFKGESGWKRIAHIGTQLLKEEGFRALYKGITPRVMRVAPGQ 317

Query: 283 SFQWLIYDSFKAYI 296
           +  + +Y+  + ++
Sbjct: 318 AVTFTVYEFVRRHL 331

 Score = 48.9 bits (115), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 45/174 (25%), Positives = 67/174 (38%), Gaps = 20/174 (11%)

Query: 33  VTPLDLVKCRLQ---VNPQL------YRSNLDGWKTIVRSEGLSKVFTGVGATFIGYSLQ 83
           V P+++VK RLQ   +NP        Y + +    TI++ EG+S ++ GV  T    +  
Sbjct: 156 VNPMEVVKIRLQAQHLNPNHDLAKPKYTNAVQAGYTIIKEEGISALYRGVSLTAARQATN 215

Query: 84  GACKYGGYEYFKQTYSNLLSPETAHRHRTAVYLCASASAEFLADILLCPWEAIKVKQQTT 143
               +  Y   ++        ET     T+   C    +  +      P + IK + Q  
Sbjct: 216 QGANFTVYSKLREFLQEYHGTETLPSWETS---CIGLISGAIGPFSNAPLDTIKTRLQKD 272

Query: 144 IPPFCKNFLEGWSKIT-------AAEGLSGLYKGITPLWCRQIPYTMCKFTSFE 190
                K    GW +I          EG   LYKGITP   R  P     FT +E
Sbjct: 273 KSTSFKG-ESGWKRIAHIGTQLLKEEGFRALYKGITPRVMRVAPGQAVTFTVYE 325

 Score = 35.8 bits (81), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 38/158 (24%), Positives = 65/158 (41%), Gaps = 21/158 (13%)

Query: 151 FLEGWSKITAAEGLSGLYKGITPLWCRQIPYTMCKFTSFERIVEMIYAKLPRSKQE--MS 208
           F+     I A EG   LYKG+  +    IP    +F+S+E      Y  L   KQ   +S
Sbjct: 82  FIRTGRNIYAQEGFLALYKGLGAVVIGIIPKMAIRFSSYE-----FYRTLLADKQTGVVS 136

Query: 209 PSQQIGVSFVGGYLAGILCAV-VSHPADVMVSKVNAD---------RKQGESMVEASKRI 258
            S     +F+ G  AG+  AV V +P +V+  ++ A          + +  + V+A   I
Sbjct: 137 TSN----TFIAGVGAGVTEAVLVVNPMEVVKIRLQAQHLNPNHDLAKPKYTNAVQAGYTI 192

Query: 259 YSRIGFGGLWNGLPVRIFMIGTLTSFQWLIYDSFKAYI 296
               G   L+ G+ +      T     + +Y   + ++
Sbjct: 193 IKEEGISALYRGVSLTAARQATNQGANFTVYSKLREFL 230

 Score = 34.3 bits (77), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 22/84 (26%), Positives = 37/84 (44%), Gaps = 9/84 (10%)

Query: 25  ACGPTHSSVTPLDLVKCRLQVNPQLYRSNLDGWKTI-------VRSEGLSKVFTGVGATF 77
           A GP  ++  PLD +K RLQ +         GWK I       ++ EG   ++ G+    
Sbjct: 253 AIGPFSNA--PLDTIKTRLQKDKSTSFKGESGWKRIAHIGTQLLKEEGFRALYKGITPRV 310

Query: 78  IGYSLQGACKYGGYEYFKQTYSNL 101
           +  +   A  +  YE+ ++   NL
Sbjct: 311 MRVAPGQAVTFTVYEFVRRHLENL 334

>YOR130C (ORT1) [4932] chr15 complement(569929..570807) Ornithine
           transport protein of mitochondria involved in arginine
           metabolism, member of the mitochondrial carrier family
           (MCF) of membrane transporters [879 bp, 292 aa]
          Length = 292

 Score = 55.8 bits (133), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 46/169 (27%), Positives = 74/169 (43%), Gaps = 13/169 (7%)

Query: 33  VTPLDLVKCRLQV-NPQLYRSN------LDGWKTIVRSEGLSKVFTGVGATFIGYSLQGA 85
           +TP++LVKC+LQV N Q+  +       L   K I+   GL+ ++ G   TFI  S  G 
Sbjct: 125 LTPVELVKCKLQVANLQVASAKTKHTKVLPTIKAIITERGLAGLWQGQSGTFIRESFGGV 184

Query: 86  CKYGGYEYFKQTYSNLLSPETAHRHRTAVY--LCASASAEFLADILLCPWEAIKVKQQTT 143
             +  YE  K++  +  S +   R  + ++  L +  SA    +  + P + +K   QT 
Sbjct: 185 AWFATYEIVKKSLKDRHSLDDPKRDESKIWELLISGGSAGLAFNASIFPADTVKSVMQTE 244

Query: 144 IPPFCKNFLEGWSKITAAEGLSGLYKGITPLWCRQIPYTMCKFTSFERI 192
                 +      KI    GL G Y+G+     R +P     F  FE +
Sbjct: 245 ----HISLTNAVKKIFGKFGLKGFYRGLGITLFRAVPANAAVFYIFETL 289

>YKL120W (OAC1) [3145] chr11 (216990..217964) Mitochondrial
           oxaloacetate transporter, member of the mitochondrial
           carrier (MCF) family of membrane transporters [975 bp,
           324 aa]
          Length = 324

 Score = 55.8 bits (133), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 42/173 (24%), Positives = 78/173 (45%), Gaps = 12/173 (6%)

Query: 34  TPLDLVKCRLQ-------VNPQLYRSNL-DGWKTIVRSEGLSKVFTGVGATFIGYSLQGA 85
           +PL LVK RLQ       +  Q + + + +G  TI ++EG+  +F G+ A  +      +
Sbjct: 147 SPLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTIFKTEGVKGLFRGIDAAILRTGAGSS 206

Query: 86  CKYGGYEYFKQTYSNLLSPETAHRHRTAVYLCASASAEFLADILLCPWEAIKVKQQTTIP 145
            +   Y     T  N+L      +   A++L AS  +     +++ PW+ I  +      
Sbjct: 207 VQLPIYN----TAKNILVKNDLMKDGPALHLTASTISGLGVAVVMNPWDVILTRIYNQKG 262

Query: 146 PFCKNFLEGWSKITAAEGLSGLYKGITPLWCRQIPYTMCKFTSFERIVEMIYA 198
              K  ++   K    EG++ LYKG      R  P+T+   T  E+ ++++Y+
Sbjct: 263 DLYKGPIDCLVKTVRIEGVTALYKGFAAQVFRIAPHTIMCLTFMEQTMKLVYS 315

 Score = 48.1 bits (113), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 49/192 (25%), Positives = 82/192 (42%), Gaps = 15/192 (7%)

Query: 116 LCASASAEFLADILLCPWEAIKVKQQ------TTIPPFCKNFLEGWSKITAAEGLSGLYK 169
             A   A  +A  +  P E IK++ Q       +     KN ++G + I   EG+ GL K
Sbjct: 26  FVAGGLAACIAVTVTNPIELIKIRMQLQGEMSASAAKVYKNPIQGMAVIFKNEGIKGLQK 85

Query: 170 GITPLWCRQIPYTMCKFTSFERIVEMIYAKLPRSKQEMSPSQQIGVSFVGGYLAGILCAV 229
           G+   +  QI     +   +E I   +  +L    QE    Q +GV+   G  +GI+ AV
Sbjct: 86  GLNAAYIYQIGLNGSRLGFYEPIRSSL-NQLFFPDQEPHKVQSVGVNVFSGAASGIIGAV 144

Query: 230 VSHPADVMVSKVNADR---KQGES-----MVEASKRIYSRIGFGGLWNGLPVRIFMIGTL 281
           +  P  ++ +++ +     K GE      +      I+   G  GL+ G+   I   G  
Sbjct: 145 IGSPLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTIFKTEGVKGLFRGIDAAILRTGAG 204

Query: 282 TSFQWLIYDSFK 293
           +S Q  IY++ K
Sbjct: 205 SSVQLPIYNTAK 216

>KLLA0E02772g complement(261895..262749) similar to sp|Q12375
           Saccharomyces cerevisiae YOR130c ARG11 ornithine
           transport protein of mitochondria involved in arginine
           metabolism, member of the mitochondrial carrier family
           (MCF), start by similarity
          Length = 284

 Score = 55.8 bits (133), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 69/276 (25%), Positives = 117/276 (42%), Gaps = 38/276 (13%)

Query: 35  PLDLVKCRLQVNP-QLYRSNLDGWKTIVRSEGLSKVF-TGVGATFIGYSLQGACKYGGYE 92
           P D VK RLQ  P  LY +     ++    EG+ K F  G+ +   G +L+ A  +  + 
Sbjct: 27  PFDTVKVRLQTQPAHLYPTTWSCIRSTYTDEGIWKGFYQGIASPLFGAALENAVLFVSF- 85

Query: 93  YFKQTYSNLLSPETAHRHRT-AVYLCASASAEFLADILLCPWEAIKVKQQ---------- 141
                 +N L   T  +  T  +Y  A A A   A  +L P E +K K Q          
Sbjct: 86  ---NQCTNFLDEFTQLKPLTKTIYSGAFAGA--CASFILTPVELVKCKLQVSNISNSLSQ 140

Query: 142 ----TTIPPFCKNFLEGWSKITAAEGLSGLYKGITPLWCRQIPYTMCKFTSFERIVEMIY 197
               T++ P  K+ ++        +GL GL++G    + R+       FT++E I++M +
Sbjct: 141 TTRHTSVWPTIKSVIK-------EKGLLGLWQGQLSTFVRECLGGAVWFTTYE-IMKMKF 192

Query: 198 AKLPRSKQEMSPSQQIGVSFVGGYLAGILCAVVSHPADVMVSKVNADRKQGESMVEASKR 257
           A L  +++E    + +    V G  AG+L      PAD + S    +     S+V A K+
Sbjct: 193 ASLHPAEKENHTWELL----VSGASAGVLFNASVFPADTVKSVCQTEHV---SIVNALKK 245

Query: 258 IYSRIGFGGLWNGLPVRIFMIGTLTSFQWLIYDSFK 293
           +    G  G + GL + +       +  +  Y++ K
Sbjct: 246 VLRTHGITGFYRGLGITLIRAAPANATVFYTYETLK 281

 Score = 55.5 bits (132), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 46/172 (26%), Positives = 82/172 (47%), Gaps = 16/172 (9%)

Query: 33  VTPLDLVKCRLQVN------PQLYRSNLDGW---KTIVRSEGLSKVFTGVGATFIGYSLQ 83
           +TP++LVKC+LQV+       Q  R +   W   K++++ +GL  ++ G  +TF+   L 
Sbjct: 119 LTPVELVKCKLQVSNISNSLSQTTR-HTSVWPTIKSVIKEKGLLGLWQGQLSTFVRECLG 177

Query: 84  GACKYGGYEYFKQTYSNLLSPETAHRHRTAVYLCASASAEFLADILLCPWEAIKVKQQTT 143
           GA  +  YE  K  +++L   E    + T   L + ASA  L +  + P + +K   QT 
Sbjct: 178 GAVWFTTYEIMKMKFASLHPAE--KENHTWELLVSGASAGVLFNASVFPADTVKSVCQTE 235

Query: 144 IPPFCKNFLEGWSKITAAEGLSGLYKGITPLWCRQIPYTMCKFTSFERIVEM 195
                 + +    K+    G++G Y+G+     R  P     F ++E + +M
Sbjct: 236 ----HVSIVNALKKVLRTHGITGFYRGLGITLIRAAPANATVFYTYETLKKM 283

>Scas_589.10
          Length = 316

 Score = 55.5 bits (132), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 62/275 (22%), Positives = 113/275 (41%), Gaps = 30/275 (10%)

Query: 20  LGGVVACGPTHSSVTPLDLVKCR--LQVNPQL-------------YRSNLDGWKTIVRSE 64
           + G VA       + PLD+VK R  LQ+N +              + S L     I++ E
Sbjct: 18  ISGAVAGMSETIMMYPLDVVKTRFQLQINKKALATSSVAVPKQPEHSSILSCLSKILKEE 77

Query: 65  GLSKVFTGVGATFIGYSLQGACKYGGYEYFKQTYSNLLSPETAHRHRTAVYLCASASAEF 124
           G   ++ G+    +    + A K+   E F+Q    ++         + V L A   A  
Sbjct: 78  GFKNLYKGMSPPLLMEVPKRAVKFASNEQFQQI---MMKKFKLKEVTSTVTLLAGTFAGI 134

Query: 125 LADILLCPWEAIKVKQQTTIPPFCKNFLEGWSKITAAEGLSGLYKGITPLWCRQIPYTMC 184
              +++ P+E +K++ Q     + ++ +     I   +GL G+Y G      R   +   
Sbjct: 135 TESLIVVPFELVKIRLQDAQSDY-RSPIRCTRTIIENQGLFGIYAGFESTIWRNTIWNAS 193

Query: 185 KFTSFERIVEMIYAKLPRSKQEMSPSQQIGVSFVGGYLAGILCAVVSHPADVMVSKVNAD 244
            F    ++ + I    PR+K   +  Q I   F+ G +AG +   +S P DV+ +++   
Sbjct: 194 YFGLIFQVKKFI----PRAKST-TKFQGIRNDFLVGAIAGCMSCFLSVPFDVVKTRMQGS 248

Query: 245 RKQGESMV-----EASKRIYSRIGFGGLWNG-LPV 273
           +K    M      ++   IY   G  G++ G LP+
Sbjct: 249 KKTSSGMCYGWAWQSVFLIYRTEGIKGIYKGILPI 283

 Score = 51.6 bits (122), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 48/174 (27%), Positives = 74/174 (42%), Gaps = 9/174 (5%)

Query: 13  EYYAACTLGGVVACGPTHS-SVTPLDLVKCRLQVNPQLYRSNLDGWKTIVRSEGLSKVFT 71
           E  +  TL      G T S  V P +LVK RLQ     YRS +   +TI+ ++GL  ++ 
Sbjct: 119 EVTSTVTLLAGTFAGITESLIVVPFELVKIRLQDAQSDYRSPIRCTRTIIENQGLFGIYA 178

Query: 72  GVGATFIGYSLQGACKYGGYEYFKQTYSNLLSPETAHRHRTAVYLCASASAEFLADILLC 131
           G  +T    ++  A  +G     K+      S       R    + A A    ++  L  
Sbjct: 179 GFESTIWRNTIWNASYFGLIFQVKKFIPRAKSTTKFQGIRNDFLVGAIAGC--MSCFLSV 236

Query: 132 PWEAIKVKQQTTIPPFCKNFLEGWS-----KITAAEGLSGLYKGITPLWCRQIP 180
           P++ +K + Q +          GW+      I   EG+ G+YKGI P+ CR  P
Sbjct: 237 PFDVVKTRMQGS-KKTSSGMCYGWAWQSVFLIYRTEGIKGIYKGILPIICRYGP 289

>Sklu_2430.10 YKL120W, Contig c2430 18856-19830
          Length = 324

 Score = 55.5 bits (132), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 46/177 (25%), Positives = 75/177 (42%), Gaps = 12/177 (6%)

Query: 34  TPLDLVKCRLQ-------VNPQL-YRSNLDGWKTIVRSEGLSKVFTGVGATFIGYSLQGA 85
           +PL LVK R+Q       +  Q  Y S  +G  TI + EG+  +F GV A  +      +
Sbjct: 148 SPLFLVKTRMQSYSNAIKIGEQTHYTSMSNGLATIFKKEGVLGLFRGVDAAILRTGAGSS 207

Query: 86  CKYGGYEYFKQTYSNLLSPETAHRHRTAVYLCASASAEFLADILLCPWEAIKVKQQTTIP 145
            +   Y     T  N L      +  TA++L +S        I++ PW+ +  +      
Sbjct: 208 VQLPIYN----TTKNFLLQNDIMKEGTALHLLSSTVTGLGVGIVMNPWDVVLTRVYNQKG 263

Query: 146 PFCKNFLEGWSKITAAEGLSGLYKGITPLWCRQIPYTMCKFTSFERIVEMIYAKLPR 202
              K  ++   K    EG+  LYKG      R  P+T+   T  E+ ++++YA   R
Sbjct: 264 NTYKGPIDCMFKTIKIEGIGALYKGFGAQLFRIAPHTILCLTFMEQTMKLVYAVESR 320

 Score = 49.7 bits (117), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 56/279 (20%), Positives = 111/279 (39%), Gaps = 33/279 (11%)

Query: 21  GGVVACGPTHSSVTPLDLVKCRLQV-------NPQLYRSNLDGWKTIVRSEGLSKVFTGV 73
           GG+ AC    +   P +LVK R+Q+       N ++YR+       I ++EG+  +  G+
Sbjct: 30  GGLAACIAV-TVTNPFELVKTRMQLQGEMSATNQRIYRNPFQALGVIFKNEGVKGLQRGL 88

Query: 74  GATFIGYSLQGACKYGGYEYFKQTYSNLLSPETA-HR-HRTAVYLCASASAEFLADILLC 131
            + ++        + G YE  +   +    PE+  H+    AV + A A++  +  I+  
Sbjct: 89  VSAYVYQIGLNGSRLGFYEPIRTVLNKTFFPESDPHKLQNVAVNVTAGATSGIIGAIVGS 148

Query: 132 PW-----------EAIKVKQQTTIPPFCKNFLEGWSKITAAEGLSGLYKGITPLWCRQIP 180
           P             AIK+ +QT           G + I   EG+ GL++G+     R   
Sbjct: 149 PLFLVKTRMQSYSNAIKIGEQTHYTSMS----NGLATIFKKEGVLGLFRGVDAAILRTGA 204

Query: 181 YTMCKFTSFERIVEMIYAKLPRSKQEMSPSQQIGVSFVGGYLAGILCAVVSHPADVMVSK 240
            +  +   +      +        Q     +   +  +   + G+   +V +P DV++++
Sbjct: 205 GSSVQLPIYNTTKNFLL-------QNDIMKEGTALHLLSSTVTGLGVGIVMNPWDVVLTR 257

Query: 241 V-NADRKQGESMVEASKRIYSRIGFGGLWNGLPVRIFMI 278
           V N      +  ++   +     G G L+ G   ++F I
Sbjct: 258 VYNQKGNTYKGPIDCMFKTIKIEGIGALYKGFGAQLFRI 296

 Score = 46.2 bits (108), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 42/195 (21%), Positives = 80/195 (41%), Gaps = 15/195 (7%)

Query: 116 LCASASAEFLADILLCPWEAIKVKQQ------TTIPPFCKNFLEGWSKITAAEGLSGLYK 169
             A   A  +A  +  P+E +K + Q       T     +N  +    I   EG+ GL +
Sbjct: 27  FIAGGLAACIAVTVTNPFELVKTRMQLQGEMSATNQRIYRNPFQALGVIFKNEGVKGLQR 86

Query: 170 GITPLWCRQIPYTMCKFTSFERIVEMIYAKLPRSKQEMSPSQQIGVSFVGGYLAGILCAV 229
           G+   +  QI     +   +E I   +  K    + +    Q + V+   G  +GI+ A+
Sbjct: 87  GLVSAYVYQIGLNGSRLGFYEPI-RTVLNKTFFPESDPHKLQNVAVNVTAGATSGIIGAI 145

Query: 230 VSHPADVMVSKVNA--------DRKQGESMVEASKRIYSRIGFGGLWNGLPVRIFMIGTL 281
           V  P  ++ +++ +        ++    SM      I+ + G  GL+ G+   I   G  
Sbjct: 146 VGSPLFLVKTRMQSYSNAIKIGEQTHYTSMSNGLATIFKKEGVLGLFRGVDAAILRTGAG 205

Query: 282 TSFQWLIYDSFKAYI 296
           +S Q  IY++ K ++
Sbjct: 206 SSVQLPIYNTTKNFL 220

>Sklu_2037.2 YIL134W, Contig c2037 1645-2577 reverse complement
          Length = 310

 Score = 55.1 bits (131), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 51/192 (26%), Positives = 85/192 (44%), Gaps = 19/192 (9%)

Query: 11  SPEYYAACTLGGVVACGPTHSSVTPLDLVKCRLQ----VNPQLYRSNLDGWKTIVRSEGL 66
           S  Y  A  + GV     T+    P+ ++K R+     V+ + YRS +DG K + R EGL
Sbjct: 120 SLMYLLAAAMSGVATSVLTN----PIWVIKTRIMSTSFVDSRSYRSTVDGIKKLYRIEGL 175

Query: 67  SKVFTGVGATFIGYSLQGACKYGGYEYFKQTYSNLLSPETAHRHRTAVYLCASASAEFLA 126
           +  + G+  +  G S QGA  +  Y+  K  Y      +   +     Y+  ++ ++ ++
Sbjct: 176 AGFWRGLVPSLFGVS-QGAIYFTVYDTLKYHYFAAKHVDKKKKLSNLEYITITSLSKMVS 234

Query: 127 DILLCPWEAIKVKQQ-----TTIPPFCKNFLEGWSKIT---AAEGLSGLYKGITPLWCRQ 178
              + P + +K   Q     T I P  K     W  IT     +G++GLYKG+     R 
Sbjct: 235 VTAVYPLQLLKSNLQSFEVSTVINP--KTSHRVWKLITTIYVRDGVTGLYKGLLANLIRA 292

Query: 179 IPYTMCKFTSFE 190
           +P T   F  +E
Sbjct: 293 VPSTCITFCVYE 304

 Score = 53.1 bits (126), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 67/308 (21%), Positives = 131/308 (42%), Gaps = 41/308 (13%)

Query: 20  LGGVVACGPTHSSVTPLDLVKCRLQV-----NPQLYRSNLDGWKTIVRSEG----LSKVF 70
           + G+ A   T  S  PLDLVK RLQ+      PQ Y    D  K IV+         + +
Sbjct: 13  ISGLTAGTITTVSTHPLDLVKVRLQLLATNKKPQGY---YDVVKRIVKDSKQHSFFRETY 69

Query: 71  TGVGATFIGYSLQGACKYGGYEYFK-----------QTYSNLLSPETAHRHRTAVYLCAS 119
            G+G   +G S+     +G Y   K           + ++N ++ +      + +YL A+
Sbjct: 70  RGLGVNLLGNSVAWGLYFGLYRASKDWVFQWCNTDVKRFNNTMNND--KEMTSLMYLLAA 127

Query: 120 ASAEFLADILLCPWEAIKVKQQTTIPPFCKNF---LEGWSKITAAEGLSGLYKGITPLWC 176
           A +     +L  P   IK +  +T     +++   ++G  K+   EGL+G ++G+ P   
Sbjct: 128 AMSGVATSVLTNPIWVIKTRIMSTSFVDSRSYRSTVDGIKKLYRIEGLAGFWRGLVPS-L 186

Query: 177 RQIPYTMCKFTSFERIVEMIYA-KLPRSKQEMSPSQQIGVSFVGGYLAGILCAVVSHPAD 235
             +      FT ++ +    +A K    K+++S  + I ++     L+ ++     +P  
Sbjct: 187 FGVSQGAIYFTVYDTLKYHYFAAKHVDKKKKLSNLEYITIT----SLSKMVSVTAVYPLQ 242

Query: 236 VMVSKVNA-------DRKQGESMVEASKRIYSRIGFGGLWNGLPVRIFMIGTLTSFQWLI 288
           ++ S + +       + K    + +    IY R G  GL+ GL   +      T   + +
Sbjct: 243 LLKSNLQSFEVSTVINPKTSHRVWKLITTIYVRDGVTGLYKGLLANLIRAVPSTCITFCV 302

Query: 289 YDSFKAYI 296
           Y++F+ ++
Sbjct: 303 YENFRHWL 310

>Kwal_55.21335
          Length = 317

 Score = 55.1 bits (131), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 53/187 (28%), Positives = 80/187 (42%), Gaps = 24/187 (12%)

Query: 20  LGGVVACGPTHSSVTPLDLVKCRLQVNPQLYRSNLDG--------W---KTIVRSEGLSK 68
           L G  A   T   +TP++L+KC LQV      SNL+G        W   K IV+ +G+  
Sbjct: 144 LSGAFAGACTSYVLTPVELIKCTLQV------SNLEGATTRHSKIWPTVKHIVQHKGIGG 197

Query: 69  VFTGVGATFIGYSLQGACKYGGYEYFKQTYSNLLSPETAHRHRTAVYLCASASAEFLADI 128
           ++ G  +TFI     GA  +  YE  K   S L        + T   L + ASA    + 
Sbjct: 198 LWQGQSSTFIRECAGGAVWFTTYESLK---SYLARRRNDTENHTWELLASGASAGVAFNA 254

Query: 129 LLCPWEAIKVKQQTTIPPFCKNFLEGWSKITAAEGLSGLYKGITPLWCRQIPYTMCKFTS 188
            + P + IK   QT         ++   +I A  G +GLY+G+     R  P     F +
Sbjct: 255 SIFPADTIKSTAQTQ----HLGIVDATKRILARSGPAGLYRGLGITLIRAAPANAIVFYT 310

Query: 189 FERIVEM 195
           +E +  +
Sbjct: 311 YETLSNL 317

 Score = 51.6 bits (122), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 64/267 (23%), Positives = 113/267 (42%), Gaps = 26/267 (9%)

Query: 35  PLDLVKCRLQVNP-QLYRSNLDGWKTIVRSEGLSKVF-TGVGATFIGYSLQGACKYGGY- 91
           PLD +K RLQ  P  ++ ++    K   + EG  K F  GV +  +G +L+ A  +  + 
Sbjct: 65  PLDTIKVRLQTQPAHVFPTSWSCIKYTYQKEGFVKGFYQGVASPLVGAALENAVLFVTFN 124

Query: 92  --EYFKQTYSNLLSPETAHRHRTAVYLCASASAEFLADILLCPWEAIKVKQQ-TTIPPFC 148
             + F Q Y ++ SP +         + + A A      +L P E IK   Q + +    
Sbjct: 125 RAQNFLQQYESV-SPLSQT-------VLSGAFAGACTSYVLTPVELIKCTLQVSNLEGAT 176

Query: 149 KNFLEGW---SKITAAEGLSGLYKGITPLWCRQIPYTMCKFTSFERIVEMIYAKLPRSKQ 205
               + W     I   +G+ GL++G +  + R+       FT++E +    Y    R+  
Sbjct: 177 TRHSKIWPTVKHIVQHKGIGGLWQGQSSTFIRECAGGAVWFTTYESLKS--YLARRRNDT 234

Query: 206 EMSPSQQIGVSFVGGYLAGILCAVVSHPADVMVSKVNADRKQGESMVEASKRIYSRIGFG 265
           E    + +      G  AG+       PAD + S     + Q   +V+A+KRI +R G  
Sbjct: 235 ENHTWELLA----SGASAGVAFNASIFPADTIKSTA---QTQHLGIVDATKRILARSGPA 287

Query: 266 GLWNGLPVRIFMIGTLTSFQWLIYDSF 292
           GL+ GL + +       +  +  Y++ 
Sbjct: 288 GLYRGLGITLIRAAPANAIVFYTYETL 314

>Kwal_23.4354
          Length = 343

 Score = 55.1 bits (131), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 54/255 (21%), Positives = 102/255 (40%), Gaps = 23/255 (9%)

Query: 42  RLQVNPQLYRSNLDGWKTIVRSEGLSKVFTGVGATFIGYSLQGACKYGGYEYFKQTYSNL 101
           R + +P  Y S  D +  I + EG+  ++ G+  T +  +      + GYE  +      
Sbjct: 76  RCKTSPVRYNSTWDAFGKIAKIEGVQSLWRGLSITLLMAAPANMVYFIGYESLRD----- 130

Query: 102 LSPETAHRHRTAVYLCASASAEFLADILLCPWEAIKVKQQT--------TIPPFCKNFLE 153
                  ++ T   L   A A  LA   + P E  + + Q+        T     K+ ++
Sbjct: 131 -KSRLQDKYPTLNPLMCGALARVLAATTVAPLELFRTRLQSIPRSSPKSTTAMMIKDLIK 189

Query: 154 GWSKITAAEGLSGLYKGITPLWCRQIPYTMCKFTSFERIVEMIYAKLPRSKQEMSPSQ-- 211
                 +  G   L++G+     R +P++   +  +E     +     +S    S S   
Sbjct: 190 ESRYEISKVGYKALFRGLEITLWRDVPFSSIYWGCYEFYKSNVSIDSEKSIVNSSNSNWN 249

Query: 212 QIGVSFVGGYLAGILCAVVSHPADV-----MVSKVNA--DRKQGESMVEASKRIYSRIGF 264
               SFVGG   G + AV++HP DV      ++ +N+  ++K  ++M +   ++    G 
Sbjct: 250 HFVNSFVGGSFGGAVAAVLTHPFDVGKTRMQITYLNSTLEKKPSKNMFKYLNQMRKSEGL 309

Query: 265 GGLWNGLPVRIFMIG 279
             L+ GL  R+  I 
Sbjct: 310 AALYTGLVPRVIKIA 324

 Score = 30.0 bits (66), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 27/88 (30%), Positives = 42/88 (47%), Gaps = 11/88 (12%)

Query: 19  TLGGVVACGPTHSSVTPLDLVKCRLQV---NPQLYRS---NLDGWKTIVR-SEGLSKVFT 71
           + GG VA   TH    P D+ K R+Q+   N  L +    N+  +   +R SEGL+ ++T
Sbjct: 259 SFGGAVAAVLTH----PFDVGKTRMQITYLNSTLEKKPSKNMFKYLNQMRKSEGLAALYT 314

Query: 72  GVGATFIGYSLQGACKYGGYEYFKQTYS 99
           G+    I  +   A     YE  K+ +S
Sbjct: 315 GLVPRVIKIAPSCAIMISTYEVCKRLFS 342

>YOR100C (CRC1) [4905] chr15 complement(513295..514278)
           Mitochondrial carnitine carrier, member of the
           mitochondrial carrier family (MCF) of membrane
           transporters [984 bp, 327 aa]
          Length = 327

 Score = 54.7 bits (130), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 67/274 (24%), Positives = 116/274 (42%), Gaps = 32/274 (11%)

Query: 15  YAACTLGGVVACGPTHSSVTPLDLVKCRLQVNPQLYRSNLDGWKTIVR-----------S 63
           + A  +GGV A    H    P DL+K R Q N Q   S +     I++           +
Sbjct: 39  FVAGGVGGVCAVFTGH----PFDLIKVRCQ-NGQ-ANSTVHAITNIIKEAKTQVKGTLFT 92

Query: 64  EGLSKVFTGVGATFIGYSLQGACKYGGYEYFKQTYSNLLSPETAHRHRTAVYLCASASAE 123
             +   + GV    +G +   A  + GY+  K+    L++          + +   A+A 
Sbjct: 93  NSVKGFYKGVIPPLLGVTPIFAVSFWGYDVGKK----LVTFNNKQGGSNELTMGQMAAAG 148

Query: 124 FLADI----LLCPWEAIKVKQQTTIPPFCKNFLEGWSKITAAEGLSGLYKGITPLWCRQI 179
           F++ I    +  P E +KV  QT+      +F++    I    G++ L+KG      R  
Sbjct: 149 FISAIPTTLVTAPTERVKVVLQTSSK---GSFIQAAKTIVKEGGIASLFKGSLATLARDG 205

Query: 180 PYTMCKFTSFERIVEMIYAKLPRSKQ-EMSPSQQIGVSFVGGYLAGILCAVVSHPADVMV 238
           P +   F S+E     + ++ PR    +  P   + V   GG +AG+   +   P D + 
Sbjct: 206 PGSALYFASYEISKNYLNSRQPRQDAGKDEPVNILNVCLAGG-IAGMSMWLAVFPIDTIK 264

Query: 239 SKVNADRKQGESMVEASKRIY-SRIGFGGLWNGL 271
           +K+ A   + ++M+ A+K IY  R G  G + GL
Sbjct: 265 TKLQASSTR-QNMLSATKEIYLQRGGIKGFFPGL 297

>Kwal_23.3529
          Length = 395

 Score = 54.7 bits (130), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 68/300 (22%), Positives = 124/300 (41%), Gaps = 36/300 (12%)

Query: 16  AACTLGGVVACGPTHSSVTPLDLVKCRLQVNPQL--YRSNLDGWKTIVRSEGLSK-VFTG 72
           A C + G +      S +  LD VK R Q  P    YR+ +  ++ I   EG+ + ++ G
Sbjct: 86  AHCIVAGGIGGAIGDSVMHSLDTVKTRQQGAPNAPKYRNMISAYQKIFMEEGIRRGLYGG 145

Query: 73  VGATFIGYSLQGACKYGGYEYFKQTYSNLLSPETAHRHRTAVYLCASASAEFLADILLCP 132
             A  +G     A  +G YE  K+   +         + T  +L A  S + ++ ++  P
Sbjct: 146 YTAAMLGSFPSAAIFFGTYELTKRKLIDDWGV-----NETLSHLTAGLSGDLVSSVVYVP 200

Query: 133 WEAIKVKQQT----TIPPFC-----KNFLEGWSKITAAEGLSGLYKGITPLWCRQIPYTM 183
            E +K + Q       P F      +N  +  + I   EG   L+ G     CR +P++ 
Sbjct: 201 SEVLKTRLQLQGCYNNPHFHSGYNYRNLRDAITAIVRLEGWQTLFFGYKATLCRDLPFSA 260

Query: 184 CKFTSFERIVEMIYAKLPRSKQEMSPSQQIGV--SFVGGYLAGILCAVVSHPADV----- 236
            +F  +E+  +  +     + +  +PSQ + +    + G  AG L  +++ P DV     
Sbjct: 261 FQFAFYEKFRQWAF-----TLEGKTPSQDLSLLNELLTGAAAGGLAGIITTPMDVIKTRI 315

Query: 237 ---MVSKVNADRKQ----GESMVEASKRIYSRIGFGGLWNGLPVRIFMIGTLTSFQWLIY 289
              M S V +D  +      S+++    +Y   G  G ++G+  R       +S   L+Y
Sbjct: 316 QTQMPSTVASDSTRLVRIENSLIKGLTAVYRSEGTLGFFSGVGPRFIWTSIQSSIMLLLY 375

 Score = 37.4 bits (85), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 24/90 (26%), Positives = 41/90 (45%), Gaps = 12/90 (13%)

Query: 33  VTPLDLVKCRLQVN------------PQLYRSNLDGWKTIVRSEGLSKVFTGVGATFIGY 80
            TP+D++K R+Q               ++  S + G   + RSEG    F+GVG  FI  
Sbjct: 305 TTPMDVIKTRIQTQMPSTVASDSTRLVRIENSLIKGLTAVYRSEGTLGFFSGVGPRFIWT 364

Query: 81  SLQGACKYGGYEYFKQTYSNLLSPETAHRH 110
           S+Q +     Y+   ++     SP +A ++
Sbjct: 365 SIQSSIMLLLYQVTLKSLDRFASPNSAFKY 394

>KLLA0B11319g 988293..989360 similar to sgd|S0006332 Saccharomyces
           cerevisiae YPR128c, start by similarity
          Length = 355

 Score = 53.5 bits (127), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 52/228 (22%), Positives = 97/228 (42%), Gaps = 5/228 (2%)

Query: 48  QLYRSNLDGWKTIVRSEGLSKVFTGVGATFIGYSLQGACKYGGYEYFKQTYSNLLSPE-T 106
           Q Y+  LD    + R+EG   ++ G+ A+ +G  +Q    +  Y   ++ Y  +   +  
Sbjct: 85  QRYKHALDVIVKVYRNEGFGGLYHGLSASLLGTFIQSFSYFFWYTLIRRHYFRVKKVKGE 144

Query: 107 AHRHRTAVYLCASASAEFLADILLCPWEAIKVKQQTTIPPFCKNFLEGWSK-ITAAEGLS 165
           A R  T   L  S  A   + +   P   +  KQQT       N  +  +K +   +G++
Sbjct: 145 AARFSTIEELLLSMLAAATSQLFTNPINIVSTKQQTRRGLEGDNSFKAIAKEVYDEDGIT 204

Query: 166 GLYKGITPLWCRQIPYTMCKFTSFERIVEMIYAKLPRSKQEMSPSQQI--GVSFVGGYLA 223
           G +K +       I  ++  + S E++ +++Y     +K     S Q+  G +F+ G L+
Sbjct: 205 GFWKSLKVSLVLTINPSIT-YASAEKLKDILYHVEWNAKDLNDSSLQLKPGQNFLIGVLS 263

Query: 224 GILCAVVSHPADVMVSKVNADRKQGESMVEASKRIYSRIGFGGLWNGL 271
            I+   ++HP  V  + +     +  S  E    +Y   G   LW GL
Sbjct: 264 KIISTCLTHPLIVAKASLQRSSSKFTSFQEVLTYLYRHEGAHALWKGL 311

>Kwal_47.18216
          Length = 333

 Score = 53.5 bits (127), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 61/309 (19%), Positives = 115/309 (37%), Gaps = 65/309 (21%)

Query: 35  PLDLVKCRLQV------NPQLYRSNLDGWKTIVRSEGLSKVFTGVGATFIGYSLQGACKY 88
           PLD +K R+Q+        Q  R  +   + I   EG   ++ G+GA  IG   + A ++
Sbjct: 30  PLDTIKVRMQIYSRAREQGQRARGFIGTARDISTQEGFLALYKGLGAVVIGIIPKMAIRF 89

Query: 89  GGYEYFKQTYSNLLSPETAHRHRTAVYLCASASAEFLADILLC-PWEAIKVKQQTT---- 143
             YE+F+     LL+        T     A   A     +++  P E +K++ Q      
Sbjct: 90  TSYEFFR----TLLADRQTGVVSTGNTFVAGVGAGITEAVMVVNPMEVVKIRLQAQHVRY 145

Query: 144 IP-----------------------------PFCKNFLEGWSKITAAEGLSGLYKGITPL 174
           +P                             P  +N ++    I   EG   LY+G++  
Sbjct: 146 VPLKAQLAGSVTSSSATFSSATTATENVAATPKYRNAIQAAYVIVKEEGPRALYRGVSLT 205

Query: 175 WCRQIPYTMCKFTSFERIVEMIYAKLPRSKQE-----MSPSQQIGVSFVGGYLAGILCAV 229
             RQ       FT        +Y+ L    QE     M PS +  +    G ++G L   
Sbjct: 206 AARQATNQGANFT--------VYSTLKSRLQEYHQTDMLPSWETSLI---GLISGALGPF 254

Query: 230 VSHPADVMVSKVNADRKQGES-----MVEASKRIYSRIGFGGLWNGLPVRIFMIGTLTSF 284
            + P D + +++  D+   +      ++   +++    GF  L+ G+  R+  +    + 
Sbjct: 255 SNAPLDTIKTRLQKDKSTSKDSGWSRILAIGRQLIREEGFRALYKGITPRVMRVAPGQAV 314

Query: 285 QWLIYDSFK 293
            + +Y+  +
Sbjct: 315 TFTVYELIR 323

 Score = 40.8 bits (94), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 39/138 (28%), Positives = 59/138 (42%), Gaps = 13/138 (9%)

Query: 113 AVYLCASASAEFLADILLCPWEAIKVKQQT-----TIPPFCKNFLEGWSKITAAEGLSGL 167
           A+ L A  +A     +   P + IKV+ Q            + F+     I+  EG   L
Sbjct: 11  AINLVAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQRARGFIGTARDISTQEGFLAL 70

Query: 168 YKGITPLWCRQIPYTMCKFTSFERIVEMIYAKLPRSKQEMSPSQQIGVSFVGGYLAGILC 227
           YKG+  +    IP    +FTS+E      +  L   +Q    S   G +FV G  AGI  
Sbjct: 71  YKGLGAVVIGIIPKMAIRFTSYE-----FFRTLLADRQTGVVS--TGNTFVAGVGAGITE 123

Query: 228 AV-VSHPADVMVSKVNAD 244
           AV V +P +V+  ++ A 
Sbjct: 124 AVMVVNPMEVVKIRLQAQ 141

 Score = 32.7 bits (73), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 21/87 (24%), Positives = 39/87 (44%), Gaps = 11/87 (12%)

Query: 25  ACGPTHSSVTPLDLVKCRLQVNPQLYRSNLDGW-------KTIVRSEGLSKVFTGVGATF 77
           A GP  ++  PLD +K RLQ +    + +  GW       + ++R EG   ++ G+    
Sbjct: 250 ALGPFSNA--PLDTIKTRLQKDKSTSKDS--GWSRILAIGRQLIREEGFRALYKGITPRV 305

Query: 78  IGYSLQGACKYGGYEYFKQTYSNLLSP 104
           +  +   A  +  YE  ++    L +P
Sbjct: 306 MRVAPGQAVTFTVYELIRKKLEGLTAP 332

 Score = 31.2 bits (69), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 23/99 (23%), Positives = 46/99 (46%), Gaps = 6/99 (6%)

Query: 210 SQQIGVSFVGGYLAGILCAVVSHPADVMVSKV---NADRKQGES---MVEASKRIYSRIG 263
           S    ++ V G  AG+  A+  HP D +  ++   +  R+QG+     +  ++ I ++ G
Sbjct: 7   SSHPAINLVAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQRARGFIGTARDISTQEG 66

Query: 264 FGGLWNGLPVRIFMIGTLTSFQWLIYDSFKAYIGLPTTG 302
           F  L+ GL   +  I    + ++  Y+ F+  +    TG
Sbjct: 67  FLALYKGLGAVVIGIIPKMAIRFTSYEFFRTLLADRQTG 105

>Scas_562.12
          Length = 300

 Score = 53.1 bits (126), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 70/283 (24%), Positives = 111/283 (39%), Gaps = 27/283 (9%)

Query: 22  GVVACGPTHSSVTPLDLVKCRLQVNPQLYRSNLDGWKTIVR---SEGLSK----VFTGVG 74
           G++  G  H    P+D +  RL  N     ++ +  + I R   SE L K    +F G+G
Sbjct: 21  GILEIGVFH----PVDTISKRLMSNHTKIGNSHELNRVIFREHFSEPLGKRLFTLFPGLG 76

Query: 75  ATFIGYSLQGACKYGGY----EYFKQTYSNLLSPETAHRHRTAVYLCASASAEFLADILL 130
                  LQ   KYGG     E+  + Y          +   A+    + S   + +I+L
Sbjct: 77  YAASYKVLQRVYKYGGQPFANEFLNKHYKKDFDSAFGEKTGKAMRSATAGSLIGIGEIVL 136

Query: 131 CPWEAIKVKQQTTIPPFCKNFLEGWSKITAAEGLSGLYKGITPLWCRQIPYTMCKFTSFE 190
            P + +K+K+QT    F      G+ KI   EG+  LY+G      R  P +   F    
Sbjct: 137 LPLDVLKIKRQTNPEAFKG---RGFVKILKDEGIFNLYRGWGWTAARNAPGSFALFGGNA 193

Query: 191 RIVEMIYAKLPRSKQEMSPSQQIGVSFVGGYLAGILCA-VVSHPADVMVSKV-NADRKQG 248
              E I      S  + S SQ    S VG       C+ +VS P DV+ +++ N      
Sbjct: 194 FAKEYILGLEDYS--QASWSQNFISSIVGAS-----CSLIVSAPLDVIKTRIQNRSFDNP 246

Query: 249 ESMVEASKRIYSRIGFGGLWNGLPVRIFMIGTLTSFQWLIYDS 291
           E+ +   K  +   G    + GL  ++   G    F + +  S
Sbjct: 247 ETGLTIVKNTFKNEGITAFFKGLTPKLLTTGPKLVFSFALAQS 289

>Scas_632.9
          Length = 292

 Score = 53.1 bits (126), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 45/186 (24%), Positives = 80/186 (43%), Gaps = 19/186 (10%)

Query: 20  LGGVVACGPTHSSVTPLDLVKCRLQVNPQLYRSNLDG----------WKTIVRSEGLSKV 69
           L G  A       +TP++L+KC+LQV+    ++ ++G             ++R +G+  +
Sbjct: 116 LSGAFAGSCASFVLTPVELIKCKLQVSN--LQTAVEGQIKHTKIIPTLMYVLREKGILGL 173

Query: 70  FTGVGATFIGYSLQGACKYGGYEYFKQTYSNLLSPETAHRHRTAVYLCASASAEFLADIL 129
           + G  +TFI  SL G   +  YE  KQ    L        ++T   L + ASA    +  
Sbjct: 174 WQGQSSTFIRESLGGVAWFATYEVMKQ---GLKDRRKDTENKTWELLVSGASAGLAFNAS 230

Query: 130 LCPWEAIKVKQQTTIPPFCKNFLEGWSKITAAEGLSGLYKGITPLWCRQIPYTMCKFTSF 189
           + P + +K   QT         +    K+    G++G Y+G+     R +P     F  +
Sbjct: 231 IFPADTVKSMMQTE----HITLINAVKKVLTTYGITGFYRGLGITLIRAVPANATVFYMY 286

Query: 190 ERIVEM 195
           E + +M
Sbjct: 287 ETLSKM 292

>CAGL0K11616g complement(1121834..1122796) highly similar to
           sp|P32332 Saccharomyces cerevisiae YKL120w, hypothetical
           start
          Length = 320

 Score = 53.1 bits (126), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 59/286 (20%), Positives = 116/286 (40%), Gaps = 33/286 (11%)

Query: 15  YAACTLGGVVACGPTHSSVTPLDLVKCRLQV-------NPQLYRSNLDGWKTIVRSEGLS 67
           + + T GG+ AC    +   P+++VK R+Q+       N ++Y +       + R+EG+ 
Sbjct: 19  FGSFTAGGLAACIAV-TVTNPIEVVKIRMQLQGELMAANQRIYTNPFQAMGVVFRNEGIR 77

Query: 68  KVFTGVGATFIGYSLQGACKYGGYEYFKQTYSNLLSPE-TAHR-HRTAVYLCASASAEFL 125
            +  G+ A +I        + G YE  +   +    P+  +H+     + + A A++  +
Sbjct: 78  GLQKGLVAAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQESHKVQSVGINVFAGAASGII 137

Query: 126 ADILLCPW-----------EAIKVKQQTTIPPFCKNFLEGWSKITAAEGLSGLYKGITPL 174
             ++  P             AIK+ +QT           G   I   EG+ GL++GI   
Sbjct: 138 GAVMGSPLFLVKTRLQSYSNAIKIGEQT----HYTGVWNGLKTIYMTEGVKGLFRGIDAA 193

Query: 175 WCRQIPYTMCKFTSFERIVEMIYAKLPRSKQEMSPSQQIGVSFVGGYLAGILCAVVSHPA 234
             R    +  +   +      +   L     E  PS  +  S +    +G+  AVV +P 
Sbjct: 194 ILRTGAGSSVQLPIYNTAKNFL---LRNDIMEDGPSLHLTASTI----SGLGVAVVMNPW 246

Query: 235 DVMVSKV-NADRKQGESMVEASKRIYSRIGFGGLWNGLPVRIFMIG 279
           DV+++++ N      +  ++   +     G   L+ G   ++F IG
Sbjct: 247 DVILTRIYNQKGDLYKGPIDCLVKTVKIEGITALYKGFEAQVFRIG 292

 Score = 52.8 bits (125), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 42/173 (24%), Positives = 76/173 (43%), Gaps = 12/173 (6%)

Query: 34  TPLDLVKCRLQ-------VNPQLYRSNL-DGWKTIVRSEGLSKVFTGVGATFIGYSLQGA 85
           +PL LVK RLQ       +  Q + + + +G KTI  +EG+  +F G+ A  +      +
Sbjct: 143 SPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVKGLFRGIDAAILRTGAGSS 202

Query: 86  CKYGGYEYFKQTYSNLLSPETAHRHRTAVYLCASASAEFLADILLCPWEAIKVKQQTTIP 145
            +   Y     T  N L          +++L AS  +     +++ PW+ I  +      
Sbjct: 203 VQLPIYN----TAKNFLLRNDIMEDGPSLHLTASTISGLGVAVVMNPWDVILTRIYNQKG 258

Query: 146 PFCKNFLEGWSKITAAEGLSGLYKGITPLWCRQIPYTMCKFTSFERIVEMIYA 198
              K  ++   K    EG++ LYKG      R  P+T+   T  E+ +++++A
Sbjct: 259 DLYKGPIDCLVKTVKIEGITALYKGFEAQVFRIGPHTILCLTFLEQTMKLVHA 311

 Score = 47.0 bits (110), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 46/195 (23%), Positives = 79/195 (40%), Gaps = 15/195 (7%)

Query: 116 LCASASAEFLADILLCPWEAIKVKQQTTIPPFCKNF------LEGWSKITAAEGLSGLYK 169
             A   A  +A  +  P E +K++ Q        N        +    +   EG+ GL K
Sbjct: 22  FTAGGLAACIAVTVTNPIEVVKIRMQLQGELMAANQRIYTNPFQAMGVVFRNEGIRGLQK 81

Query: 170 GITPLWCRQIPYTMCKFTSFERIVEMIYAKLPRSKQEMSPSQQIGVSFVGGYLAGILCAV 229
           G+   +  QI     +   +E I   +  K     QE    Q +G++   G  +GI+ AV
Sbjct: 82  GLVAAYIYQIALNGSRLGFYEPI-RAVMNKTFYPDQESHKVQSVGINVFAGAASGIIGAV 140

Query: 230 VSHPADVMVSKVNADR---KQGES-----MVEASKRIYSRIGFGGLWNGLPVRIFMIGTL 281
           +  P  ++ +++ +     K GE      +    K IY   G  GL+ G+   I   G  
Sbjct: 141 MGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVKGLFRGIDAAILRTGAG 200

Query: 282 TSFQWLIYDSFKAYI 296
           +S Q  IY++ K ++
Sbjct: 201 SSVQLPIYNTAKNFL 215

>YIL006W (YIL006W) [2659] chr9 (344059..345180) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters [1122 bp, 373 aa]
          Length = 373

 Score = 53.1 bits (126), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 44/189 (23%), Positives = 79/189 (41%), Gaps = 11/189 (5%)

Query: 12  PEY-YAACTLGGVVACGPTHSSVTPLDLVKCRLQV------NPQLYRSNLDGWKTIVRSE 64
           P++ + A +   + A   + +   P+ +VK RL +      +P  Y+   D ++ +   E
Sbjct: 172 PQFDFVAQSCAAITAGAASTTLTNPIWVVKTRLMLQSNLGEHPTHYKGTFDAFRKLFYQE 231

Query: 65  GLSKVFTGVGATFIGYSLQGACKYGGYEYFKQTYSNLLSPETAHRHRTAVYLCASASAEF 124
           G   ++ G+  + +G     A  +  YE  K  +         +       + AS+ ++ 
Sbjct: 232 GFKALYAGLVPSLLGL-FHVAIHFPIYEDLKVRFHCYSRENNTNSINLQRLIMASSVSKM 290

Query: 125 LADILLCPWEAIKVKQQ--TTIPPFCKNFLEGWSKIT-AAEGLSGLYKGITPLWCRQIPY 181
           +A  +  P E ++ + Q  + IP   +  L    K T A EGL G Y G T    R IP 
Sbjct: 291 IASAVTYPHEILRTRMQLKSDIPDSIQRRLFPLIKATYAQEGLKGFYSGFTTNLVRTIPA 350

Query: 182 TMCKFTSFE 190
           +     SFE
Sbjct: 351 SAITLVSFE 359

 Score = 47.8 bits (112), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 65/306 (21%), Positives = 127/306 (41%), Gaps = 35/306 (11%)

Query: 4   KQPIPLFSPEYYAACTLGGVVACGPTHSSVTPLDLVKCRLQV--------NPQLYRSNLD 55
           K+ +PL S +  A   L G  A   +  +V PLD+ K RLQ         NP  YR  + 
Sbjct: 69  KKWVPLSSTQITA---LSGAFAGFLSGVAVCPLDVAKTRLQAQGLQTRFENP-YYRGIMG 124

Query: 56  GWKTIVRSEGLSKVFTGVGATFIGYSLQGACKYGGYEYFKQTYSNLLSPETAHRHRTAVY 115
              TIVR EG   ++ G+    +GY       +  YE+ K+ +  +  P+     ++   
Sbjct: 125 TLSTIVRDEGPRGLYKGLVPIVLGYFPTWMIYFSVYEFSKKFFHGIF-PQFDFVAQS--- 180

Query: 116 LCASASAEFLADILLCPWEAIKVK--QQTTI---PPFCKNFLEGWSKITAAEGLSGLYKG 170
            CA+ +A   +  L  P   +K +   Q+ +   P   K   + + K+   EG   LY G
Sbjct: 181 -CAAITAGAASTTLTNPIWVVKTRLMLQSNLGEHPTHYKGTFDAFRKLFYQEGFKALYAG 239

Query: 171 ITPLWCRQIPYTMCKFTSFERIVEMIYAKLPRSKQEMSPSQQIGVSFVGGYLAGILCAVV 230
           + P     + +    F  +E +    +     S++  + S  +    +   ++ ++ + V
Sbjct: 240 LVPSLL-GLFHVAIHFPIYEDLKVRFHC---YSRENNTNSINLQRLIMASSVSKMIASAV 295

Query: 231 SHPADVMVSKVNADRKQGES----MVEASKRIYSRIGFGGLWNGLPVRIFMI-----GTL 281
           ++P +++ +++       +S    +    K  Y++ G  G ++G    +         TL
Sbjct: 296 TYPHEILRTRMQLKSDIPDSIQRRLFPLIKATYAQEGLKGFYSGFTTNLVRTIPASAITL 355

Query: 282 TSFQWL 287
            SF++ 
Sbjct: 356 VSFEYF 361

>CAGL0K10362g complement(1009155..1010060) similar to sp|Q12375
           Saccharomyces cerevisiae YOR130c ARG11, start by
           similarity
          Length = 301

 Score = 52.8 bits (125), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 45/181 (24%), Positives = 76/181 (41%), Gaps = 22/181 (12%)

Query: 33  VTPLDLVKCRLQV-NPQLYRSNLDGWKT--------------IVRSEGLSKVFTGVGATF 77
           +TP++L+KC+LQV N Q     + G  T              ++++ G   ++ G   TF
Sbjct: 125 LTPVELIKCKLQVSNLQSLPLGVAGGNTVTERHTRIIPTIQAVIKNRGFIGLWQGQSGTF 184

Query: 78  IGYSLQGACKYGGYEYFK---QTYSNLLSPETAHRHRTAVYLCASASAEFLADILLCPWE 134
           I  S  G   +  YE  K   ++  N+  P   + ++T   L + ASA    +  + P +
Sbjct: 185 IRESFGGVAWFATYELMKKYLKSRHNIEDPSLPNDNKTWELLASGASAGLAFNASIFPAD 244

Query: 135 AIKVKQQTTIPPFCKNFLEGWSKITAAEGLSGLYKGITPLWCRQIPYTMCKFTSFERIVE 194
            +K   QT              KI   +GL G Y+G+     R IP     F  +E + +
Sbjct: 245 TVKSMMQTE----HLGLKTAIKKIFVEKGLRGFYRGLGITLIRAIPANATVFYVYETLSK 300

Query: 195 M 195
           +
Sbjct: 301 L 301

>Scas_662.12
          Length = 308

 Score = 52.4 bits (124), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 45/181 (24%), Positives = 86/181 (47%), Gaps = 12/181 (6%)

Query: 22  GVVACGPTHSSVTPLDLVKCRL----QVNPQLYRSNLDGWKTIVRSEGLSKVFTGVGATF 77
           G+++   T     PL ++K R+    + +   Y+S   G+K+++  EG   ++ G+  + 
Sbjct: 124 GLISGISTTLLTNPLWVIKTRIMSTSRHHKDSYKSIRHGFKSLLTKEGPKAIWMGLLPSL 183

Query: 78  IGYSLQGACKYGGYEYFKQTYS-NLLSPETAHRHRTAVYLCASASAEFLADILLCPWEAI 136
           +G S QGA  +  Y+  K  ++ NL   +  + +     +  S+ ++ L+ + + P++ +
Sbjct: 184 LGVS-QGAIYFMIYDNLKLHFNVNLNKSKKDNANANLKIVLISSLSKMLSVMSVYPFQLL 242

Query: 137 KVKQQT------TIPPFCKNFLEGWSKITAAEGLSGLYKGITPLWCRQIPYTMCKFTSFE 190
           K   QT       IP    +F+    KI    G+ GLYKG++    R IP T   F  +E
Sbjct: 243 KSNLQTFRSVTNNIPQNDYHFITLIRKIYRDNGIKGLYKGLSANLLRAIPSTCITFCIYE 302

Query: 191 R 191
            
Sbjct: 303 N 303

 Score = 37.0 bits (84), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 54/301 (17%), Positives = 118/301 (39%), Gaps = 32/301 (10%)

Query: 20  LGGVVACGPTHSSVTPLDLVKCRLQV-NPQLYRSNLDGWKTIVR----------SEG--- 65
           + G+ A   T   V PLDL+K RLQ+      + +  G+  ++           S+G   
Sbjct: 12  ISGLSAGSLTTLIVHPLDLIKVRLQLLATTTTQQHQKGYTYLINELINNSKKMGSQGPIY 71

Query: 66  --LSKVFTGVGATFIGYSLQGACKYGGYEYFKQTYSNLLSPETAHRHRTAVYLCASASAE 123
             + + + G+    +G ++  +  +  Y     T   +      H + T ++L +   + 
Sbjct: 72  NLIKESYRGLPINLLGNAVAWSLYFTIYN---STKDYMFQNNYLHNNNTTIFLTSGLISG 128

Query: 124 FLADILLCPWEAIKVKQQTTIPPF---CKNFLEGWSKITAAEGLSGLYKGITPLWCRQIP 180
               +L  P   IK +  +T        K+   G+  +   EG   ++ G+ P     + 
Sbjct: 129 ISTTLLTNPLWVIKTRIMSTSRHHKDSYKSIRHGFKSLLTKEGPKAIWMGLLPSLL-GVS 187

Query: 181 YTMCKFTSFERIVEMIYAKLPRSKQEMSPSQQIGVSFVGGYLAGILCAVVSHPADVMVSK 240
                F  ++ +       L +SK++ + +  + +  +   L+ +L  +  +P  ++ S 
Sbjct: 188 QGAIYFMIYDNLKLHFNVNLNKSKKD-NANANLKIVLISS-LSKMLSVMSVYPFQLLKSN 245

Query: 241 VNADRKQGESM-------VEASKRIYSRIGFGGLWNGLPVRIFMIGTLTSFQWLIYDSFK 293
           +   R    ++       +   ++IY   G  GL+ GL   +      T   + IY++FK
Sbjct: 246 LQTFRSVTNNIPQNDYHFITLIRKIYRDNGIKGLYKGLSANLLRAIPSTCITFCIYENFK 305

Query: 294 A 294
           +
Sbjct: 306 S 306

>Kwal_23.2913
          Length = 320

 Score = 52.4 bits (124), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 68/283 (24%), Positives = 113/283 (39%), Gaps = 46/283 (16%)

Query: 13  EYYAACTLGGVVACGPTHSSVTPLDLVKCRLQVNPQLYRSNLDGWKTIVRSEGLSK---- 68
           E  AA  +GGV A    H    P DL+K R Q N       LD    ++  E  SK    
Sbjct: 30  ESLAAGGVGGVCAVLTGH----PFDLLKVRCQSNQA--SGTLDAISRVLH-EAKSKSGPL 82

Query: 69  -------VFTGVGATFIGYSLQGACKYGGYEYFKQTY-------------SNLLSPETAH 108
                   + GV    +G +   A  + GY+  K+               S+ L+P T  
Sbjct: 83  PLNQIKGFYRGVIPPLLGVTPIFAVSFWGYDVGKRLVTWGSNPVTDIAGSSSKLTPLTTS 142

Query: 109 RHRTAVYLCASASAEFLADILLCPWEAIKVKQQTTIPPFCKNFLEGWSKITAAEGLSGLY 168
           +   A +  A  +      ++  P E +KV  QT+      +FL     +    G+  L+
Sbjct: 143 QLALAGFFSAIPTT-----LITAPTERVKVVLQTSE---SGSFLGAARTLIREGGVRSLF 194

Query: 169 KGITPLWCRQIPYTMCKFTSFERIVEMIYAKLPRSKQEMSPSQQIGVSFVGGYLAGILCA 228
           +G      R  P +   F S+E     +  +     Q+      + +   GG +AG+   
Sbjct: 195 QGTLATLARDGPGSALYFASYE-----VSKRFLSRNQDTDALSVVSICVAGG-VAGMSMW 248

Query: 229 VVSHPADVMVSKVNADRKQGESMVEASKRIYSRIGFGGLWNGL 271
           +   P D + +K+ +  +  +SMV+A++ IY+R G  G + GL
Sbjct: 249 IGVFPIDTIKTKLQSSSRS-QSMVQAAREIYTRAGLRGFFPGL 290

>CAGL0H03839g 359987..360835 highly similar to sp|P38921
           Saccharomyces cerevisiae YNL003c PET8, start by
           similarity
          Length = 282

 Score = 52.0 bits (123), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 68/280 (24%), Positives = 122/280 (43%), Gaps = 21/280 (7%)

Query: 20  LGGVVACGPTHSSVTPLDLVKCRLQVNPQLYRSNLDGWKTIVRSEGLSKVFTGVGAT--F 77
           L G  A   T     P+D +K RLQ     +R+   G++ + R  G + V +  GA+  F
Sbjct: 10  LSGAAAGTSTDLVFFPIDTLKTRLQAKGGFFRNG--GYRGVYRGLGSAVVASAPGASLFF 67

Query: 78  IGYSLQGACKYGGYEYFKQTYSNLLSPETAHRHRTAVYLCASASAEFLADILLCPWEAIK 137
           I Y     CK     +F+      L P +++      ++ +S+  E  A ++  P E +K
Sbjct: 68  ITYD---TCKAETRGFFRG-----LLP-SSNVADVVTHMFSSSMGEIAACMVRVPAEVVK 118

Query: 138 VKQQTTIPPFCKNFLEGWSKITAAEGLS-GLYKGITPLWCRQIPYTMCKFTSFERIVEMI 196
            + QT         L    K    EG+   LY+G +    R+IP+T  +F  +E  ++ +
Sbjct: 119 QRSQTHASHSSWETLREILKNENGEGVRRNLYRGWSTTIMREIPFTCIQFPLYE-YMKKV 177

Query: 197 YAKLPRSKQEMSPSQQIGVSFVGGYLAGILCAVVSHPADVMVSKVNADRKQGESMVEASK 256
           +A+L  S + + P +      V G +AG + A  + P D + +++   +K        S 
Sbjct: 178 WAELDESDR-VEPWKGA----VCGSIAGGIAAATTTPLDFLKTRLMLCKKSIPLGTLVST 232

Query: 257 RIYSRIGFGGLWNGLPVRIFMIGTLTSFQWLIYDSFKAYI 296
            IY   GF   ++G+  R   I    +    IY++  + +
Sbjct: 233 -IYKEEGFKVFFSGVGPRTMWISAGGAIFLGIYETVHSLL 271

 Score = 32.7 bits (73), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 29/83 (34%), Positives = 39/83 (46%), Gaps = 7/83 (8%)

Query: 22  GVVACGPTHSSVTPLDLVKCRLQV-NPQLYRSNLDGWKTIVRSEGLSKVFTGVGATFIGY 80
           G +A G   ++ TPLD +K RL +    +    L    TI + EG    F+GVG   +  
Sbjct: 196 GSIAGGIAAATTTPLDFLKTRLMLCKKSIPLGTLV--STIYKEEGFKVFFSGVGPRTMWI 253

Query: 81  SLQGACKYGGYEYFKQTYSNLLS 103
           S  GA   G YE    T  +LLS
Sbjct: 254 SAGGAIFLGIYE----TVHSLLS 272

>Sklu_2115.4 YDL119C, Contig c2115 2906-3805
          Length = 299

 Score = 52.0 bits (123), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 59/292 (20%), Positives = 114/292 (39%), Gaps = 22/292 (7%)

Query: 20  LGGVVACGPTHSSVTPLDLVKCRLQVNPQLYRSNLDGWKTIVRSEGLSKVFTGVGATFIG 79
           +GG V    +   + P DL+K RLQ N      +   W T+       +++ G   + + 
Sbjct: 12  IGGFVGGLTSAIVLQPFDLLKTRLQQN-----KDTTLWGTLKEIRSPKQLWRGALPSSLR 66

Query: 80  YSLQGACKYGGYEYFKQTY----SNLLSPETAHRHRTAVY--LCASASAEFLADILLCPW 133
            S+  A        F+       +  L+P ++   +  +Y  L + A    +   +  P 
Sbjct: 67  TSIGSALYLSTLNVFRTAMAKGKTQTLNPGSSFLPQLTMYENLASGAFTRGVVGFITMPI 126

Query: 134 EAIKVKQQTTIPPFCKNFLEGWSKITAAEGLSGLYKGITPLWCRQIPYTMCKFTSFERIV 193
             IKV+ ++T+  + K+  E    I + EG+ G + G      R  PY       +E+  
Sbjct: 127 TIIKVRYESTMYSY-KSLGEATRHIYSTEGIRGFFNGCGATVMRDAPYAGLYVLLYEKAK 185

Query: 194 EMIYAKLPRSKQEMSPSQQIG------VSFVGGYLAGILCAVVSHPADVMVSKVNADRKQ 247
            ++   LP S      +          V+ +  +++  L   ++ P D + +++  D  +
Sbjct: 186 LLVPMMLPSSTISYDEAGMFTTYTSTVVNSISAFMSASLATTITSPFDTIKTRMQLDPTK 245

Query: 248 GESMVEASKRIYSRIGFGGLWNGLPVRIFMIGTLTSFQWLIYDS----FKAY 295
                +    I S+  F  L++GL +R+          W IY+     F AY
Sbjct: 246 FSGFYKTLVLIVSKEKFKNLFDGLTLRLTRKAFSAGIAWGIYEELIKRFMAY 297

>CAGL0G03135g 290834..291757 similar to sp|P53257 Saccharomyces
           cerevisiae YGR096w, hypothetical start
          Length = 307

 Score = 52.0 bits (123), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 50/186 (26%), Positives = 85/186 (45%), Gaps = 12/186 (6%)

Query: 112 TAVYLCASASAEFLADILLCPWEAIKVKQQTTIPPFCKNFLEGWSKITAAEGLSGLYKGI 171
           T   L A + +   A   + P + +K+K Q T  P  KN       I   EG+ G +KG 
Sbjct: 15  TTNSLVAGSLSGLFARTCIAPLDTVKIKLQVT--PHNKN-ANVLINILKREGIRGFWKGN 71

Query: 172 TPLWCRQIPYTMCKFTSFERIVEMIYAKLPRSKQEMSPSQQIGVSFVGGYLAGILCAVVS 231
            P     I Y   +F S+  I   +   L     +++ S Q+    VG  LAG+  ++ S
Sbjct: 72  VPGSIMYIIYGGAQFGSYTYIGSFLRGGL-----DLNISPQLYSCLVGS-LAGMTSSLAS 125

Query: 232 HPADVMVSKVNADRKQGE--SMVEASKRIYSRIGFGGLWNGLPVRIFMIGTLTSFQWLIY 289
           +P DV+ ++  A+  QG+   + +    I+S  G  G ++G    +  IG  T+  + +Y
Sbjct: 126 YPFDVLRTRFAAN-SQGQLIKLRDEIMAIWSHEGLMGFFSGCGSSMINIGLNTAIMFGVY 184

Query: 290 DSFKAY 295
           +S K +
Sbjct: 185 ESIKIF 190

 Score = 44.3 bits (103), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 47/199 (23%), Positives = 80/199 (40%), Gaps = 22/199 (11%)

Query: 11  SPEYYAACTLGGVVACGPTHSSVTPLDLVKCRLQVNPQLYRSNL-DGWKTIVRSEGLSKV 69
           SP+ Y+ C +G +     + +S  P D+++ R   N Q     L D    I   EGL   
Sbjct: 105 SPQLYS-CLVGSLAGMTSSLASY-PFDVLRTRFAANSQGQLIKLRDEIMAIWSHEGLMGF 162

Query: 70  FTGVGATFIGYSLQGACKYGGYEYFKQTYSNLLSPETAHRHR-TAVYLCASASAEFLADI 128
           F+G G++ I   L  A  +G YE  K  ++   S  +  R   T +   A   + F + +
Sbjct: 163 FSGCGSSMINIGLNTAIMFGVYESIK-IFTEERSKLSDRRDPFTLLNELAGPISGFTSKL 221

Query: 129 LLCPWEAIKVKQQTTIPP--------FCKNFLEGWSK---------ITAAEGLSGLYKGI 171
              P + ++ + Q    P        F K+  + +           +   EG   LY+G+
Sbjct: 222 ATFPLDTVRRRIQIRNSPNEERHDREFTKDIYKSYKNRRFLGVGISMVQQEGPLSLYRGV 281

Query: 172 TPLWCRQIPYTMCKFTSFE 190
           T    + +P T     S+E
Sbjct: 282 TMSLIKSVPSTAISLWSYE 300

 Score = 37.4 bits (85), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 55/251 (21%), Positives = 96/251 (38%), Gaps = 24/251 (9%)

Query: 16  AACTLGGVVACGPTHSSVTPLDLVKCRLQVNPQLYRSNLDGWKTIVRSEGLSKVFTGVGA 75
            A +L G+ A     + + PLD VK +LQV P  +  N +    I++ EG+   + G   
Sbjct: 20  VAGSLSGLFA----RTCIAPLDTVKIKLQVTP--HNKNANVLINILKREGIRGFWKGNVP 73

Query: 76  TFIGYSLQGACKYGGYEYFKQTYSNLLSPETAHRHRTAVYLCASAS-AEFLADILLCPWE 134
             I Y + G  ++G Y Y        L    + +    +Y C   S A   + +   P++
Sbjct: 74  GSIMYIIYGGAQFGSYTYIGSFLRGGLDLNISPQ----LYSCLVGSLAGMTSSLASYPFD 129

Query: 135 AIKVK----QQTTIPPFCKNFLEGWSKITAAEGLSGLYKGITPLWCRQIPYTMCKFTSFE 190
            ++ +     Q  +       +  WS     EGL G + G           T   F  +E
Sbjct: 130 VLRTRFAANSQGQLIKLRDEIMAIWSH----EGLMGFFSGCGSSMINIGLNTAIMFGVYE 185

Query: 191 RIVEMIYAKLPRSKQEMSPSQQIGVSFVGGYLAGILCAVVSHPADVMVSKVNADRKQGES 250
            I   I+ +  RSK          ++ + G ++G    + + P D +  ++       E 
Sbjct: 186 SI--KIFTE-ERSKLSDRRDPFTLLNELAGPISGFTSKLATFPLDTVRRRIQIRNSPNEE 242

Query: 251 M--VEASKRIY 259
               E +K IY
Sbjct: 243 RHDREFTKDIY 253

>YNL003C (PET8) [4582] chr14 complement(624974..625828) Protein of
           the mitochondrial carrier (MCF) family of membrane
           transporters, has similarity to Mrs4p and Mrs3p [855 bp,
           284 aa]
          Length = 284

 Score = 51.2 bits (121), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 68/290 (23%), Positives = 120/290 (41%), Gaps = 25/290 (8%)

Query: 20  LGGVVACGPTHSSVTPLDLVKCRLQVNPQLYRSNLDGWKTIVRSEGLSKVFTGVGATFIG 79
           L G  A   T     P+D +K RLQ     + +   G+K I R  G + V +  GA+   
Sbjct: 9   LSGAAAGTSTDLVFFPIDTIKTRLQAKGGFFANG--GYKGIYRGLGSAVVASAPGASLFF 66

Query: 80  YSLQGACKYGGYEYFKQT----YSNLLSPETAHRHRTAVYLCASASAEFLADILLCPWEA 135
            S         Y+Y K       S L S  +     T  ++ +S+  E  A ++  P E 
Sbjct: 67  IS---------YDYMKVKSRPYISKLYSQGSEQLIDTTTHMLSSSIGEICACLVRVPAEV 117

Query: 136 IKVKQQTTIPPFCKNFLEGWSKITAAEGL-SGLYKGITPLWCRQIPYTMCKFTSFERIVE 194
           +K + Q          L+   +    EGL   LY+G +    R+IP+T  +F  +E + +
Sbjct: 118 VKQRTQVHSTNSSWQTLQSILRNDNKEGLRKNLYRGWSTTIMREIPFTCIQFPLYEYL-K 176

Query: 195 MIYAKLPRSKQEMSPSQQIGVSFVGGYLAGILCAVVSHPADVMVSKVNADRKQGESMVEA 254
             +AK    + ++ P +      + G +AG + A  + P D + +++  + K   S+   
Sbjct: 177 KTWAK-ANGQSQVEPWK----GAICGSIAGGIAAATTTPLDFLKTRLMLN-KTTASLGSV 230

Query: 255 SKRIYSRIGFGGLWNGLPVRIFMIGTLTSFQWLIYDSFKAYI--GLPTTG 302
             RIY   G    ++G+  R   I    +    +Y++  + +    PT G
Sbjct: 231 IIRIYREEGPAVFFSGVGPRTMWISAGGAIFLGMYETVHSLLSKSFPTAG 280

>AFR131C [3323] [Homologous to ScYGR257C - SH] (672999..674033)
           [1035 bp, 344 aa]
          Length = 344

 Score = 51.2 bits (121), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 46/193 (23%), Positives = 80/193 (41%), Gaps = 17/193 (8%)

Query: 53  NLDGWKTIVRSEGLSKVFTGVGATFIGYSLQGACKYGGYEYFKQTYSNLLSPETAHRHRT 112
            L+G + I + EGL  ++ G+G T +         + GYE  +       SP  A R   
Sbjct: 83  TLEGLRKIAQLEGLPTLWRGLGITLVMAVPANVVYFSGYEALRDN-----SP-LASRLPV 136

Query: 113 AVYLCASASAEFLADILLCPWEAIKVKQQTTIPP---------FCKNFLEGWSKITAAEG 163
           A  L   A A  LA   + P E ++ + Q ++P             + L       +  G
Sbjct: 137 ANPLVCGAFARILAATTIAPLELLRTRLQ-SVPRARDTERTIYLIGDLLREMRHEVSVMG 195

Query: 164 LSGLYKGITPLWCRQIPYTMCKFTSFERIVEMIYAKLPRSKQEMSPSQQIGVSFVGGYLA 223
              L+KG+     R +P++   + ++E      +A+   +    +    IG SF  G + 
Sbjct: 196 YRALFKGLEITLWRDVPFSAIYWGTYEFCKTQFWARHAATHNASNWDHFIG-SFACGSMG 254

Query: 224 GILCAVVSHPADV 236
           G + A+++HP DV
Sbjct: 255 GAVAALLTHPFDV 267

 Score = 35.8 bits (81), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 40/231 (17%), Positives = 86/231 (37%), Gaps = 51/231 (22%)

Query: 102 LSPETAHRHRTAVYLCASASAEFLADILLCPWEAIKVK--QQTTIP----------PFCK 149
           +S ET         + ++++   +  + L P + ++V+  QQ  +P          P  K
Sbjct: 1   MSKETRKEGSAKERMVSASAGSLVTSLFLTPLDVVRVRLHQQEMLPSCTCTGQLSKPAGK 60

Query: 150 NF---------------------LEGWSKITAAEGLSGLYKGITPLWCRQIPYTMCKFTS 188
            F                     LEG  KI   EGL  L++G+       +P  +  F+ 
Sbjct: 61  VFWQDECFANVGCREPAARLQGTLEGLRKIAQLEGLPTLWRGLGITLVMAVPANVVYFSG 120

Query: 189 FERIVEMIYAKLPRSKQEMSPSQQIGVSFVGGYLAGILCAVVSHPADVMVSKVNADRKQG 248
           +E +         R    ++    +    V G  A IL A    P +++ +++ +  +  
Sbjct: 121 YEAL---------RDNSPLASRLPVANPLVCGAFARILAATTIAPLELLRTRLQSVPRAR 171

Query: 249 ES---------MVEASKRIYSRIGFGGLWNGLPVRIFMIGTLTSFQWLIYD 290
           ++         ++   +   S +G+  L+ GL + ++     ++  W  Y+
Sbjct: 172 DTERTIYLIGDLLREMRHEVSVMGYRALFKGLEITLWRDVPFSAIYWGTYE 222

>YLR348C (DIC1) [3731] chr12 complement(826976..827872)
           Mitochondrial dicarboxylate transport protein, member of
           the mitochondrial carrier family (MCF) of membrane
           transporters [897 bp, 298 aa]
          Length = 298

 Score = 50.8 bits (120), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 54/232 (23%), Positives = 96/232 (41%), Gaps = 30/232 (12%)

Query: 21  GGVVACGPTHSSVTPLDLVKCRLQVNPQLYRSNLDGWKTIVRSEGLSKVFTGVGATFIGY 80
            G+ A   TH    PLDL K RLQ  P    +     ++I+ +EG+  +++G+ A  +  
Sbjct: 23  AGIFATMVTH----PLDLAKVRLQAAPMPKPTLFRMLESILANEGVVGLYSGLSAAVLRQ 78

Query: 81  SLQGACKYGGYEYFKQTYSNLLSPETAHRHRTAVYLCASAS------AEFLADILLCPWE 134
                 ++G Y+  K+     + P     +   +  C+  S      A   AD++     
Sbjct: 79  CTYTTVRFGAYDLLKEN----VIPREQLTNMAYLLPCSMFSGAIGGLAGNFADVV----- 129

Query: 135 AIKVKQQTTIPPF----CKNFLEGWSKITAAE-GLSGLYKGITPLWCRQIPYTMCKFTSF 189
            I+++  + +        KN ++G  KI   E GL  L+ G  P   R I  T  +  ++
Sbjct: 130 NIRMQNDSALEAAKRRNYKNAIDGVYKIYRYEGGLKTLFTGWKPNMVRGILMTASQVVTY 189

Query: 190 ERIVEMIYAKLPRSKQEMSPSQQIGVSFVGGYLAGILCAVVSHPADVMVSKV 241
           +     +  KL     +   S+          LAG++   V  PADVM +++
Sbjct: 190 DVFKNYLVTKL-----DFDASKNY-THLTASLLAGLVATTVCSPADVMKTRI 235

 Score = 44.3 bits (103), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 51/189 (26%), Positives = 82/189 (43%), Gaps = 27/189 (14%)

Query: 121 SAEFLADILLCPWEAIKVKQQTTIPPFCKNFLEGWSKITAAEGLSGLYKGITPLWCRQIP 180
           +A   A ++  P +  KV+ Q    P           I A EG+ GLY G++    RQ  
Sbjct: 22  AAGIFATMVTHPLDLAKVRLQAAPMP-KPTLFRMLESILANEGVVGLYSGLSAAVLRQCT 80

Query: 181 YTMCKFTSFERIVEMIYAKLPRSKQEMSPSQQIGVSFVGGYLAGILCAVVSHPADVMVSK 240
           YT  +F +++ + E +   +PR +Q  + +  +  S   G + G+      + ADV    
Sbjct: 81  YTTVRFGAYDLLKENV---IPR-EQLTNMAYLLPCSMFSGAIGGL----AGNFADV---- 128

Query: 241 VNADRKQGESMVEASKR------------IYS-RIGFGGLWNGLPVRIFMIGTLTSFQWL 287
           VN  R Q +S +EA+KR            IY    G   L+ G    +     +T+ Q +
Sbjct: 129 VNI-RMQNDSALEAAKRRNYKNAIDGVYKIYRYEGGLKTLFTGWKPNMVRGILMTASQVV 187

Query: 288 IYDSFKAYI 296
            YD FK Y+
Sbjct: 188 TYDVFKNYL 196

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 43/167 (25%), Positives = 71/167 (42%), Gaps = 18/167 (10%)

Query: 37  DLVKCRLQVNPQL-------YRSNLDGWKTIVRSEG-LSKVFTGVGATFIGYSLQGACKY 88
           D+V  R+Q +  L       Y++ +DG   I R EG L  +FTG     +   L  A + 
Sbjct: 127 DVVNIRMQNDSALEAAKRRNYKNAIDGVYKIYRYEGGLKTLFTGWKPNMVRGILMTASQV 186

Query: 89  GGYEYFKQTYSNLLSPETAHRHRTAVYLCASASAEFLADILLCPWEAIKVKQQT---TIP 145
             Y+ FK      L  + +  +    +L AS  A  +A  +  P + +K +         
Sbjct: 187 VTYDVFKNYLVTKLDFDASKNY---THLTASLLAGLVATTVCSPADVMKTRIMNGSGDHQ 243

Query: 146 PFCKNFLEGWSKITAAEGLSGLYKGITPLWCRQIPYTMCKFTSFERI 192
           P  K   +   K    EG S +++G  P + R  P+TM  F + E++
Sbjct: 244 PALKILADAVRK----EGPSFMFRGWLPSFTRLGPFTMLIFFAIEQL 286

 Score = 33.1 bits (74), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 20/77 (25%), Positives = 36/77 (46%)

Query: 220 GYLAGILCAVVSHPADVMVSKVNADRKQGESMVEASKRIYSRIGFGGLWNGLPVRIFMIG 279
           G  AGI   +V+HP D+   ++ A      ++    + I +  G  GL++GL   +    
Sbjct: 20  GGAAGIFATMVTHPLDLAKVRLQAAPMPKPTLFRMLESILANEGVVGLYSGLSAAVLRQC 79

Query: 280 TLTSFQWLIYDSFKAYI 296
           T T+ ++  YD  K  +
Sbjct: 80  TYTTVRFGAYDLLKENV 96

>Kwal_0.232
          Length = 274

 Score = 50.4 bits (119), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 60/262 (22%), Positives = 119/262 (45%), Gaps = 20/262 (7%)

Query: 20  LGGVVACGPTHSSVTPLDLVKCRLQVNPQLYRSNLDGWKTIVRSEGLSKVFTGVGAT--F 77
           L G  A   T     P+D +K RLQ     + +   G+  + R  G + V +   A+  F
Sbjct: 11  LAGAAAGTSTDLFFFPIDTLKTRLQAAGGFFANG--GYLGVYRGLGSAVVASAPSASLFF 68

Query: 78  IGYSLQGACKYGGYEYFKQTYSNLLSPETAHRHRTAVYLCASASAEFLADILLCPWEAIK 137
           + Y        G   Y +  ++NL++  +     TA ++ +S++ E  A ++  P E IK
Sbjct: 69  VTYD-------GMKSYSRPIFNNLIT-SSDQVAETATHMFSSSAGEIAACMVRVPAEVIK 120

Query: 138 VKQQTTIPPFCKNFLEGWSKITAAEGLS-GLYKGITPLWCRQIPYTMCKFTSFERIVEMI 196
            + QT         L+   +    EG+   LY+G +    R+IP+T  +F  +E + +  
Sbjct: 121 QRTQTHKSDSSLQTLKKLLQNENGEGIRRNLYRGWSTTVMREIPFTCIQFPLYEFLKKQW 180

Query: 197 YAKLPRSKQEMSPSQQIGVSFVGGYLAGILCAVVSHPADVMVSKVNADRKQGESMVEASK 256
              +   +++++P Q    +F  G +AG + A  + P DV+ +++         ++  ++
Sbjct: 181 --AISGGREQVAPWQG---AFC-GCVAGGIAAATTTPLDVLKTRLMLSHTS-VPVLHLAR 233

Query: 257 RIYSRIGFGGLWNGLPVRIFMI 278
           +IY+  G+   ++G+  R   I
Sbjct: 234 QIYATEGWKVFFSGVGPRTVWI 255

 Score = 34.7 bits (78), Expect = 0.061,   Method: Compositional matrix adjust.
 Identities = 26/75 (34%), Positives = 38/75 (50%), Gaps = 9/75 (12%)

Query: 22  GVVACGPTHSSVTPLDLVKCRLQVN----PQLYRSNLDGWKTIVRSEGLSKVFTGVGATF 77
           G VA G   ++ TPLD++K RL ++    P L+ +     + I  +EG    F+GVG   
Sbjct: 198 GCVAGGIAAATTTPLDVLKTRLMLSHTSVPVLHLA-----RQIYATEGWKVFFSGVGPRT 252

Query: 78  IGYSLQGACKYGGYE 92
           +  S  GA   G YE
Sbjct: 253 VWISAGGAIFLGVYE 267

>KLLA0F13464g 1246646..1247548 highly similar to sp|P38988
           Saccharomyces cerevisiae YDL198c YHM1 member of the
           mitochondrial carrier family (MCF), start by similarity
          Length = 300

 Score = 50.4 bits (119), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 66/270 (24%), Positives = 104/270 (38%), Gaps = 26/270 (9%)

Query: 22  GVVACGPTHSSVTPLDLVKCRLQVNPQLYRSNLDGWKTIVR---SEGLSK----VFTGVG 74
           G++  G  H    P+D +  RL  N     S       I R   SE L +    +F G+G
Sbjct: 21  GILEIGVFH----PVDTISKRLMSNHTKIASTSQLNSVIFRDFASEPLGRRLLSLFPGLG 76

Query: 75  ATFIGYSLQGACKYGGY----EYFKQTYSNLLSPETAHRHRTAVYLCASASAEFLADILL 130
                  LQ   KYGG     E+  + +          +   A+    + S   + +I+L
Sbjct: 77  YAAAYKILQRVYKYGGQPFANEFLNKNFKGDFDQAFGEKTGKALRSATAGSLIGIGEIVL 136

Query: 131 CPWEAIKVKQQTTIPPFCKNFLEGWSKITAAEGLSGLYKGITPLWCRQIPYTMCKFTSFE 190
            P + +K+K+QT    F      G+ KI   EG  GLY+G      R  P +   F    
Sbjct: 137 LPLDVLKIKRQTNPESFKG---RGFLKIIKDEGF-GLYRGWGWTAARNAPGSFALFGGNA 192

Query: 191 RIVEMIYAKLPRSKQEMSPSQQIGVSFVGGYLAGILCAVVSHPADVMVSKV-NADRKQGE 249
              E I     +   + + SQ    +FV   +      +VS P DV+ +++ N +    E
Sbjct: 193 FAKEYILG--LKDYGQATWSQ----NFVSSIVGASASLIVSAPLDVIKTRIQNRNFDNPE 246

Query: 250 SMVEASKRIYSRIGFGGLWNGLPVRIFMIG 279
           S  +  K      GF   + GL  ++   G
Sbjct: 247 SGFKIIKNTLKNEGFTAFFKGLTPKLLTTG 276

>Scas_716.29
          Length = 316

 Score = 50.4 bits (119), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 48/186 (25%), Positives = 79/186 (42%), Gaps = 15/186 (8%)

Query: 116 LCASASAEFLADILLCPWEAIKVKQQTTIPPFCKNFLEGWSK-----ITAAEGLSGLYKG 170
           L A + +  LA  ++ P + +K++ Q   P +      G  K     I    GL   +KG
Sbjct: 26  LVAGSVSGLLARTVIAPLDTLKIRLQLR-PSYTGQAPSGLLKMMKGMILNEGGLRSFWKG 84

Query: 171 ITPLWCRQIPYTMCKFTSFERIVEMIYAKLPRSKQEMSPSQQIGVSFVGGYLAGILCAVV 230
             P     + Y   +F+S+       Y  L     +M+   Q   S V G LAG+  + V
Sbjct: 85  NVPGTMMYVLYGGAQFSSYS-----FYNNLFGETSDMNGQLQ---SLVVGALAGMTSSFV 136

Query: 231 SHPADVMVSKVNADRKQG-ESMVEASKRIYSRIGFGGLWNGLPVRIFMIGTLTSFQWLIY 289
           S+P DV+ ++  A++     S+    K I++  G  G + G    +F I    S  +  Y
Sbjct: 137 SYPTDVLRTRFIANQDVALSSLSHGCKEIWNMEGIPGFFRGCTASMFTITLSASILFGTY 196

Query: 290 DSFKAY 295
           +S K Y
Sbjct: 197 ESIKIY 202

 Score = 45.8 bits (107), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 46/192 (23%), Positives = 83/192 (43%), Gaps = 27/192 (14%)

Query: 26  CGPTHSSVT-PLDLVKCRLQVNPQLYRSNLD-GWKTIVRSEGLSKVFTGVGATFIGYSLQ 83
            G T S V+ P D+++ R   N  +  S+L  G K I   EG+   F G  A+    +L 
Sbjct: 129 AGMTSSFVSYPTDVLRTRFIANQDVALSSLSHGCKEIWNMEGIPGFFRGCTASMFTITLS 188

Query: 84  GACKYGGYEYFKQTYSNLLSPETAHRHRTAVYLCASASA--EFLADILLCPWEAIKVKQQ 141
            +  +G YE  K  Y +  S E+ + +    YL  SAS+     + ++  P + I+ + Q
Sbjct: 189 ASILFGTYESIK-IYCDEYSKESDYTN----YLRYSASSISGVTSKMVTYPLDTIRRRIQ 243

Query: 142 TTIPPFCKN------------------FLEGWSKITAAEGLSGLYKGITPLWCRQIPYTM 183
                + ++                  F+     I   EGL  LY+G++   C+ +P T+
Sbjct: 244 VRNSVYVQHNVENKIVTEIYQSYKGASFIRMGLNILRQEGLLSLYQGVSMSLCKTVPSTV 303

Query: 184 CKFTSFERIVEM 195
               ++E ++ +
Sbjct: 304 VSLWAYETVMRL 315

 Score = 34.3 bits (77), Expect = 0.090,   Method: Compositional matrix adjust.
 Identities = 47/227 (20%), Positives = 90/227 (39%), Gaps = 16/227 (7%)

Query: 20  LGGVVACGPTHSSVTPLDLVKCRLQVNP----QLYRSNLDGWKTIVRSE-GLSKVFTGVG 74
           + G V+     + + PLD +K RLQ+ P    Q     L   K ++ +E GL   + G  
Sbjct: 27  VAGSVSGLLARTVIAPLDTLKIRLQLRPSYTGQAPSGLLKMMKGMILNEGGLRSFWKGNV 86

Query: 75  ATFIGYSLQGACKYGGYEYFKQTYSNLLSPETAHRHRTAVYLCASASAEFLADILLCPWE 134
              + Y L G  ++  Y +    Y+NL   ET+  +     L   A A   +  +  P +
Sbjct: 87  PGTMMYVLYGGAQFSSYSF----YNNLFG-ETSDMNGQLQSLVVGALAGMTSSFVSYPTD 141

Query: 135 AIKVKQQTTIPPFCKNFLEGWSKITAAEGLSGLYKGITPLWCRQIPYTMCKFTSFERIVE 194
            ++ +          +   G  +I   EG+ G ++G T             F ++E I  
Sbjct: 142 VLRTRFIANQDVALSSLSHGCKEIWNMEGIPGFFRGCTASMFTITLSASILFGTYESI-- 199

Query: 195 MIYAKLPRSKQEMSPSQQIGVSFVGGYLAGILCAVVSHPADVMVSKV 241
            IY      + + +   +   S +    +G+   +V++P D +  ++
Sbjct: 200 KIYCDEYSKESDYTNYLRYSASSI----SGVTSKMVTYPLDTIRRRI 242

>Sklu_1926.2 YPR058W, Contig c1926 347-1264 reverse complement
          Length = 305

 Score = 50.1 bits (118), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 61/248 (24%), Positives = 108/248 (43%), Gaps = 22/248 (8%)

Query: 35  PLDLVKCRLQVNPQLYRSNLDGWKTIVRSEGLSKVFTGVGATFIGYSLQGACKYGGYEYF 94
           P D  K RLQ +  +  + LD  K +V++EG    + G     +G     + ++G  E  
Sbjct: 43  PFDTTKVRLQTS-SVPTTALDVVKKLVKNEGFRGFYKGTLTPLVGVGACVSVQFGVNEAM 101

Query: 95  KQTYS--NLLSPETAHRHRTAVYLCASASAEFLADILLCPWEAIKVKQQT-TIPPFCKNF 151
           K+ +   N  S           YLC  A        L  P E ++++ QT T       F
Sbjct: 102 KRFFHSRNGNSGPNETLGLLQYYLCGFAGGT-ANSFLASPIEHVRIRLQTQTGTGAAAQF 160

Query: 152 ---LEGWSKITAAEGLSGLYKGITPLWCRQIPYTMCKFTSFERIV-EMIYAKLPRSKQEM 207
              L+   K+TA    + L +G+TP   R+       F ++E ++   ++  + RS+   
Sbjct: 161 HGPLDCIKKLTAN---NSLMRGLTPTMLRESHGCGVYFLTYEALIANELHKGVSRSE--- 214

Query: 208 SPSQQIGVSFVGGYLAGILCAVVSHPADVMVSKVNADR----KQGESMVEASKRIYSRIG 263
            P+ ++ +    G  +G    ++ +P DV+ S +  D     KQG++M++ +K IYS  G
Sbjct: 215 IPTWKLCLF---GATSGTTLWLMIYPLDVIKSVMQTDSLLQPKQGKNMLQVAKTIYSTRG 271

Query: 264 FGGLWNGL 271
               + G 
Sbjct: 272 LSSFFKGF 279

 Score = 35.8 bits (81), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 21/72 (29%), Positives = 32/72 (44%), Gaps = 3/72 (4%)

Query: 128 ILLCPWEAIKVKQQTTI---PPFCKNFLEGWSKITAAEGLSGLYKGITPLWCRQIPYTMC 184
           +++ P + IK   QT     P   KN L+    I +  GLS  +KG  P   R  P    
Sbjct: 233 LMIYPLDVIKSVMQTDSLLQPKQGKNMLQVAKTIYSTRGLSSFFKGFGPTMLRAAPANGA 292

Query: 185 KFTSFERIVEMI 196
            F +FE  + ++
Sbjct: 293 TFATFELAMRVL 304

 Score = 31.2 bits (69), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 18/62 (29%), Positives = 30/62 (48%), Gaps = 4/62 (6%)

Query: 35  PLDLVKCRLQVN----PQLYRSNLDGWKTIVRSEGLSKVFTGVGATFIGYSLQGACKYGG 90
           PLD++K  +Q +    P+  ++ L   KTI  + GLS  F G G T +  +      +  
Sbjct: 237 PLDVIKSVMQTDSLLQPKQGKNMLQVAKTIYSTRGLSSFFKGFGPTMLRAAPANGATFAT 296

Query: 91  YE 92
           +E
Sbjct: 297 FE 298

>YGR096W (TPC1) [2056] chr7 (676623..677567) Mitochondrial thiamine
           pyrophosphate transporter, controls import of thiamine
           pyrophosphate during growth on fermentative carbon
           sources, member of the mitochondrial carrier family
           (MCF) of membrane transporters [945 bp, 314 aa]
          Length = 314

 Score = 50.1 bits (118), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 50/192 (26%), Positives = 73/192 (38%), Gaps = 27/192 (14%)

Query: 26  CGPTHSSVT-PLDLVKCRLQVNPQLY-----RSNLDGWKTIVRSEGLSKVFTGVGATFIG 79
            G T S V+ P D+++ RL  N Q++     R   D WK     EGL   F G  A+   
Sbjct: 122 AGITSSIVSYPFDVLRTRLVANNQMHSMSITREVRDIWKL----EGLPGFFKGSIASMTT 177

Query: 80  YSLQGACKYGGYEYFKQTYSNLLSPETAHRHRTAVYLCASAS--AEFLADILLCPWEAIK 137
            +L  +  +G YE  +           AH+      L  SA      +A I+  P E I+
Sbjct: 178 ITLTASIMFGTYETIRIYCDENEKTTAAHKKWELATLNHSAGTIGGVIAKIITFPLETIR 237

Query: 138 VKQQTTIPPFCKNFLEGWS---------------KITAAEGLSGLYKGITPLWCRQIPYT 182
            + Q       + F    S               +I   EG+S LY+GI     + IP T
Sbjct: 238 RRMQFMNSKHLEKFSRHSSVYGSYKGYGFARIGLQILKQEGVSSLYRGILVALSKTIPTT 297

Query: 183 MCKFTSFERIVE 194
              F  +E  + 
Sbjct: 298 FVSFWGYETAIH 309

 Score = 49.7 bits (117), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 44/185 (23%), Positives = 78/185 (42%), Gaps = 14/185 (7%)

Query: 116 LCASASAEFLADILLCPWEAIKVKQQTT----IPPFCKNFLEGWSKITAAEGLSGLYKGI 171
           L A A +  LA  +  P + IK++ Q T    + PF    +E    +   EG+   +KG 
Sbjct: 20  LLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVMEVARSMIKNEGIRSFWKGN 79

Query: 172 TPLWCRQIPYTMCKFTSFERIVEMIYAKLPRSKQEMSPSQQIGVSFVGGYLAGILCAVVS 231
            P     + Y   +F+S        Y+   R         ++  S V G  AGI  ++VS
Sbjct: 80  IPGSLLYVTYGSAQFSS--------YSLFNRYLTPFGLEARLH-SLVVGAFAGITSSIVS 130

Query: 232 HPADVMVSKVNADRK-QGESMVEASKRIYSRIGFGGLWNGLPVRIFMIGTLTSFQWLIYD 290
           +P DV+ +++ A+ +    S+    + I+   G  G + G    +  I    S  +  Y+
Sbjct: 131 YPFDVLRTRLVANNQMHSMSITREVRDIWKLEGLPGFFKGSIASMTTITLTASIMFGTYE 190

Query: 291 SFKAY 295
           + + Y
Sbjct: 191 TIRIY 195

 Score = 34.3 bits (77), Expect = 0.095,   Method: Compositional matrix adjust.
 Identities = 31/156 (19%), Positives = 60/156 (38%), Gaps = 11/156 (7%)

Query: 20  LGGVVACGPTHSSVTPLDLVKCRLQVNPQ-----LYRSNLDGWKTIVRSEGLSKVFTGVG 74
           L G V+     S   P+D +K RLQ+ P           ++  ++++++EG+   + G  
Sbjct: 21  LAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVMEVARSMIKNEGIRSFWKGNI 80

Query: 75  ATFIGYSLQGACKYGGYEYFKQTYSNLLSPETAHRHRTAVYLCASASAEFLADILLCPWE 134
              + Y   G+ ++  Y  F +  +        H       L   A A   + I+  P++
Sbjct: 81  PGSLLYVTYGSAQFSSYSLFNRYLTPFGLEARLHS------LVVGAFAGITSSIVSYPFD 134

Query: 135 AIKVKQQTTIPPFCKNFLEGWSKITAAEGLSGLYKG 170
            ++ +          +       I   EGL G +KG
Sbjct: 135 VLRTRLVANNQMHSMSITREVRDIWKLEGLPGFFKG 170

>Kwal_14.2210
          Length = 315

 Score = 50.1 bits (118), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 69/308 (22%), Positives = 120/308 (38%), Gaps = 46/308 (14%)

Query: 21  GGVVACGPTHSSVTPLDLVKCRLQVNPQLYRSN---LDGWKTIVRSEGLSKVFTGVGATF 77
            G +A   + + V+P + VK  LQV    +  N       K +   EG+  +  G G   
Sbjct: 23  AGGIAGAVSRTVVSPFERVKILLQVQSSTHAYNHGLFRAVKQVYLEEGVPGLLRGNGLNC 82

Query: 78  IGYSLQGACKYGGYEYFKQTYSNLLSPETA----HRHRTAVYLCASAS--AEFLADILLC 131
           I      A ++  YE+ K+ +    +P+T     HR  +   LC   S  A +  D++  
Sbjct: 83  IRIFPYSAVQFLVYEFCKKQWFQQ-NPDTVVLNWHRLVSGA-LCGGCSVLATYPLDLV-- 138

Query: 132 PWEAIKVKQQTT--------------IPPFCKNFLEGWSKITAAEGLSGLYKGITPLWCR 177
                ++  QT                PP     L      T   G+ GLY+G+ P    
Sbjct: 139 ---RTRLSIQTANLARLHKAKAASAAKPPGVWELLR--KTYTQEGGIFGLYRGVWPTSIG 193

Query: 178 QIPYTMCKFTSFERIVEMIYAKLPRSKQEMSPSQQIGVSFVGGYLAGILCAVVSHPADVM 237
            +PY    F  +E++ E I A          P+         G ++G +   +++P D++
Sbjct: 194 VVPYVALNFAVYEQLREYIPASF-------DPASASLYKLSIGAISGGVAQTITYPFDLL 246

Query: 238 VSKVNA-DRKQGE------SMVEASKRIYSRIGFGGLWNGLPVRIFMIGTLTSFQWLIYD 290
             +       Q E      S+ +A   I    GF G + GL   +F +   T+  W++Y+
Sbjct: 247 RRRFQVLAMGQSELGFHYKSVPDALITIGRTEGFKGYYKGLTANLFKVVPSTAVSWVVYE 306

Query: 291 SFKAYIGL 298
           + + Y+ L
Sbjct: 307 TVRDYMQL 314

 Score = 31.2 bits (69), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 18/86 (20%), Positives = 38/86 (44%), Gaps = 2/86 (2%)

Query: 107 AHRHRTAVYLCASASAEFLADILLCPWEAIKV--KQQTTIPPFCKNFLEGWSKITAAEGL 164
           A +    +  CA   A  ++  ++ P+E +K+  + Q++   +         ++   EG+
Sbjct: 12  ALKSDAGIAFCAGGIAGAVSRTVVSPFERVKILLQVQSSTHAYNHGLFRAVKQVYLEEGV 71

Query: 165 SGLYKGITPLWCRQIPYTMCKFTSFE 190
            GL +G      R  PY+  +F  +E
Sbjct: 72  PGLLRGNGLNCIRIFPYSAVQFLVYE 97

 Score = 28.5 bits (62), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 18/80 (22%), Positives = 37/80 (46%), Gaps = 3/80 (3%)

Query: 214 GVSFVGGYLAGILCAVVSHPAD---VMVSKVNADRKQGESMVEASKRIYSRIGFGGLWNG 270
           G++F  G +AG +   V  P +   +++   ++       +  A K++Y   G  GL  G
Sbjct: 18  GIAFCAGGIAGAVSRTVVSPFERVKILLQVQSSTHAYNHGLFRAVKQVYLEEGVPGLLRG 77

Query: 271 LPVRIFMIGTLTSFQWLIYD 290
             +    I   ++ Q+L+Y+
Sbjct: 78  NGLNCIRIFPYSAVQFLVYE 97

>KLLA0B08503g complement(753498..754409) similar to sp|P32331
           Saccharomyces cerevisiae YPR058w YMC1 mitochondrial
           carrier protein (MCF), start by similarity
          Length = 303

 Score = 50.1 bits (118), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 55/246 (22%), Positives = 102/246 (41%), Gaps = 20/246 (8%)

Query: 35  PLDLVKCRLQVNPQLYRSNLDGWKTIVRSEGLSKVFTGVGATFIGYSLQGAC---KYGGY 91
           P D  K RLQ + +   + +   K ++++EG    + G     +G    GAC   ++G  
Sbjct: 43  PFDTTKVRLQTS-ETSTNAVKVIKDLIKNEGPMGFYKGTLTPLVGV---GACVSLQFGVN 98

Query: 92  EYFKQTYSNLLSPETAHRHRTAVYLCASASAEFLADILLCPWEAIKVKQQTTIPPFCKNF 151
           E  K+ +       + H      Y+C  A   F    L  P E I+++ QT         
Sbjct: 99  EAMKRFFHTFDEAASQHLSLLQYYICGVAGG-FTNSFLASPIEHIRIRLQTQTGSGATAE 157

Query: 152 LEGWSKITAAEGLSG-LYKGITPLWCRQIPYTMCKFTSFERIV-EMIYAKLPRSKQEMSP 209
            +G         ++G L +G+TP   R+       F ++E ++   + + + R      P
Sbjct: 158 FKGPIDCIKKLRVNGQLMRGLTPTMLRESHGCGVYFLTYEALIGHQVKSGIQRKD---IP 214

Query: 210 SQQIGVSFVGGYLAGILCAVVSHPADVMVSKVNADR----KQGESMVEASKRIYSRIGFG 265
           + ++ +    G  +G L   + +P DV+ S +  D     K G +++   + I +R G  
Sbjct: 215 AWKLCLF---GAASGTLLWTMVYPLDVIKSVMQTDNLKTPKNGNNILTVGRTIIARQGVS 271

Query: 266 GLWNGL 271
           GL+ G 
Sbjct: 272 GLFKGF 277

 Score = 33.1 bits (74), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 47/191 (24%), Positives = 72/191 (37%), Gaps = 26/191 (13%)

Query: 9   LFSPEYYAACTLGGVVACGPTHSSVTPLDLVKCRLQVNPQLYRSNLDGWKTIVRSEGLSK 68
           L SP  +    L      G T     P+D +K +L+VN QL R       T++R      
Sbjct: 135 LASPIEHIRIRLQTQTGSGATAEFKGPIDCIK-KLRVNGQLMRGL---TPTMLRESHGCG 190

Query: 69  VFTGVGATFIGYSLQGACKYGGYEYFKQTYSNLLSPETAHRHRTAVYLCASASAEFLADI 128
           V+       IG+ ++   +      +K                  + L  +AS   L   
Sbjct: 191 VYFLTYEALIGHQVKSGIQRKDIPAWK------------------LCLFGAASGTLLW-T 231

Query: 129 LLCPWEAIKVKQQTT---IPPFCKNFLEGWSKITAAEGLSGLYKGITPLWCRQIPYTMCK 185
           ++ P + IK   QT     P    N L     I A +G+SGL+KG  P   R  P     
Sbjct: 232 MVYPLDVIKSVMQTDNLKTPKNGNNILTVGRTIIARQGVSGLFKGFAPTMLRAAPANAAT 291

Query: 186 FTSFERIVEMI 196
           F +FE  + ++
Sbjct: 292 FATFETAMRLL 302

>Sklu_2363.2 YPR011C, Contig c2363 11969-12940
          Length = 323

 Score = 50.1 bits (118), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 61/296 (20%), Positives = 118/296 (39%), Gaps = 33/296 (11%)

Query: 20  LGGVVACGPTHSSVTPLDLVKCRLQVNPQLYRSN---LDGWKTIVRSEGLSKVFTGVGAT 76
           L G +A   + + V+P + VK  LQV       N   +   + + R EG   +F G G  
Sbjct: 27  LAGGLAGAVSRTVVSPFERVKILLQVQNSTTAYNQGIVGAVRQVYREEGTPGLFRGNGLN 86

Query: 77  FIGYSLQGACKYGGYEYFKQTYSNLLSPETAHRHRTAVYLCASASAEFLADILLCPWEAI 136
            I      A ++  YE  K+ + ++   +   + +    L + A     + +   P + +
Sbjct: 87  CIRIFPYSAVQFVVYEACKKHFFHVDGSKGREQLQNWQRLFSGALCGGCSVLATYPLDLV 146

Query: 137 KVK---QQTTIPPFCKNFLEGWSK-----------ITAAEGLSGLYKGITPLWCRQIPYT 182
           + +   Q   +    K+     SK                G+ GLY+G+ P     +PY 
Sbjct: 147 RTRLSIQTANLTKLSKSRAHNISKPPGVWDLLCRTYKEEGGIKGLYRGVWPTSLGVVPYV 206

Query: 183 MCKFTSFERIVEMIYAKLPR-SKQEMSPSQQIGVSFVGGYLAGILCAVVSHPADVMVSKV 241
              F  +E+  E     +P  +   ++   ++ +    G L+G +   V++P D++  + 
Sbjct: 207 ALNFAVYEQFKEF----MPEGTDNTLANFYKLSI----GALSGGVAQTVTYPFDLLRRRF 258

Query: 242 NADRKQG-------ESMVEASKRIYSRIGFGGLWNGLPVRIFMIGTLTSFQWLIYD 290
                 G       +S+++A   I    GF G + GL   +F +   T+  WL+Y+
Sbjct: 259 QVLAMGGNELGFRYKSVMDALITIGKTEGFRGYYKGLTANLFKVIPSTAVSWLVYE 314

 Score = 37.7 bits (86), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 42/185 (22%), Positives = 75/185 (40%), Gaps = 27/185 (14%)

Query: 35  PLDLVKCRLQVNP----QLYRSNLDG-------WKTIVRS----EGLSKVFTGVGATFIG 79
           PLDLV+ RL +      +L +S           W  + R+     G+  ++ GV  T +G
Sbjct: 142 PLDLVRTRLSIQTANLTKLSKSRAHNISKPPGVWDLLCRTYKEEGGIKGLYRGVWPTSLG 201

Query: 80  YSLQGACKYGGYEYFKQTYSNLLSPETAHRHRTAVY-LCASASAEFLADILLCPWEAIKV 138
                A  +  YE FK+       PE         Y L   A +  +A  +  P++ ++ 
Sbjct: 202 VVPYVALNFAVYEQFKE-----FMPEGTDNTLANFYKLSIGALSGGVAQTVTYPFDLLRR 256

Query: 139 KQQ------TTIPPFCKNFLEGWSKITAAEGLSGLYKGITPLWCRQIPYTMCKFTSFERI 192
           + Q        +    K+ ++    I   EG  G YKG+T    + IP T   +  +E +
Sbjct: 257 RFQVLAMGGNELGFRYKSVMDALITIGKTEGFRGYYKGLTANLFKVIPSTAVSWLVYEVV 316

Query: 193 VEMIY 197
            ++++
Sbjct: 317 CDLMH 321

 Score = 32.0 bits (71), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 20/84 (23%), Positives = 43/84 (51%), Gaps = 3/84 (3%)

Query: 215 VSFVGGYLAGILCAVVSHPAD---VMVSKVNADRKQGESMVEASKRIYSRIGFGGLWNGL 271
           V+F+ G LAG +   V  P +   +++   N+     + +V A +++Y   G  GL+ G 
Sbjct: 24  VAFLAGGLAGAVSRTVVSPFERVKILLQVQNSTTAYNQGIVGAVRQVYREEGTPGLFRGN 83

Query: 272 PVRIFMIGTLTSFQWLIYDSFKAY 295
            +    I   ++ Q+++Y++ K +
Sbjct: 84  GLNCIRIFPYSAVQFVVYEACKKH 107

>Kwal_27.11626
          Length = 299

 Score = 49.7 bits (117), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 71/286 (24%), Positives = 105/286 (36%), Gaps = 34/286 (11%)

Query: 22  GVVACGPTHSSVTPLDLVKCRLQVNPQLYRSNLDGWKTIVRS---EGLSK----VFTGVG 74
           G++  G  H    P+D V  RL  N     S+      I R    E L K    +F G+G
Sbjct: 20  GILEIGVFH----PVDTVSKRLMSNHTKISSSAQLNSVIFREHAGEALGKRLFTLFPGLG 75

Query: 75  ATFIGYSLQGACKYGGYEY--------FKQTYSNLLSPETAHRHRTAVYLCASASAEFLA 126
                  LQ   KYGG  +        FK  + N    +T    R+A     + S   + 
Sbjct: 76  YAASYKILQRVYKYGGQPFANEFLNKNFKADFDNAFGEKTGKALRSAT----AGSLIGIG 131

Query: 127 DILLCPWEAIKVKQQTTIPPFCKNFLEGWSKITAAEGLSGLYKGITPLWCRQIPYTMCKF 186
           +I+L P + +K+K+QT    F      G+ KI   EG  GLY+G      R  P +   F
Sbjct: 132 EIVLLPLDVLKIKRQTNPESFKG---RGFIKILKDEGF-GLYRGWGWTAARNAPGSFALF 187

Query: 187 TSFERIVEMIYAKLPRSKQEMSPSQQIGVSFVGGYLAGILCAVVSHPADVMVSKV-NADR 245
                  E I      S    S       +FV   +      +VS P DV+ +++ N   
Sbjct: 188 GGNAFAKEYILGLKDYSSATWSQ------NFVSSIVGASASLIVSAPLDVIKTRIQNRHF 241

Query: 246 KQGESMVEASKRIYSRIGFGGLWNGLPVRIFMIGTLTSFQWLIYDS 291
              ES     +      G    + GL  ++   G    F + +  S
Sbjct: 242 DNPESGFRIVQNTLKNEGITAFFKGLTPKLLTTGPKLVFSFALAQS 287

>KLLA0F17864g complement(1634241..1635164) similar to sp|P32331
           Saccharomyces cerevisiae YPR058w YMC1 mitochondrial
           carrier protein (MCF), start by similarity
          Length = 307

 Score = 49.7 bits (117), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 51/203 (25%), Positives = 82/203 (40%), Gaps = 32/203 (15%)

Query: 14  YYAACTLGGVVACGPTHSSV-----TPLDLVKCRLQVNPQL-----YRSNLDGWKTIVRS 63
           Y    +LG    CG    S      TP++ V+ RLQ+  +      Y+S LD  + +++ 
Sbjct: 116 YDNTLSLGQYYTCGFVSGSANALLATPIEHVRIRLQLQKEALANAEYKSTLDCTEKLLKQ 175

Query: 64  EGLSKVFTGVGATFIGYSLQGACKYGGYEYFKQTYSNLLSPETAHRHR-------TAVYL 116
             L + FT   AT +  S        G+  +  TY  L++ + AH  R        A   
Sbjct: 176 GSLMRGFT---ATLMRTS-------HGFGIYFLTYETLIASQLAHGFRREDISAWKACMF 225

Query: 117 CASASAEFLADILLCPWEAIKVKQQT---TIPPFCKNFLEGWSKITAAEGLSGLYKGITP 173
            A + A F A  +  P++ +K   Q      P +  N ++    I    GL    KG  P
Sbjct: 226 GALSGAFFWA--MTYPFDVVKSVMQADKLVNPAYGTNVVQVAKNIYRERGLRAFTKGFMP 283

Query: 174 LWCRQIPYTMCKFTSFERIVEMI 196
              R +P     F +FE  ++M+
Sbjct: 284 TMLRSLPVNGATFAAFEVTMQML 306

 Score = 49.3 bits (116), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 59/250 (23%), Positives = 99/250 (39%), Gaps = 25/250 (10%)

Query: 35  PLDLVKCRLQVNPQLYRSNLDGWKTI---VRSEGLSKVFTGVGATFIGYSLQGACKYGGY 91
           P D++K RLQ  P     N   W+ I   V+ EG    + G  A  +G     +C++G  
Sbjct: 44  PFDIIKVRLQTMP----GNATAWEAITDLVKYEGFMGFYKGTMAPLVGVGACVSCQFGIN 99

Query: 92  EYFKQTYSNLLSPETAHRHRTAV---YLCASASAEFLADILLCPWEAIKVKQQTTIPPFC 148
           E  K+ + +L      + +  ++   Y C   S    A +L  P E ++++ Q       
Sbjct: 100 EAMKRYFRDLNRSRGIYDNTLSLGQYYTCGFVSGSANA-LLATPIEHVRIRLQLQKEALA 158

Query: 149 KNFLEGWSKITAAEGL---SGLYKGITPLWCRQIPYTMCKFTSFERIVEMIYAKLPRSKQ 205
               E  S +   E L     L +G T    R        F ++E    +I ++L    +
Sbjct: 159 NA--EYKSTLDCTEKLLKQGSLMRGFTATLMRTSHGFGIYFLTYE---TLIASQLAHGFR 213

Query: 206 EMSPSQQIGVSFVGGYLAGILCAVVSHPADVMVSKVNADR----KQGESMVEASKRIYSR 261
               S      F  G L+G     +++P DV+ S + AD+      G ++V+ +K IY  
Sbjct: 214 REDISAWKACMF--GALSGAFFWAMTYPFDVVKSVMQADKLVNPAYGTNVVQVAKNIYRE 271

Query: 262 IGFGGLWNGL 271
            G      G 
Sbjct: 272 RGLRAFTKGF 281

>Kwal_26.7972
          Length = 358

 Score = 49.7 bits (117), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 40/162 (24%), Positives = 75/162 (46%), Gaps = 21/162 (12%)

Query: 111 RTAVYLCASASAEFLA----DILLCPWEAIKVKQQTTIPPFCK------NFLEGWSKITA 160
           R+A Y+  S  A  +A      L+ P + IK+  QT+ P + K        +   + I A
Sbjct: 22  RSAHYILRSGLAGGIAGSCAKTLIAPLDRIKILFQTSNPHYLKYSGSTMGLIRAGAHINA 81

Query: 161 AEGLSGLYKGITPLWCRQIPYTMCKFTSFERIVEMIYAKLPRSKQEMSPSQQIGVSFVGG 220
            +G+ G Y+G +    R  PY   KF ++E+I   +   +P  + E    +        G
Sbjct: 82  HDGIRGFYQGHSATLIRIFPYAAIKFIAYEQIRHFM---IPSKEYETHARR-----LASG 133

Query: 221 YLAGILCAVVSHPADVMVSKVN--ADRKQGESMVEASKRIYS 260
            +AG+    +++P D++  ++    DR + + M+   K+IY+
Sbjct: 134 SMAGLCSVFMTYPLDLIRVRLAYVTDRSRIK-MLPVIKQIYT 174

 Score = 41.2 bits (95), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 64/317 (20%), Positives = 118/317 (37%), Gaps = 51/317 (16%)

Query: 2   STKQPIPLFSPEYYAACTLGGVVACGPTHSSVTPLDLVKCRLQV-NPQLYRSN------L 54
           S  Q +   S  Y     L G +A     + + PLD +K   Q  NP   + +      +
Sbjct: 14  SKNQSVDKRSAHYILRSGLAGGIAGSCAKTLIAPLDRIKILFQTSNPHYLKYSGSTMGLI 73

Query: 55  DGWKTIVRSEGLSKVFTGVGATFIGYSLQGACKYGGYEYFKQTYSNLLSPETAHRHRTAV 114
                I   +G+   + G  AT I      A K+  YE  +    + + P  +  + T  
Sbjct: 74  RAGAHINAHDGIRGFYQGHSATLIRIFPYAAIKFIAYEQIR----HFMIP--SKEYETHA 127

Query: 115 YLCASASAEFLADILLC-PWEAIKVK--------QQTTIPPFCKNFLEGWSKITAAEGLS 165
              AS S   L  + +  P + I+V+        +   +P   + + E  S+   ++   
Sbjct: 128 RRLASGSMAGLCSVFMTYPLDLIRVRLAYVTDRSRIKMLPVIKQIYTERASESLTSKSYV 187

Query: 166 --------GLYKGITPLWCRQIPYTMCKFTSFERIVEMI-------YAKLP--------R 202
                     Y+G TP     IPY    F + +   +++       Y+ LP        R
Sbjct: 188 PRWFAHWCNFYRGFTPTVLGMIPYAGVSFFAHDLCGDILRSGALSPYSVLPISDEELTIR 247

Query: 203 SKQEMSPSQQIGVSFVGGYLAGILCAVVSHPADVMVSKVNADR------KQGESMVEASK 256
           SK++ S   +     V G LAG+     S+P +++  ++             +++ +  +
Sbjct: 248 SKKQSSRPLKTWAELVAGGLAGMASQTASYPFEIIRRRLQVSVVSPTSIHNFQTIPDMIR 307

Query: 257 RIYSRIGFGGLWNGLPV 273
            IY   G+ G + GL +
Sbjct: 308 IIYKERGWRGFFVGLSI 324

>KLLA0E15532g complement(1383230..1384210) similar to sp|P23500
           Saccharomyces cerevisiae YKR052c MRS4 RNA splicing
           protein and member of the mitochondrial carrier family
           (MCF), start by similarity
          Length = 326

 Score = 49.3 bits (116), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 59/302 (19%), Positives = 108/302 (35%), Gaps = 45/302 (14%)

Query: 20  LGGVVACGPTHSSVTPLDLVKCRLQVNPQL--------------------YRSNLDGWKT 59
           + G  A    HS + P+D +K R+Q   ++                      + L     
Sbjct: 25  IAGAFAGIMEHSIMFPIDALKTRMQAVSEIKAAASASASGGAGAASGGAGAGTLLQQISR 84

Query: 60  IVRSEGLSKVFTGVGATFIGYSLQGACKYGGYEYFKQTYSNLLSPETAHRHRTAVYLCAS 119
           I  +EG   ++ GV +  +G     A  +  YE+ K+    L+  +  + H+      + 
Sbjct: 85  ISSTEGSLALWRGVQSMVMGAGPAHAVYFATYEFCKE---QLIDAKDFNTHQPLKTAVSG 141

Query: 120 ASAEFLADILLCPWEAIKVKQQTTIPPFCKNFLEGWSKITAAEGLSGLYKGITPLWCRQI 179
            +A   AD L+ P++ IK + Q        +       I   EG    +          I
Sbjct: 142 VAATVAADALMNPFDTIKQRLQLQSKSSDSSMWRMAFNIYKNEGPMAFFYSYPTTLAMNI 201

Query: 180 PYTMCKFTSFERIVEMIYAKLPRSKQEMSPSQQIG--VSFVGGYLAGILCAVVSHPADVM 237
           P+    F  +E            S +  +P+      +  + G +AG  CA V+ P D +
Sbjct: 202 PFAALNFVIYES-----------STKFFNPTNAYNPWIHCLCGGIAGATCAAVTTPLDCI 250

Query: 238 VSKVN---------ADRKQGESMVEASKRIYSRIGFGGLWNGLPVRIFMIGTLTSFQWLI 288
            + +             K   +  +A++ I+   G+ G W GL  R+      T+  W  
Sbjct: 251 KTVLQIRGSDTVHVESFKTANTFKKAAQAIWQSYGWKGFWRGLQPRVISNIPATAISWTS 310

Query: 289 YD 290
           Y+
Sbjct: 311 YE 312

 Score = 33.5 bits (75), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 41/190 (21%), Positives = 74/190 (38%), Gaps = 17/190 (8%)

Query: 20  LGGVVACGPTHSSVTPLDLVKCRLQVNPQLYRSNLDGWK---TIVRSEGLSKVFTGVGAT 76
           + GV A     + + P D +K RLQ+  +   S++  W+    I ++EG    F     T
Sbjct: 139 VSGVAATVAADALMNPFDTIKQRLQLQSKSSDSSM--WRMAFNIYKNEGPMAFFYSYPTT 196

Query: 77  FIGYSLQGACKYGGYEYFKQTYSNLLSPETAHRHRTAVYLC---ASASAEFLADILLCPW 133
                   A  +  YE    + +   +P  A+       LC   A A+   +   L C  
Sbjct: 197 LAMNIPFAALNFVIYE----SSTKFFNPTNAYNPWIHC-LCGGIAGATCAAVTTPLDCIK 251

Query: 134 EAIKVKQQTTIP----PFCKNFLEGWSKITAAEGLSGLYKGITPLWCRQIPYTMCKFTSF 189
             ++++   T+          F +    I  + G  G ++G+ P     IP T   +TS+
Sbjct: 252 TVLQIRGSDTVHVESFKTANTFKKAAQAIWQSYGWKGFWRGLQPRVISNIPATAISWTSY 311

Query: 190 ERIVEMIYAK 199
           E    +++ K
Sbjct: 312 EFAKHLLFTK 321

>CAGL0J02002g 198226..199311 similar to sp|P40556 Saccharomyces
           cerevisiae YIL006w or sp|P39953 Saccharomyces cerevisiae
           YEL006w, hypothetical start
          Length = 361

 Score = 49.3 bits (116), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 60/292 (20%), Positives = 120/292 (41%), Gaps = 36/292 (12%)

Query: 17  ACTLGGVVACGPTHSSVTPLDLVKCRLQ--------VNPQLYRSNLDGWKTIVRSEGLSK 68
           A  L G+V C        PLD+ K RLQ             YR ++    TIVR EG+  
Sbjct: 78  AGLLSGIVVC--------PLDVAKTRLQAQGLQTRTTENLYYRGSIGTMTTIVRDEGVRG 129

Query: 69  VFTGVGATFIGYSLQGACKYGGYEYFKQTYSNLLSPETAHRHRTAVYLCASASAEFLADI 128
           ++ G+    +GY       +  YE+ K    NL +  +     +  +   +A A  ++ +
Sbjct: 130 LYKGLVPIIMGYFPTWMIYFSVYEFCKD---NLRTNSSNWSFVSHSFSAITAGA--VSTV 184

Query: 129 LLCPWEAIKVK--QQTTIPPFCKNF---LEGWSKITAAEGLSGLYKGITPLWCRQIPYTM 183
           +  P   +K +   QT I     ++    + + KI   EG+  LY G+ P     + +  
Sbjct: 185 VTNPIWVVKTRLMLQTHIGSNTTHYQGTYDAFKKIINQEGVKALYAGLVPSLL-GLLHVA 243

Query: 184 CKFTSFERIVEMIYAKLPRSKQEMSPSQQIGVSFVGGYLAGILCAVVSHPADVMVSKVNA 243
             F  +ER+ ++ +    R +        +    +   ++ ++ +V+S+P +++ +++  
Sbjct: 244 IHFPVYERL-KVSFKCYQRDESSNESKINLKRLILASSVSKMVASVLSYPHEILRTRLQL 302

Query: 244 DRK---QGESMVEASKRIYSRIGFGGLWNGLPVRIFMIG-----TLTSFQWL 287
                     ++   K  Y + G  G ++G    +F        TL SF+++
Sbjct: 303 KSDLPSHQRRLIPLIKITYIQEGIFGFYSGFGTNLFRTLPASAITLVSFEYV 354

 Score = 39.3 bits (90), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 39/167 (23%), Positives = 73/167 (43%), Gaps = 21/167 (12%)

Query: 118 ASASAEFLADILLCPWEAIKVKQQ-------TTIPPFCKNFLEGWSKITAAEGLSGLYKG 170
           + A A  L+ I++CP +  K + Q       TT   + +  +   + I   EG+ GLYKG
Sbjct: 74  SGALAGLLSGIVVCPLDVAKTRLQAQGLQTRTTENLYYRGSIGTMTTIVRDEGVRGLYKG 133

Query: 171 ITPLWCRQIPYTMCKFTSFERIVEMIYAKLPRSKQEMSPSQQIGVSFVGGYLAGILCAVV 230
           + P+     P  M  F+ +E   + +       +   S    +  SF     AG +  VV
Sbjct: 134 LVPIIMGYFPTWMIYFSVYEFCKDNL-------RTNSSNWSFVSHSF-SAITAGAVSTVV 185

Query: 231 SHPADVMVSK------VNADRKQGESMVEASKRIYSRIGFGGLWNGL 271
           ++P  V+ ++      + ++    +   +A K+I ++ G   L+ GL
Sbjct: 186 TNPIWVVKTRLMLQTHIGSNTTHYQGTYDAFKKIINQEGVKALYAGL 232

>Kwal_55.20868
          Length = 380

 Score = 48.9 bits (115), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 42/171 (24%), Positives = 72/171 (42%), Gaps = 19/171 (11%)

Query: 112 TAVYLCASASAEFLADILLCPWEAIKVKQQ-----TTIPPFCKNFLEGWSKITAAEGLSG 166
           T +   + A A FLA + +CP +  K + Q     +    + K  L   + I   EG  G
Sbjct: 75  TEITALSGAMAGFLAGVTVCPLDVAKTRLQAQGLHSNPSNYYKGILGTLTTIIRDEGARG 134

Query: 167 LYKGITPLWCRQIPYTMCKFTSFERIVEMIYAKLPRSKQEMSPSQQIGVSFVGGYLAGIL 226
           LYKG+ P+     P  M  F+ +ER  ++     PR    + PS            AG +
Sbjct: 135 LYKGLVPIIMGYFPTWMIYFSVYERSKKL----YPR----IFPSFDFISHSASALTAGTV 186

Query: 227 CAVVSHPADVMVSK------VNADRKQGESMVEASKRIYSRIGFGGLWNGL 271
             ++++P  V+ ++      VN +     S  +A  ++Y+  G    + GL
Sbjct: 187 STILTNPVWVVKTRLMLQTHVNKNSTHYTSTFDAFHKMYTTEGLRTFYAGL 237

 Score = 45.8 bits (107), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 43/174 (24%), Positives = 70/174 (40%), Gaps = 19/174 (10%)

Query: 35  PLDLVKCRLQV------NPQLYRSNLDGWKTIVRSEGLSKVFTGVGATFIGYSLQGACKY 88
           P+ +VK RL +      N   Y S  D +  +  +EGL   + G+  + +G     A  +
Sbjct: 193 PVWVVKTRLMLQTHVNKNSTHYTSTFDAFHKMYTTEGLRTFYAGLLPSLLGL-FHVAIHF 251

Query: 89  GGYEYFK--QTYSNLLSPETAHRHRTAVYLCASASAEFLADILLCPWEAIKVKQQTTIPP 146
             YE  K     +  +S    H    A  + AS++++ +A  L  P E ++ + Q    P
Sbjct: 252 PIYEKLKVWLHCTPSMSRTEDHNLNLARLIIASSASKMVASTLTYPHEILRTRMQLKAYP 311

Query: 147 ------FCKNFLEGWSKITA----AEGLSGLYKGITPLWCRQIPYTMCKFTSFE 190
                   K    G  ++      +EGL G Y G T    R +P +     SFE
Sbjct: 312 TDPLAALQKTSRHGLIRLIKHTYKSEGLRGFYSGFTANLARTLPASAITLVSFE 365

 Score = 45.4 bits (106), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 54/299 (18%), Positives = 112/299 (37%), Gaps = 37/299 (12%)

Query: 20  LGGVVACGPTHSSVTPLDLVKCRLQV-----NP-QLYRSNLDGWKTIVRSEGLSKVFTGV 73
           L GV  C        PLD+ K RLQ      NP   Y+  L    TI+R EG   ++ G+
Sbjct: 88  LAGVTVC--------PLDVAKTRLQAQGLHSNPSNYYKGILGTLTTIIRDEGARGLYKGL 139

Query: 74  GATFIGYSLQGACKYGGYEYFKQTYSNLLSPETAHRHRTAVYLCASASAEFLADILLCPW 133
               +GY       +  YE  K+ Y  +        H  +     + S      IL  P 
Sbjct: 140 VPIIMGYFPTWMIYFSVYERSKKLYPRIFPSFDFISHSASALTAGTVST-----ILTNPV 194

Query: 134 EAIKVK--QQTTIPPFCKNF---LEGWSKITAAEGLSGLYKGITPLWCRQIPYTMCKFTS 188
             +K +   QT +     ++    + + K+   EGL   Y G+ P     + +    F  
Sbjct: 195 WVVKTRLMLQTHVNKNSTHYTSTFDAFHKMYTTEGLRTFYAGLLPSLL-GLFHVAIHFPI 253

Query: 189 FERIVEMIYAKLPRSKQEMSPSQQIGVSFVGGYLAGILCAVVSHPADVMVSKVN------ 242
           +E++   ++     S+ E   +  +    +    + ++ + +++P +++ +++       
Sbjct: 254 YEKLKVWLHCTPSMSRTE-DHNLNLARLIIASSASKMVASTLTYPHEILRTRMQLKAYPT 312

Query: 243 -----ADRKQGESMVEASKRIYSRIGFGGLWNGLPVRIFMIGTLTSFQWLIYDSFKAYI 296
                  +     ++   K  Y   G  G ++G    +      ++   + ++ F+ Y+
Sbjct: 313 DPLAALQKTSRHGLIRLIKHTYKSEGLRGFYSGFTANLARTLPASAITLVSFEYFRKYL 371

>Scas_558.2
          Length = 289

 Score = 48.5 bits (114), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 58/274 (21%), Positives = 108/274 (39%), Gaps = 29/274 (10%)

Query: 15  YAACTLGGVVACGPTHSSVTPLDLVKCRLQVNPQLYRSNLDGWKTIVRSEGLSKVFTGVG 74
           +    L G  A   T     P+D +K RLQ     +++            G   ++ G+G
Sbjct: 6   FVMSLLSGAAAGTSTDLVFFPIDTLKTRLQAKGGFFQNG-----------GYHGIYRGLG 54

Query: 75  ATFIGYSLQGACKYGGYEYFK-------QTYSNLLSPETAHRHRTAVYLCASASAEFLAD 127
           +  +  +   +  +  Y+  K       +   N     + H   T V++ AS+  E  A 
Sbjct: 55  SAVVASAPSASLFFVTYDSMKVRVRPHVERVINSSGTRSPHSVDTIVHMIASSMGELAAC 114

Query: 128 ILLCPWEAIKVKQQTTIPPFCKNFLEGWSKITAAEGL-SGLYKGITPLWCRQIPYTMCKF 186
           ++  P E IK + Q               K    EG+   LY+G +    R+IP+T  +F
Sbjct: 115 LVRVPAEVIKQRTQVHSTNSSWQTFRTILKNENQEGIIRNLYRGWSTTIMREIPFTCIQF 174

Query: 187 TSFERIVEMIYAKLPRSKQEMSPSQQIGVSFVGGYLAGILCAVVSHPADVMVSK--VNAD 244
             +E  ++  +A        + P +      + G +AG + A  + P D + ++  +N D
Sbjct: 175 PLYE-FMKKEWALYDNEVGHLKPWK----GAICGSIAGGIAAATTTPLDFLKTRLMLNKD 229

Query: 245 RKQGESMVEASKRIYSRIGFGGLWNGLPVRIFMI 278
               +S++   + IY   GF   ++G+  R   I
Sbjct: 230 SIPIKSLI---RNIYKEEGFKIFFSGIYPRTMWI 260

 Score = 32.3 bits (72), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 23/73 (31%), Positives = 35/73 (47%), Gaps = 5/73 (6%)

Query: 22  GVVACGPTHSSVTPLDLVKCRLQVNPQLY--RSNLDGWKTIVRSEGLSKVFTGVGATFIG 79
           G +A G   ++ TPLD +K RL +N      +S +   + I + EG    F+G+    + 
Sbjct: 203 GSIAGGIAAATTTPLDFLKTRLMLNKDSIPIKSLI---RNIYKEEGFKIFFSGIYPRTMW 259

Query: 80  YSLQGACKYGGYE 92
            S  GA   G YE
Sbjct: 260 ISAGGAIFLGVYE 272

>Scas_717.20
          Length = 356

 Score = 48.5 bits (114), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 68/337 (20%), Positives = 129/337 (38%), Gaps = 41/337 (12%)

Query: 3   TKQPIPLFSPEYYAACTLGGVVACGPTHSSVTPLDLVKCRLQV-NPQL--YRSNLDGWKT 59
            + PI   S EY     L G ++     + + PLD +K   Q  NP    Y  +L G K 
Sbjct: 20  NQMPIDKNSLEYITRSGLAGGISGSCAKTLIAPLDRIKILFQTSNPHYTKYAGSLVGLKE 79

Query: 60  IVR----SEGLSKVFTGVGATFIGYSLQGACKYGGYEYFKQTYSNLLSPETAHRHRTAVY 115
             +    ++G+   F G   T +      A K+  YE  + T       E+  R   +  
Sbjct: 80  AAKHIWLNDGIRGFFQGHSVTLMRIFPYAAVKFVAYEQIRNTLIPSKEYESHWRRLMSGS 139

Query: 116 LCA--SASAEFLADILLCPWEAIKVKQQTTIPPFCKN-FLEGWSKITAAEGL-------- 164
           L    S    +  D++      +   ++ ++    K  + E  S    A+G         
Sbjct: 140 LAGLCSVFTTYPLDLIRVRLAYVTEHKRISLLGLVKTIYKEPASTTLEAKGYIPNWFAHW 199

Query: 165 SGLYKGITPLWCRQIPYTMCKFTSFERIVEMIYAKL--PRSKQEMSPSQQIGVSF----- 217
              Y+G TP     IPY    F + + + +++   +  P S   +S S+Q    F     
Sbjct: 200 CNFYRGYTPTVLGMIPYAGVSFFAHDLLHDVLKHPILAPYSVLALSESEQEERHFKHQRL 259

Query: 218 --------VGGYLAGILCAVVSHPADVMVSKVNAD--------RKQGESMVEASKRIYSR 261
                   + G LAG+     ++P +++  ++             + +S+ E +K IY  
Sbjct: 260 PLRTWAELLSGGLAGMASQTAAYPFEIIRRRLQVSTLSVSQMYDHRFQSISEIAKIIYKE 319

Query: 262 IGFGGLWNGLPVRIFMIGTLTSFQWLIYDSFKAYIGL 298
            G+ G + GL +    +  + +  + +Y+  K ++G+
Sbjct: 320 RGWRGFFVGLSIGYIKVTPMVACSFFVYERMKWHLGI 356

>CAGL0J01661g 154646..155629 highly similar to tr|Q12251
           Saccharomyces cerevisiae YPR011c, start by similarity
          Length = 327

 Score = 48.5 bits (114), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 61/295 (20%), Positives = 114/295 (38%), Gaps = 28/295 (9%)

Query: 20  LGGVVACGPTHSSVTPLDLVKCRLQVNPQLYRSN---LDGWKTIVRSEGLSKVFTGVGAT 76
           L G +A   + + V+P + VK  LQV       N    D    + + E +  +F G G  
Sbjct: 28  LAGGIAGAISRTVVSPFERVKILLQVQSSTTAYNKGLFDAIGQVYKEENIKGLFRGNGLN 87

Query: 77  FIGYSLQGACKYGGYEYFKQTYSNLLSPETAHRHRTAVYLCASASAEFLADILLCPWEAI 136
            I      A ++  +E  K+   ++ +     +      L + A     + +   P + +
Sbjct: 88  CIRVFPYSAVQFVVFEGCKKHIFHVDTKGKGEQLNNWQRLFSGALCGGCSVVATYPLDLV 147

Query: 137 KVK---QQTTIPPFCKNFLEG-------W---SKITAAEG-LSGLYKGITPLWCRQIPYT 182
           + +   Q   +    K+           W   SK  A EG + GLY+G+ P     +PY 
Sbjct: 148 RTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAYAEEGGIMGLYRGVWPTSLGIVPYV 207

Query: 183 MCKFTSFERIVEMIYAKLPRSKQEMSPSQQIGVSFVGGYLAGILCAVVSHPADVMVSKVN 242
              F  +E++ E     +P  +   S  +        G ++G +   +++P D++  +  
Sbjct: 208 ALNFAVYEQLKEF----MPSDENGNSSMRDSLYKLSMGAISGGVAQTITYPFDLLRRRFQ 263

Query: 243 ADRKQG-------ESMVEASKRIYSRIGFGGLWNGLPVRIFMIGTLTSFQWLIYD 290
                G        S+ +A   I    GF G + GL   +F +   T+  WL+Y+
Sbjct: 264 VLAMGGNELGFHYNSVWDALVTIGKTEGFKGYYKGLTANLFKVVPSTAVSWLVYE 318

 Score = 42.4 bits (98), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 29/136 (21%), Positives = 61/136 (44%), Gaps = 5/136 (3%)

Query: 109 RHRTAVYLCASASAEFLADILLCPWEAIKV--KQQTTIPPFCKNFLEGWSKITAAEGLSG 166
           +  T V   A   A  ++  ++ P+E +K+  + Q++   + K   +   ++   E + G
Sbjct: 20  KQDTNVAFLAGGIAGAISRTVVSPFERVKILLQVQSSTTAYNKGLFDAIGQVYKEENIKG 79

Query: 167 LYKGITPLWCRQIPYTMCKFTSFERIVEMIYAKLPRSKQEMSPSQQIGVSFVGGYLAGIL 226
           L++G      R  PY+  +F  FE   + I+    + K E   + Q       G L G  
Sbjct: 80  LFRGNGLNCIRVFPYSAVQFVVFEGCKKHIFHVDTKGKGEQLNNWQ---RLFSGALCGGC 136

Query: 227 CAVVSHPADVMVSKVN 242
             V ++P D++ ++++
Sbjct: 137 SVVATYPLDLVRTRLS 152

>YIL134W (FLX1) [2542] chr9 (97395..98330) Protein involved in
           transport of FAD from cytosol into the mitochondrial
           matrix, member of mitochondrial carrier (MCF) family of
           membrane transporters [936 bp, 311 aa]
          Length = 311

 Score = 48.1 bits (113), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 67/304 (22%), Positives = 128/304 (42%), Gaps = 39/304 (12%)

Query: 20  LGGVVACGPTHSSVTPLDLVKCRLQVNPQLYRSNLDG----WKTIVRSEGLS------KV 69
           + G+ A   T   V PLDL+K RLQ++    +    G     K I+RS   S      ++
Sbjct: 14  ISGLSAGSVTTLVVHPLDLLKVRLQLSATSAQKAHYGPFMVIKEIIRSSANSGRSVTNEL 73

Query: 70  FTGVGATFIGYSLQGACKYGGYEYFKQ-TYSNLLSP-ETA-------HRHRTAVYLCASA 120
           + G+     G ++     +G Y   K+  Y ++  P ET        H+  + +YL A A
Sbjct: 74  YRGLSINLFGNAIAWGVYFGLYGVTKELIYKSVAKPGETQLKGVGNDHKMNSLIYLSAGA 133

Query: 121 SAEFLADILLCPWEAIKVKQQTT---IPPFCKNFLEGWSKITAAEGLSGLYKGITPLWCR 177
           S+  +  IL  P   IK +  +T         +   G  ++   +G  GL+KG+ P    
Sbjct: 134 SSGLMTAILTNPIWVIKTRIMSTSKGAQGAYTSMYNGVQQLLRTDGFQGLWKGLVPAL-- 191

Query: 178 QIPYTMCKFTSFERIVEMIYAKLPRSKQE------MSPSQQIGVSFVGGYLAGILCAVVS 231
              + + +   +  + + +  +  R K+E      ++  + I ++ +G  ++  L     
Sbjct: 192 ---FGVSQGALYFAVYDTLKQRKLRRKRENGLDIHLTNLETIEITSLGKMVSVTLV---- 244

Query: 232 HPADVMVSKVNADR--KQGESMVEASKRIYSRIGFGGLWNGLPVRIFMIGTLTSFQWLIY 289
           +P  ++ S + + R  +Q   +    K I +  GF GL+ GL   +      T   + +Y
Sbjct: 245 YPFQLLKSNLQSFRANEQKFRLFPLIKLIIANDGFVGLYKGLSANLVRAIPSTCITFCVY 304

Query: 290 DSFK 293
           ++ K
Sbjct: 305 ENLK 308

>Scas_714.18
          Length = 305

 Score = 47.8 bits (112), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 43/191 (22%), Positives = 82/191 (42%), Gaps = 36/191 (18%)

Query: 33  VTPLDLVKCRLQVNPQLYRSNLDGW---------------------------KTIVRSEG 65
           +TP++L+KC+LQ++  L+ S  D                             K+I++ +G
Sbjct: 124 LTPVELIKCKLQIS-NLHYSLHDNDGEQQDEEDEDQGMVIGEGRHTRIIPTIKSIIKEKG 182

Query: 66  LSKVFTGVGATFIGYSLQGACKYGGYEYFKQTYSNLLSPETAHRHRTAVYLCASASAEFL 125
           L  ++ G  +TFI  S+     +  YE  KQT    L    +  + T   L + A+A   
Sbjct: 183 LFGLWQGQSSTFIRESIGSVVWFATYELMKQT----LRDPKSEVNTTWQLLISGATAGLA 238

Query: 126 ADILLCPWEAIKVKQQTTIPPFCKNFLEGWSKITAAEGLSGLYKGITPLWCRQIPYTMCK 185
            +  + P + +K   QT         +E    I   +G++G Y+G+     R +P     
Sbjct: 239 FNGSVFPADTVKSIMQTEHLA----LMETVRSILERDGVAGFYRGLGITLLRAVPSNAAV 294

Query: 186 FTSFERIVEMI 196
           F ++E++ +++
Sbjct: 295 FYTYEKLSKIL 305

>AER366W [2867] [Homologous to ScYIL134W (FLX1) - SH]
           complement(1314627..1315508) [882 bp, 293 aa]
          Length = 293

 Score = 47.8 bits (112), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 48/235 (20%), Positives = 100/235 (42%), Gaps = 17/235 (7%)

Query: 68  KVFTGVGATFIGYSLQGACKYGGYEYFKQTYSNLLSPETA-----HRHRTAVYLCASASA 122
           +++ G+G   +G S+  A  +G Y   K      L  E+A      R     Y+ A+ S+
Sbjct: 64  ELYRGLGVNLLGNSVAWALYFGCYRCAKDIALRHLGNESATGIMDRRLPAHAYMLAAGSS 123

Query: 123 EFLADILLCPWEAIKVKQQTT--IPPFCKNFLEGWSKITAAEGLSGLYKGITP--LWCRQ 178
                +L  P   IK +   T    P+   F +G  K+   EG+   ++G+ P  L   Q
Sbjct: 124 GIATAVLTNPIWVIKTRIMATSRAGPYKSTF-DGVYKLYQTEGVLAFWRGVVPSLLGVSQ 182

Query: 179 IPYTMCKFTSFERIVEMIYAKLPRSKQEMSPSQQIGVSFVGGYLAGILCAVVSHPADVMV 238
                  + + +     +++   ++++ +S S+ IG++ +    + ++     +P  ++ 
Sbjct: 183 GAIYFALYDTLK--FHYLHSSTDKAERRLSVSEIIGITCI----SKMISVTSVYPFQLLK 236

Query: 239 SKVNADRKQGESMVEASKRIYSRIGFGGLWNGLPVRIFMIGTLTSFQWLIYDSFK 293
           SK+  D      + +  + +YSR G  G + GL   +      T   + +Y++ K
Sbjct: 237 SKLQ-DFGAPSGITQLVQTVYSREGIRGFYRGLSANLLRAVPATCITFFVYENIK 290

 Score = 47.4 bits (111), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 36/161 (22%), Positives = 74/161 (45%), Gaps = 5/161 (3%)

Query: 34  TPLDLVKCRLQVNPQL--YRSNLDGWKTIVRSEGLSKVFTGVGATFIGYSLQGACKYGGY 91
            P+ ++K R+    +   Y+S  DG   + ++EG+   + GV  + +G S QGA  +  Y
Sbjct: 132 NPIWVIKTRIMATSRAGPYKSTFDGVYKLYQTEGVLAFWRGVVPSLLGVS-QGAIYFALY 190

Query: 92  EYFKQTYSNLLSPETAHRHRTAVYLCASASAEFLADILLCPWEAIKVKQQTTIPPFCKNF 151
           +  K  Y +  + +   R   +  +  +  ++ ++   + P++ +K K Q    P     
Sbjct: 191 DTLKFHYLHSSTDKAERRLSVSEIIGITCISKMISVTSVYPFQLLKSKLQDFGAP--SGI 248

Query: 152 LEGWSKITAAEGLSGLYKGITPLWCRQIPYTMCKFTSFERI 192
            +    + + EG+ G Y+G++    R +P T   F  +E I
Sbjct: 249 TQLVQTVYSREGIRGFYRGLSANLLRAVPATCITFFVYENI 289

>Scas_697.47
          Length = 328

 Score = 47.8 bits (112), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 64/271 (23%), Positives = 107/271 (39%), Gaps = 30/271 (11%)

Query: 17  ACTLGGVVACGPTHSSVTPLDLVKCRLQVNPQLYRSNLDGWKTIVRS-----------EG 65
           A  +GGV A    H    P DL+K R Q       S +   K I++              
Sbjct: 42  AGGVGGVCAVLTGH----PFDLIKVRCQSGQA--SSTIHAIKIILKDARAIPTSNMLVNS 95

Query: 66  LSKVFTGVGATFIGYSLQGACKYGGYEYFKQTYSNLLSPETAHRHRTAVYLCASASAEFL 125
           +   + GV    +G +   A  + GY+  K+  +       +      + +   A+A F+
Sbjct: 96  VKGFYKGVIPPLLGVTPIFAVSFWGYDVGKKIVTR------SDSSSAQLTMGQMAAAGFI 149

Query: 126 ADI----LLCPWEAIKVKQQTTIPPFCKNFLEGWSKITAAEGLSGLYKGITPLWCRQIPY 181
           + I    +  P E IKV  QT       +F+     I    G+  L+KG      R  P 
Sbjct: 150 SAIPTTLVTAPTERIKVVLQTAGANSKTSFIGAAKNIVKDGGVKSLFKGSLATLARDGPG 209

Query: 182 TMCKFTSFERIVEMIYAKLPRSKQEMSPSQQIGVSFVGGYLAGILCAVVSHPADVMVSKV 241
           +   F S+E   + +  +   ++ +        V   GG +AG+   +V  P D + +K+
Sbjct: 210 SALYFASYEISKKFLNDRNATAESKTGEVNIANVCLAGG-IAGMSMWLVVFPIDTIKTKL 268

Query: 242 NADRKQGESMVEASKRIY-SRIGFGGLWNGL 271
            +     +SMV A++ IY  R G  G + GL
Sbjct: 269 QSSSGS-QSMVAATREIYVKRGGIKGFFPGL 298

>KLLA0E08877g complement(791157..792041) similar to sgd|S0002277
           Saccharomyces cerevisiae YDL119c, start by similarity
          Length = 294

 Score = 47.4 bits (111), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 56/267 (20%), Positives = 111/267 (41%), Gaps = 17/267 (6%)

Query: 35  PLDLVKCRLQVNPQLYRSNLDGWKTIVRSEGLSKVFTGVGATFIGYSLQGACKYGGYEYF 94
           P DL+K RLQ   Q   S L  WKT+   E  S+++ G   + I  S+  A         
Sbjct: 27  PFDLLKTRLQ---QDKTSTL--WKTLKSIETPSQLWRGALPSCIRTSVGSAMYLTMLNSI 81

Query: 95  KQTYS---NLLSPETAHRHRTAVY--LCASASAEFLADILLCPWEAIKVKQQTTIPPFCK 149
           +Q  S   N  S  +++  +  +Y  + + A    L  ++  P   IKV+ ++T+  +  
Sbjct: 82  RQAISKGKNTGSTGSSYLPQLNMYENMFSGAVTRALTGLITMPITVIKVRYESTLYQYT- 140

Query: 150 NFLEGWSKITAAEGLSGLYKGITPLWCRQIPYTMCKFTSFERIVEMIYAKLPRSKQEMSP 209
           +     S I   EGL G ++G      R  PY       ++R+  ++   LP +  +++ 
Sbjct: 141 SLRYATSHIFRTEGLRGFFRGFGATALRDAPYAGLYMLFYDRMKVLVPTLLPSNVVKLNS 200

Query: 210 SQQIGV---SFVGG---YLAGILCAVVSHPADVMVSKVNADRKQGESMVEASKRIYSRIG 263
             +      + + G   + A ++   ++ P D + +++  +  +  S       I ++  
Sbjct: 201 DNRYSTYASTLINGSSAFSAAVIATSITAPFDTVKTRMQLEPAKFHSFTSTFWHIATKES 260

Query: 264 FGGLWNGLPVRIFMIGTLTSFQWLIYD 290
              L+ G+ +R+          W IY+
Sbjct: 261 VRNLFAGISLRLTRKAFSAGIAWGIYE 287

 Score = 39.3 bits (90), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 44/188 (23%), Positives = 73/188 (38%), Gaps = 18/188 (9%)

Query: 20  LGGVVACGPTHSSVTPLDLVKCRLQVNPQLYRSNLDGWKTIVRSEGLSKVFTGVGATFIG 79
             G V    T     P+ ++K R +     Y S       I R+EGL   F G GAT   
Sbjct: 109 FSGAVTRALTGLITMPITVIKVRYESTLYQYTSLRYATSHIFRTEGLRGFFRGFGAT--- 165

Query: 80  YSLQGACKYGGYEYFKQTY---------SNLLSPETAHRHRTAVYLCASASAEFLADI-- 128
            +L+ A   G Y  F             SN++   + +R+ T      + S+ F A +  
Sbjct: 166 -ALRDAPYAGLYMLFYDRMKVLVPTLLPSNVVKLNSDNRYSTYASTLINGSSAFSAAVIA 224

Query: 129 --LLCPWEAIKVKQQTTIPPFCKNFLEGWSKITAAEGLSGLYKGITPLWCRQIPYTMCKF 186
             +  P++ +K + Q   P    +F   +  I   E +  L+ GI+    R+       +
Sbjct: 225 TSITAPFDTVKTRMQLE-PAKFHSFTSTFWHIATKESVRNLFAGISLRLTRKAFSAGIAW 283

Query: 187 TSFERIVE 194
             +E IV+
Sbjct: 284 GIYEEIVK 291

 Score = 30.0 bits (66), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 9/39 (23%), Positives = 23/39 (58%)

Query: 207 MSPSQQIGVSFVGGYLAGILCAVVSHPADVMVSKVNADR 245
           MS  ++     +GG+  G++ A++  P D++ +++  D+
Sbjct: 1   MSEQRRATTHLIGGFSGGLVSAIILQPFDLLKTRLQQDK 39

>CAGL0K02915g 259026..260054 highly similar to sp|P38702
           Saccharomyces cerevisiae YHR002w LEU5, hypothetical
           start
          Length = 342

 Score = 47.4 bits (111), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 69/346 (19%), Positives = 135/346 (39%), Gaps = 57/346 (16%)

Query: 2   STKQPIPLFSPEYYAACTLGGVVACGPTHSSVTPLDLVKCRLQV-NPQL--YRSNLDGW- 57
           + +Q +   S +Y     L G V+     + + PLD +K   Q  NP    Y  +L G  
Sbjct: 5   NNRQAVDKNSLDYVVRSGLAGGVSGSCAKTLIAPLDRIKILFQTSNPHYSKYAGSLVGLY 64

Query: 58  ---KTIVRSEGLSKVFTGVGATFIGYSLQGACKYGGYEYFKQTYSNLLSPE---TAHRHR 111
              K I  ++G+   F G   T +      A K+  YE  +    ++L P     +H  R
Sbjct: 65  EAAKHIWINDGIRGFFQGHSVTLLRIFPYAAVKFVAYEQIR----SILIPSREYESHWRR 120

Query: 112 TAVYLCASASAEFLA---DILLCPWEAIKVKQQTTIPPFCKNFLEGWSKITAAEGLS--- 165
            A    A   + F+    D+       +   ++  +    K          A+EGL+   
Sbjct: 121 LASGSLAGLCSVFITYPLDLTRVRLAYVTEHKRVKLRDIVKTIYHE----PASEGLTSHL 176

Query: 166 ----------GLYKGITPLWCRQIPYTMCKFTSFERIVEMIYAKL--PRSKQEMSPSQQI 213
                       Y+G  P     IPY    F + + I +++ + L  P + +++S  +++
Sbjct: 177 LVPKWFAHWCNFYRGYVPTVLGMIPYAGVSFFAHDLIHDIMKSSLMAPYAVKQLSSQEEL 236

Query: 214 G-------------VSFVGGYLAGILCAVVSHPADVMVSKVNAD----RK----QGESMV 252
                            V G L+GIL    ++P +++  ++       RK    + +S+ 
Sbjct: 237 ERKKLRQKTPLRTWAELVAGGLSGILSQTAAYPLEIIRRRLQVSTLSPRKMYDHKFQSIS 296

Query: 253 EASKRIYSRIGFGGLWNGLPVRIFMIGTLTSFQWLIYDSFKAYIGL 298
             ++ IY   G+ G + GL +    +  + +  + +Y+  K ++G+
Sbjct: 297 SIARIIYQEKGWRGFFVGLSIGYIKVTPMVACSFFVYERMKWHLGI 342

>Kwal_33.15446
          Length = 305

 Score = 47.4 bits (111), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 49/193 (25%), Positives = 75/193 (38%), Gaps = 17/193 (8%)

Query: 16  AACTLGGVVACGPTHSSVTPLDLVKCRLQVN----PQLYRSNLDGWKTIVRSEGLSKVFT 71
           + C L GV+A         P++L K +LQV        YR  LD  K +  ++G+  ++ 
Sbjct: 117 SGCILSGVLAGWSVSFIAAPVELAKAKLQVQYDAQTTRYRGPLDVIKKVYAADGIRGMYK 176

Query: 72  GVGATFIGYSLQGACKYGGYEYFKQTYSNLLSPETAHRHRTAVYLCASA-SAEFLADILL 130
           G+ +T I +       +G YE   + +         +   TA+   A   SA F      
Sbjct: 177 GLVSTLI-FRTHFVYWWGSYELLTRWFK-----ANTNLSDTAINFWAGGFSASFGFWTTA 230

Query: 131 CPWEAIKVKQQTTIPPFCKNFLEGW----SKITAAEGLSGLYKGITPLWCRQIPYTMCKF 186
            P + IK  Q           L  W    S I    G+ G +KG  P + R  P      
Sbjct: 231 YPSDVIK--QVILCNDKYDGSLRSWRNAASDIWRTRGIRGFFKGFVPSFLRSFPANAAAL 288

Query: 187 TSFERIVEMIYAK 199
            SFE ++ +  AK
Sbjct: 289 ASFEFVLRVSGAK 301

>ADL264C [1477] [Homologous to ScYOR100C (CRC1) - SH]
           (241532..242521) [990 bp, 329 aa]
          Length = 329

 Score = 47.4 bits (111), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 71/270 (26%), Positives = 122/270 (45%), Gaps = 36/270 (13%)

Query: 16  AACTLGGVVACGPTHSSVTPLDLVKCRLQVNPQLYRSNLDGWKTIV---RSE-GLSKV-- 69
           AA  +GGV A    H    P DL+K R Q N       +D  + I+   R++ GLS V  
Sbjct: 52  AAGAVGGVCAVLTGH----PFDLLKVRCQSNQA--SGTVDAVRKILVEARAQSGLSAVNM 105

Query: 70  ----FTGVGATFIGYSLQGACKYGGYEYFKQ--TYSNLLSPETAHRHRTAVYLCASASAE 123
               + GV    +G +   A  + GY+  K+  T+++     T  +  TA ++ A  +  
Sbjct: 106 MRGFYKGVIPPLLGVTPIFAVSFWGYDVGKKLVTWNDNSGKLTTAQLATAGFISAIPTT- 164

Query: 124 FLADILLCPWEAIKVKQQTTIPPFCKNFLEGWSK-ITAAEGLSGLYKGITPLWCRQIPYT 182
               +++ P E +KV  QT       + L   +K I A  G+  L++G      R  P +
Sbjct: 165 ----LVMAPTERVKVVLQTQ----SNHSLGSAAKHILATGGVRSLFRGSLATLARDGPGS 216

Query: 183 MCKFTSFERIVEMIYAKLPRSKQEMSPSQQIGVSFVGGYLAGILCAVVSHPADVMVSKVN 242
              F S+E     + A+      E+S      V   GG +AG+   V   P D + +++ 
Sbjct: 217 ALYFASYEATKAYLNAR--SGTNELSIKN---VCLAGG-MAGVSMWVGVFPIDTIKTELQ 270

Query: 243 ADRKQGESMVEASKRIY-SRIGFGGLWNGL 271
           +   + ++M+EA+++IY +R G  G + G+
Sbjct: 271 SSNTR-QTMMEATRKIYNTRGGIKGFFPGI 299

>CAGL0H10538g 1027739..1028632 highly similar to tr|Q07534
           Saccharomyces cerevisiae YDL119c, hypothetical start
          Length = 297

 Score = 47.0 bits (110), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 56/286 (19%), Positives = 117/286 (40%), Gaps = 15/286 (5%)

Query: 20  LGGVVACGPTHSSVTPLDLVKCRLQVNP-----QLYRSNLDGWKTIVRSEGLSKVFTGVG 74
           +GG      +  ++ PLDL+K R Q        Q  +S    W+ + R    S + T VG
Sbjct: 9   IGGFAGGLSSAVALQPLDLLKTRFQQTKGGTLWQTVKSLDTPWQ-LWRGTLPSAIRTSVG 67

Query: 75  ATFIGYSLQGACKYGGYEYFKQTYSNLLSPETAHRHRTAVY--LCASASAEFLADILLCP 132
           +     SL              T  ++++ ++++  + ++Y  L   A A      +  P
Sbjct: 68  SALYLSSLNLMRTALAKRKQFDTADSVVTGKSSNLPQLSMYENLVTGAFARGTVGYITMP 127

Query: 133 WEAIKVKQQTTIPPFCKNFLEGWSKITAAEGLSGLYKGITPLWCRQIPYTMCKFTSFERI 192
              IKV+ ++T+  + K+  E    I A EG+ G ++G  P   R  PY+      +E++
Sbjct: 128 ITIIKVRYESTLYNY-KSIAEAAKSIAAQEGIRGFFRGFGPTCLRDAPYSGLYVLLYEKL 186

Query: 193 VEMIYAKLPRSKQEMSPSQQ------IGVSFVGGYLAGILCAVVSHPADVMVSKVNADRK 246
              +   LP+S  ++    +        ++     L+  +   V+ P D + +++  +  
Sbjct: 187 KHTLPTILPKSLLQLDSEGRYTAYTSTAINSTSAILSASMATTVTAPFDTIKTRMQLEPT 246

Query: 247 QGESMVEASKRIYSRIGFGGLWNGLPVRIFMIGTLTSFQWLIYDSF 292
           + ++       I ++     +++GL +R+          W IY+  
Sbjct: 247 KFKTFWSTLTTIVTQEHPIKIFSGLSMRLTRKALSAGIAWGIYEEL 292

>Sklu_1275.1 , Contig c1275 314-1249
          Length = 311

 Score = 47.0 bits (110), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 54/245 (22%), Positives = 102/245 (41%), Gaps = 18/245 (7%)

Query: 35  PLDLVKCRLQVNPQLYRSNLDGWKTIVRSEGLSKVFTGVGATFIGYSLQGACKYGGYEYF 94
           P D+ K R+Q +     + ++  K +V++EGL   + G     IG     +C++G  E  
Sbjct: 43  PFDITKVRMQTSSG-SPTAIEVIKNLVKNEGLLAFYKGTLVPLIGVGACVSCQFGVNEAM 101

Query: 95  KQTYSNLLSPETAHRHRTAVYLCASASAEFLADILLCPWEAIKVKQQTTIPPFCK----N 150
           K+ +  +   +  H      Y C   S    A  L  P E ++++ Q       K     
Sbjct: 102 KRYFLRVNGYKDQHLSLLQYYTCGFVSGSANA-FLATPIEHVRIRLQLQTKALAKAEYRG 160

Query: 151 FLEGWSKITAAEGLSGLYKGITPLWCRQIPYTMCKFTSFERIVEMIYAKLPRSKQEMSPS 210
            L+   K+   +    L +G T    R        F ++E ++ M   K    ++++ P 
Sbjct: 161 SLDCMKKLLKQK---ALMRGFTATLMRTSHGFGVYFLTYEALI-MNQNKNGVLRKDIPPW 216

Query: 211 QQIGVSFVGGYLAGILCAVVSHPADVMVSKVNADR----KQGESMVEASKRIYSRIGFGG 266
           +      V G  +G     +++P DV+ S + ADR      G+++ + +K I++  G+G 
Sbjct: 217 KVC----VFGAFSGAFFWAMTYPFDVVKSIMQADRLVSPVHGKNVFQVAKSIHATRGWGA 272

Query: 267 LWNGL 271
              G 
Sbjct: 273 FVKGF 277

 Score = 38.5 bits (88), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 43/173 (24%), Positives = 72/173 (41%), Gaps = 17/173 (9%)

Query: 34  TPLDLVKCRLQVNPQL-----YRSNLDGWKTIVRSEGLSKVFTGVGATFIGYSLQGACKY 88
           TP++ V+ RLQ+  +      YR +LD  K +++ + L + FT   AT +  S      +
Sbjct: 137 TPIEHVRIRLQLQTKALAKAEYRGSLDCMKKLLKQKALMRGFT---ATLMRTSHGFGVYF 193

Query: 89  GGYE--YFKQTYSNLLSPETAHRHRTAVYLCASASAEFLADILLCPWEAIKVKQQT---T 143
             YE     Q  + +L  +     +  V+  A + A F A  +  P++ +K   Q     
Sbjct: 194 LTYEALIMNQNKNGVLRKDIPP-WKVCVF-GAFSGAFFWA--MTYPFDVVKSIMQADRLV 249

Query: 144 IPPFCKNFLEGWSKITAAEGLSGLYKGITPLWCRQIPYTMCKFTSFERIVEMI 196
            P   KN  +    I A  G     KG  P   R +P     F +FE  + ++
Sbjct: 250 SPVHGKNVFQVAKSIHATRGWGAFVKGFVPTMLRSLPVNGATFATFEVTMRLL 302

>Kwal_27.12599
          Length = 304

 Score = 46.6 bits (109), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 56/254 (22%), Positives = 114/254 (44%), Gaps = 36/254 (14%)

Query: 35  PLDLVKCRLQVNPQLYRSNLDGWKTIVRSEGLSKVFTGVGATFIGYSLQGACKYGGYEYF 94
           P D  K RLQ +     + ++  K +V++EGL   + G     +G     +C++G  E  
Sbjct: 44  PFDTTKVRLQTS-TTPTTAVEVVKKLVKNEGLRGFYKGTLTPLVGVGACVSCQFGVNEAM 102

Query: 95  KQTYSNLLSPETAHRHRTAV----YLC---ASASAEFLADILLCPWEAIKVKQQT----- 142
           K+ +       +A  H+T      Y+C      +  FLA     P E ++++ QT     
Sbjct: 103 KRFFRG----SSADPHKTLTLPQYYICGFVGGVANSFLAS----PIEHVRIRLQTQTASG 154

Query: 143 TIPPFCKNFLEGWSKITAAEGLSGLYKGITPLWCRQIPYTMCKFTSFERIV-EMIYAKLP 201
           T+  F K  L+  +K+ A      L +G++P   R+       F ++E +V   I   + 
Sbjct: 155 TVAEF-KGPLDCINKLRAN---GALMRGLSPTILREAQGCATYFLTYEALVANQIGKGIA 210

Query: 202 RSKQEMSPSQQIGVSFVGGYLAGILCAVVSHPADVMVSKVNADR----KQGESMVEASKR 257
           RS     P+ ++ +    G ++G+   +  +P DV+ S +  D      +G+++++ ++ 
Sbjct: 211 RSD---VPAWKLCLF---GAVSGVTLWLTVYPLDVIKSLMQTDNLKNPVRGKNIIQVARL 264

Query: 258 IYSRIGFGGLWNGL 271
           + ++ G+   + G 
Sbjct: 265 VNAKYGWKSFFKGF 278

 Score = 30.4 bits (67), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 44/188 (23%), Positives = 70/188 (37%), Gaps = 19/188 (10%)

Query: 12  PEYYAACTLGGVVACGPTHSSVTPLDLVKCRLQVNPQL-----YRSNLDGWKTIVRSEGL 66
           P+YY    +GGV          +P++ V+ RLQ          ++  LD    + R+ G 
Sbjct: 120 PQYYICGFVGGVA----NSFLASPIEHVRIRLQTQTASGTVAEFKGPLDCINKL-RANG- 173

Query: 67  SKVFTGVGATFIGYSLQGACKYGGYEYFKQTYSNLLSPETAHRHRTAVYLCASASAEFLA 126
             +  G+  T +    QG   Y  +  ++   +N +    A     A  LC   +   + 
Sbjct: 174 -ALMRGLSPTIL-REAQGCATY--FLTYEALVANQIGKGIARSDVPAWKLCLFGAVSGVT 229

Query: 127 DILLC-PWEAIKVKQQTTI---PPFCKNFLEGWSKITAAEGLSGLYKGITPLWCRQIPYT 182
             L   P + IK   QT     P   KN ++    + A  G    +KG  P   R  P  
Sbjct: 230 LWLTVYPLDVIKSLMQTDNLKNPVRGKNIIQVARLVNAKYGWKSFFKGFGPTMLRAAPAN 289

Query: 183 MCKFTSFE 190
              F +FE
Sbjct: 290 GATFATFE 297

>AGR383W [4694] [Homologous to ScYDL119C - SH]
           complement(1436769..1437650) [882 bp, 293 aa]
          Length = 293

 Score = 46.2 bits (108), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 62/283 (21%), Positives = 109/283 (38%), Gaps = 41/283 (14%)

Query: 32  SVTPLDLVKCRLQVNP--------QLYRSNLDGWKTIVRSEGLSKVFTGVGATFIGYSLQ 83
           ++ PLDL+K RLQ           +  R+  + W+  + S   + + + +  + + YS +
Sbjct: 25  ALQPLDLLKTRLQQAQASSLRSVLREVRTTRELWRGTLPSALRTSIGSALYLSLLNYS-R 83

Query: 84  GACKYGGYEYFK-------QTYSNLLSPETAHRHRTAVYLCASASAEFLADILLCPWEAI 136
            A   G     +       Q+Y NLL   T    R AV L               P   I
Sbjct: 84  SALARGSEARTRSSLLPRLQSYQNLL---TGALSRAAVGLVT------------MPITVI 128

Query: 137 KVKQQTTIPPFCKNFLEGWSKITAAEGLSGLYKGITPLWCRQIPYTMCKFTSFERIVEMI 196
           KV+ ++T+  +     E    I  +EG  G +KG      R  PY       +E+  EM+
Sbjct: 129 KVRYESTLYAY-NGLAEATRHIWRSEGARGFFKGAAATTLRDAPYAGLYVLLYEQAKEML 187

Query: 197 YAKLP-------RSKQEMSPSQQIGVSFVGGYLAGILCAVVSHPADVMVSKVNADRKQGE 249
              LP        S +  +P+  + V+ V  +L+  L   ++ P D + +++        
Sbjct: 188 PRALPATLLGADESGKLTAPASAM-VNGVSAFLSASLATTLTAPFDTIKTRMQLQ-SHPV 245

Query: 250 SMVEASKRIYSRIGFGGLWNGLPVRIFMIGTLTSFQWLIYDSF 292
             V+  + I        L++GL +R+          W IY+  
Sbjct: 246 GFVQTLRHIVCEERARTLFDGLSLRLCRKAMSACIAWGIYEEL 288

>KLLA0E18788g complement(1661093..1662238) similar to sp|P38702
           Saccharomyces cerevisiae YHR002w, start by similarity
          Length = 381

 Score = 46.6 bits (109), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 69/340 (20%), Positives = 122/340 (35%), Gaps = 63/340 (18%)

Query: 13  EYYAACTLGGVVACGPTHSSVTPLDLVKCRLQV-NPQL------YRSNLDGWKTIVRSEG 65
           +Y     L G VA     + + PLD +K   Q  NP        ++  L+    I   + 
Sbjct: 51  DYILKSGLAGGVAGSCAKTLIAPLDRIKILFQTSNPHYVKYAGSFQGLLNAGVHIWSRDR 110

Query: 66  LSKVFTGVGATFIGYSLQGACKYGGYEYFKQTYSNLLSPETAHRHRTAVYLCASASAEFL 125
           L  VF G  AT +      A K+  YE  +         ET  R      LC+ + A   
Sbjct: 111 LRGVFQGHSATLLRIFPYAAVKFIAYEQIRNVIIPSKEYETHFRR-----LCSGSLAGLC 165

Query: 126 ADILLCPWEAIKVK-------QQTTIPPFCKNFLEGWSKITAAEGLS------------- 165
           +     P + I+V+        +  + P  K          A+E LS             
Sbjct: 166 SVFCTYPLDLIRVRLAYVTEHHKVRVWPLVKQIYSE----PASEALSSKAYVPKWFAQWC 221

Query: 166 GLYKGITPLWCRQIPYTMCKFTSFE-----------------RIVEMIYAKLPRSKQEMS 208
             Y+G  P     IPY    F + +                 R+ ++    L    Q   
Sbjct: 222 NFYRGYIPTVIGMIPYAGVSFFAHDLFHDILRHPVIAPYSVLRVDDLDADDLKVDVQTTR 281

Query: 209 PSQQIGVS----FVGGYLAGILCAVVSHPADVMVSKV------NADRKQGESMVEASKRI 258
             ++I ++     + G LAG+     ++P +++  ++      N    +  SM E +K I
Sbjct: 282 TGKRIPLNTWAELLAGGLAGMASQTAAYPFEIIRRRLQVGAVTNPLEHKFTSMSEMAKII 341

Query: 259 YSRIGFGGLWNGLPVRIFMIGTLTSFQWLIYDSFKAYIGL 298
           +   G+ G + GL +    +  + +  + +Y+  K Y+G+
Sbjct: 342 FHERGWRGFFVGLSIGYIKVTPMVACSFFVYERMKWYMGI 381

>CAGL0B04543g 441599..442552 highly similar to tr|Q12289
           Saccharomyces cerevisiae YOR100c CRC1, start by
           similarity
          Length = 317

 Score = 45.8 bits (107), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 43/185 (23%), Positives = 69/185 (37%), Gaps = 11/185 (5%)

Query: 11  SPEYYAACTLGGVVACGPTHSSVTPLDLVKCRLQVNPQLYRSNLDGWKTIVRSEGLSKVF 70
           +P   A     G ++  PT     P + +K  LQ N +   S +   K IV + G+  +F
Sbjct: 128 APLTTAQMATAGFISAIPTTLVTAPTERIKVVLQTNSEFKGSFIKAAKHIVSTGGVKSLF 187

Query: 71  TGVGATFIGYSLQGACKYGGYEYFKQTYSNLLSPETAHRHRTAVYLCASASAEFLAD--- 127
            G  AT        A  +  YE  K      L+   A + +  V L     A  +A    
Sbjct: 188 NGSLATLARDGPGSALYFASYELSKA----FLNKSVAKKDKDEVNLANVCLAGGIAGMSM 243

Query: 128 -ILLCPWEAIKVKQQTTIPPFCKNFLEGWSKITAAE-GLSGLYKGITPLWCRQIPYTMCK 185
            +++ P + IK + Q    P   + ++    I     G+ G + G+ P   R  P     
Sbjct: 244 WLVVFPIDTIKTRLQVATTPI--SMVQATKDIYIQRGGIKGFFPGLGPALLRSFPANAAT 301

Query: 186 FTSFE 190
           F   E
Sbjct: 302 FLGVE 306

 Score = 30.0 bits (66), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 28/133 (21%), Positives = 54/133 (40%), Gaps = 5/133 (3%)

Query: 164 LSGLYKGITPLWCRQIPYTMCKFTSFERIVEMIYAKLPRSKQEMSPSQQIGVSFVGGYLA 223
           + G YKG+ P      P     F  ++     I  +L   KQ              G+++
Sbjct: 88  VKGFYKGVIPPLIGVTPIFAVSFWGYD-----IGKRLVTWKQASDAPLTTAQMATAGFIS 142

Query: 224 GILCAVVSHPADVMVSKVNADRKQGESMVEASKRIYSRIGFGGLWNGLPVRIFMIGTLTS 283
            I   +V+ P + +   +  + +   S ++A+K I S  G   L+NG    +   G  ++
Sbjct: 143 AIPTTLVTAPTERIKVVLQTNSEFKGSFIKAAKHIVSTGGVKSLFNGSLATLARDGPGSA 202

Query: 284 FQWLIYDSFKAYI 296
             +  Y+  KA++
Sbjct: 203 LYFASYELSKAFL 215

>Kwal_47.19228
          Length = 281

 Score = 45.4 bits (106), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 28/133 (21%), Positives = 58/133 (43%), Gaps = 11/133 (8%)

Query: 149 KNFLEGWSKITAAEGLSGLYKGITPLWCRQIPYTMCKFTSFERIVEMIYAKLPRSKQEMS 208
           + FL    +I  + G+ G  +G  P   RQ   +  +FT++  + +MI    P ++    
Sbjct: 129 RQFLTTVQEIYRSRGIRGFLQGTMPTIIRQTSNSAVRFTTYTSLKQMISPNKPLNEY--- 185

Query: 209 PSQQIGVSFVGGYLAGILCAVVSHPADVMVSKVNADR--KQGESMVEASKRIYSRIGFGG 266
                  +F  G+++      V+ P DV+ +++ +       ++ +  + RI+   GF  
Sbjct: 186 ------YAFALGFISSCAVVAVTQPIDVIKTRMQSKYTWSNYKNSLNCAYRIFVEEGFTK 239

Query: 267 LWNGLPVRIFMIG 279
            W G   R+  +G
Sbjct: 240 FWKGWAPRLMKVG 252

 Score = 35.8 bits (81), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 29/96 (30%), Positives = 45/96 (46%), Gaps = 6/96 (6%)

Query: 2   STKQPIPLFSP--EYYAACTLGGVVACGPTHSSVTPLDLVKCRLQVNP--QLYRSNLDGW 57
           S KQ I    P  EYYA   LG + +C    +   P+D++K R+Q       Y+++L+  
Sbjct: 171 SLKQMISPNKPLNEYYAFA-LGFISSCAVV-AVTQPIDVIKTRMQSKYTWSNYKNSLNCA 228

Query: 58  KTIVRSEGLSKVFTGVGATFIGYSLQGACKYGGYEY 93
             I   EG +K + G     +   L G   +G Y+Y
Sbjct: 229 YRIFVEEGFTKFWKGWAPRLMKVGLSGGVSFGVYQY 264

>ABL023W [569] [Homologous to ScYKL120W (OAC1) - SH]
           complement(355977..356906) [930 bp, 309 aa]
          Length = 309

 Score = 45.8 bits (107), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 43/179 (24%), Positives = 73/179 (40%), Gaps = 14/179 (7%)

Query: 34  TPLDLVKCRLQVNPQLYRSNLDGWK-----TIVRSEGLSKVFTGVGATFIGYSLQGACKY 88
           +PL LVK R+Q         L G        + +  G+  ++ GV A  +   +  A + 
Sbjct: 136 SPLQLVKTRMQALAPRRVPPLPGRMGRRLVALFKDRGVRGLYQGVDAALLRTGVGSAVQL 195

Query: 89  GGYEYFKQTYSNLLSPETAHRHRTAVYLCASASAEFLADILLCPWEAIKVKQQTTIPPFC 148
             Y + K+  S  + P+       A+Y  ASA +     I + P++    +         
Sbjct: 196 AVYSHAKEALSRHV-PDG-----MALYTLASALSSVAVCIAMNPFDVAMTRMYHHRGGLY 249

Query: 149 KNFLEGWSKITAAEGLSGLYKGITPLWCRQIPYTMCKFTSFE---RIVEMIYAKLPRSK 204
           +  L+   K    EG S LYKG      R  P+T+   T  E   R+V ++  +LP+ +
Sbjct: 250 RGPLDCLCKTVRQEGFSALYKGHLAQLLRIAPHTILCLTLMEQALRVVRLVENRLPQIR 308

>AFR146W [3338] [Homologous to ScYOR130C (ORT1) - SH]
           complement(702404..703249) [846 bp, 281 aa]
          Length = 281

 Score = 45.4 bits (106), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 52/186 (27%), Positives = 77/186 (41%), Gaps = 27/186 (14%)

Query: 20  LGGVVACGPTHSSVTPLDLVKCRLQVN-------PQLYRSNLDGWKTIVRSEGLSKVFTG 72
             G +A   T   +TP++LVKC+LQV+       P+ Y + L   + IV+  GL  ++ G
Sbjct: 107 FAGAIAGACTSYVLTPVELVKCKLQVSNLTGVSGPR-YTAVLPTLRAIVKQNGLGGLWQG 165

Query: 73  VGATFIGYSLQGACKYGGYEYFKQTYSNLLSPETAHRHRTAVYLC---ASASAEFLADIL 129
              TFI  S  GA  +  YE  K      L+        T   L    A A A F A I 
Sbjct: 166 QSGTFIRESAGGAVWFTAYEVLK----GWLARRRGSTENTVWELLASGAGAGAAFHASIF 221

Query: 130 LCPWEAIKVKQQTT---IPPFCKNFLEGWSKITAAEGLSGLYKGITPLWCRQIPYTMCKF 186
             P + +K   QT    + P  +  L+         G +G Y+G+     R +P     F
Sbjct: 222 --PADTVKSTMQTEHLGLGPAVRTVLK-------KHGPTGFYRGVGITLLRALPANAVIF 272

Query: 187 TSFERI 192
             +E +
Sbjct: 273 YVYESL 278

 Score = 31.6 bits (70), Expect = 0.75,   Method: Compositional matrix adjust.
 Identities = 41/160 (25%), Positives = 70/160 (43%), Gaps = 29/160 (18%)

Query: 125 LADILLCPWEAIKVKQQTTIPPFCKNFLEGWSKITAA---EGL-SGLYKGI-TPLWCRQI 179
           L  ++  P++ +KV+ QT        F   WS ++     EGL  G Y+G+ +P++   +
Sbjct: 21  LGKLVEYPFDTVKVRLQTQSAAL---FPTTWSCVSHTYKQEGLWRGFYQGMASPVFGAFL 77

Query: 180 PYTMCKFTSFER---IVEMIYAKLPRSKQEMSPSQQIGVSFVGGYLAGILCAVVSHPADV 236
            + +  F SF R   ++E  Y+  P  K          V F G  +AG   + V  P ++
Sbjct: 78  EHAVL-FVSFNRAQAVLENCYSCGPLEK----------VVFAGA-IAGACTSYVLTPVEL 125

Query: 237 MVSKVNADRKQGES------MVEASKRIYSRIGFGGLWNG 270
           +  K+      G S      ++   + I  + G GGLW G
Sbjct: 126 VKCKLQVSNLTGVSGPRYTAVLPTLRAIVKQNGLGGLWQG 165

>AER419W [2919] [Homologous to ScYNL083W - SH]
           complement(1442595..1444076) [1482 bp, 493 aa]
          Length = 493

 Score = 45.8 bits (107), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 48/192 (25%), Positives = 75/192 (39%), Gaps = 18/192 (9%)

Query: 15  YAACTLGGVVACGPTHSSVTPLDLVKCRLQVNPQLYRSN-----LDGWKTIVRSEGLSKV 69
           Y A  LGG++A      SV P+D +K R+Q  P   R       +   K + R  GL   
Sbjct: 299 YVAGGLGGIMA----QFSVYPIDTLKFRIQCAPLDTRCRGLPLLIKTAKDMYREGGLRLF 354

Query: 70  FTGVGATFIGYSLQGACKYGGYEYFKQTY----SNLLS-PETAHRHRTAVYLCASASAEF 124
           + G+G   +G     A   G +   K+ Y    +N L   E        V L   A +  
Sbjct: 355 YRGLGVGILGVFPYAALDLGTFSALKRWYITRRANALGISENEVVMSNLVVLPMGAFSGT 414

Query: 125 LADILLCPWEAIKVKQQT----TIPPFCKNFLEGWSKITAAEGLSGLYKGITPLWCRQIP 180
           +   ++ P   ++ + Q       P     F + + K    EGL GLYKG+ P   +  P
Sbjct: 415 VGATVVYPINLLRTRLQAQGTYAHPHRYDGFQDVFRKTVQREGLPGLYKGLVPTLAKVCP 474

Query: 181 YTMCKFTSFERI 192
                +  +E +
Sbjct: 475 AVAISYLCYENL 486

>Scas_640.25
          Length = 306

 Score = 45.4 bits (106), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 37/154 (24%), Positives = 66/154 (42%), Gaps = 10/154 (6%)

Query: 33  VTPLDLVKCRLQVNPQLYRSNLDGWKTIVRSEGLSKVFTGVGATFIGYSLQGACKYGGYE 92
           + P +LVK RLQ     ++  ++  K I++ +GL  +++GV +T    ++  A  +G   
Sbjct: 134 IVPFELVKIRLQDVNSKFKGPVEVLKHIIKQDGLKGLYSGVESTVWRNAVWNAGYFGVIF 193

Query: 93  YFKQTYSNLLSPETAHRHRTAVYLCASASAEFLADILLCPWEAIKVKQQTTIPPFCKNFL 152
             ++    LL    + + +T   LCA         +   P++ +K + Q+          
Sbjct: 194 QVRE----LLPVAKSKQEKTRNDLCAGFVGGTFGVMFNTPFDVVKSRIQSDGNEIINGVR 249

Query: 153 E-GWS-----KITAAEGLSGLYKGITPLWCRQIP 180
           +  W+     KI   EG   LYKG  P   R  P
Sbjct: 250 KYNWTWPSVMKIYHEEGFRALYKGFVPKVLRLGP 283

 Score = 40.0 bits (92), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 40/164 (24%), Positives = 74/164 (45%), Gaps = 14/164 (8%)

Query: 116 LCASASAEFLADILLCPWEAIKVKQQTTI--------PPFCKNFLEGWSKITAAEGLSGL 167
             A A A     +++ P + +K + Q  +            K  ++  S+I   EG   +
Sbjct: 17  FMAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGVIDCLSQIVKKEGPMHM 76

Query: 168 YKGITPLWCRQIPYTMCKFTSFERIVEMIYAKLPRSKQEMSPSQQIGVSFVGGYLAGILC 227
           YKGI+     + P    KF S +  +++ +  +  +KQ    +QQI V  + G  AGI  
Sbjct: 77  YKGISSPMLMEAPKRAVKFASNDEFIKL-WKSVFGTKQ---LTQQISV--LSGASAGITE 130

Query: 228 AVVSHPADVMVSKVNADRKQGESMVEASKRIYSRIGFGGLWNGL 271
           A+V  P +++  ++     + +  VE  K I  + G  GL++G+
Sbjct: 131 ALVIVPFELVKIRLQDVNSKFKGPVEVLKHIIKQDGLKGLYSGV 174

>AAL014C [173] [Homologous to ScYNL003C (PET8) - SH]
           (317388..318203) [816 bp, 271 aa]
          Length = 271

 Score = 45.1 bits (105), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 48/193 (24%), Positives = 81/193 (41%), Gaps = 16/193 (8%)

Query: 15  YAACTLGGVVACGPTHSSVTPLDLVKCRLQVNPQLYRSNLDGWKTIVRSEGLSKVFTGVG 74
           + A  + G  A   T     P+D +K RLQ     + +   G++ I R  G + V +  G
Sbjct: 5   FLASLVSGAAAGTSTDVVFFPIDTLKTRLQAKGGFFHNG--GYRGIYRGLGSAVVASAPG 62

Query: 75  ATFIGYSLQGACKYGGYEYFKQTYSNLLSPETAHRHRTAV--YLCASASAEFLADILLCP 132
           A+           +  Y+  KQ    ++   TA      V  ++ +S+  E  A ++  P
Sbjct: 63  ASLF---------FVTYDSMKQQLRPVMGRWTASEQLAEVLTHMLSSSLGEMSACLVRVP 113

Query: 133 WEAIKVKQQTTIPPFCKNFLEGWSKITAAEGL-SGLYKGITPLWCRQIPYTMCKFTSFER 191
            E IK + QT         L    +    EG+  GLY+G      R+IP+T  +F  +E 
Sbjct: 114 AEVIKQRTQTHHTNSSLQTLRLILRDPTGEGVVRGLYRGWWTTIMREIPFTCIQFPLYEY 173

Query: 192 IVE--MIYAKLPR 202
           + +    YA++ R
Sbjct: 174 LKKKWAAYAEIER 186

 Score = 30.8 bits (68), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 31/62 (50%), Gaps = 9/62 (14%)

Query: 35  PLDLVKCRLQVN----PQLYRSNLDGWKTIVRSEGLSKVFTGVGATFIGYSLQGACKYGG 90
           PLD++K R+ ++    P L+ +     +T+ R EG    F G+G   +  S  GA   G 
Sbjct: 209 PLDVLKTRMMLHERRVPMLHLA-----RTLFREEGARVFFRGIGPRTMWISAGGAIFLGV 263

Query: 91  YE 92
           YE
Sbjct: 264 YE 265

>AGL065C [4246] [Homologous to ScYHR002W (LEU5) - SH]
           (585963..586970) [1008 bp, 335 aa]
          Length = 335

 Score = 45.4 bits (106), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 67/333 (20%), Positives = 119/333 (35%), Gaps = 37/333 (11%)

Query: 1   MSTKQ----PIPLFSPEYYAACTLGGVVACGPTHSSVTPLDLVKCRLQV-NPQL--YRSN 53
           MS +Q    P+   S +Y     L G +A     + V PLD +K   Q  NPQ   +  +
Sbjct: 1   MSGRQRGSGPVDKSSVDYIVKSGLAGGIAGSCAKTLVAPLDRIKILFQTSNPQFAQFAGS 60

Query: 54  LDGW----KTIVRSEGLSKVFTGVGATFIGYSLQGACKYGGYEYFKQTYSNLLSPETAHR 109
           + G     K I+  +G    F G  AT +      A K+  YE  +         E+  R
Sbjct: 61  MGGLVRASKYIMAHDGPRGFFQGHSATLLRIFPYAAIKFIAYEQIRSVVIPTWRHESHWR 120

Query: 110 HRTAVYLCA--SASAEFLADILLCPWEAIKVKQQTTIPPFC--------KNFLEGWSKIT 159
              +  L    S    +  D++      +  +    +               L  W    
Sbjct: 121 RLLSGSLAGLCSVFVTYPLDLVRVRLAYVTERHDAKVRKIMACIYNERPSEALRKWYIPQ 180

Query: 160 AAEGLSGLYKGITPLWCRQIPYTMCKFTSFERIVEMIYAKLPRSKQEMSPSQ-------- 211
                S  Y+G TP     IPY    F + +   ++    +      +SP          
Sbjct: 181 WFAHWSNFYRGYTPTVIGMIPYAGVSFFAHDLCQDIFRHPMLEPYSVLSPGGSSAYDRTV 240

Query: 212 --QIGVSFVGGYLAGILCAVVSHPADVMVSKV------NADRKQGESMVEASKRIYSRIG 263
             +     V G LAG+     ++P +++  ++      +  R+    + E +K IY+  G
Sbjct: 241 PLKTWAQLVAGGLAGMASQTAAYPFEIIRRRLQVSAITDPTRRHFVGINEIAKIIYTEGG 300

Query: 264 FGGLWNGLPVRIFMIGTLTSFQWLIYDSFKAYI 296
           + G + GL +    +  + +  + IY+  K Y+
Sbjct: 301 WRGFFVGLSIGYIKVTPMVACSFFIYERTKWYL 333

>YHR002W (LEU5) [2287] chr8 (108806..109879) Protein with similarity
           to Grave's disease protein, member of the mitochondrial
           carrier (MCF) family of membrane transporters [1074 bp,
           357 aa]
          Length = 357

 Score = 45.4 bits (106), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 30/121 (24%), Positives = 54/121 (44%), Gaps = 20/121 (16%)

Query: 126 ADILLCPWEAIKVKQQTTIPPFCK------NFLEGWSKITAAEGLSGLYKGITPLWCRQI 179
           A  L+ P + IK+  QT+ P + K        +E    I   +G+ G ++G +    R  
Sbjct: 47  AKTLIAPLDRIKILFQTSNPHYTKYTGSLIGLVEAAKHIWINDGVRGFFQGHSATLLRIF 106

Query: 180 PYTMCKFTSFERIVEMIYAKLPRSKQEMSPSQQIGVS---FVGGYLAGILCAVVSHPADV 236
           PY   KF ++E+I           +  + PS++        V G LAG+    +++P D+
Sbjct: 107 PYAAVKFVAYEQI-----------RNTLIPSKEFESHWRRLVSGSLAGLCSVFITYPLDL 155

Query: 237 M 237
           +
Sbjct: 156 V 156

 Score = 35.0 bits (79), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 60/334 (17%), Positives = 122/334 (36%), Gaps = 51/334 (15%)

Query: 11  SPEYYAACTLGGVVACGPTHSSVTPLDLVKCRLQV-NPQL--YRSNLDGW----KTIVRS 63
           S +Y     L G ++     + + PLD +K   Q  NP    Y  +L G     K I  +
Sbjct: 29  SFDYIVRSGLAGGISGSCAKTLIAPLDRIKILFQTSNPHYTKYTGSLIGLVEAAKHIWIN 88

Query: 64  EGLSKVFTGVGATFIGYSLQGACKYGGYEYFKQTYSNLLSPETAHRHRTAVYLCASASAE 123
           +G+   F G  AT +      A K+  YE  + T       E+  R      L + + A 
Sbjct: 89  DGVRGFFQGHSATLLRIFPYAAVKFVAYEQIRNTLIPSKEFESHWRR-----LVSGSLAG 143

Query: 124 FLADILLCPWEAIKVK-------QQTTIPPFCKNFLEGWSKITAAEG---------LSGL 167
             +  +  P + ++V+       ++  +    K   +  +  T  +              
Sbjct: 144 LCSVFITYPLDLVRVRLAYETEHKRVKLGRIIKKIYKEPASATLIKNDYIPNWFCHWCNF 203

Query: 168 YKGITPLWCRQIPYTMCKFTSFERIVEMIYAKL--PRSKQEMSPSQQIG----------- 214
           Y+G  P     IPY    F + + + +++ +    P S  E+S   ++            
Sbjct: 204 YRGYVPTVLGMIPYAGVSFFAHDLLHDVLKSPFFAPYSVLELSEDDELERVQKKQRRPLR 263

Query: 215 --VSFVGGYLAGILCAVVSHPADVMVSKVNAD--------RKQGESMVEASKRIYSRIGF 264
                + G LAG+     ++P +++  ++             + +S+ E +  I+   G 
Sbjct: 264 TWAELISGGLAGMASQTAAYPFEIIRRRLQVSALSPKTMYDHKFQSISEIAHIIFKERGV 323

Query: 265 GGLWNGLPVRIFMIGTLTSFQWLIYDSFKAYIGL 298
            G + GL +    +  + +  + +Y+  K   G+
Sbjct: 324 RGFFVGLSIGYIKVTPMVACSFFVYERMKWNFGI 357

>YPR011C (YPR011C) [5447] chr16 complement(583057..584037) Protein
           with similarity to human Grave's disease carrier protein
           and to bovine homolog of Grave's disease protein, member
           of the mitochondrial carrier family (MCF) of membrane
           transporters [981 bp, 326 aa]
          Length = 326

 Score = 45.1 bits (105), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 61/298 (20%), Positives = 110/298 (36%), Gaps = 34/298 (11%)

Query: 20  LGGVVACGPTHSSVTPLDLVKCRLQVNPQLYRSN---LDGWKTIVRSEGLSKVFTGVGAT 76
           L G VA   + + V+P + VK  LQV       N       + +   EG   +F G G  
Sbjct: 27  LAGGVAGAVSRTVVSPFERVKILLQVQSSTTSYNRGIFSSIRQVYHEEGTKGLFRGNGLN 86

Query: 77  FIGYSLQGACKYGGYEYFKQTYSNLLSPETAHRHRTAVYLCASASAEFLADILLCPWEAI 136
            I      A ++  YE  K+   ++       +      L + A     + +   P + I
Sbjct: 87  CIRIFPYSAVQFVVYEACKKKLFHVNGNNGQEQLTNTQRLFSGALCGGCSVVATYPLDLI 146

Query: 137 KVK----------------QQTTIPPFCKNFLEGWSKITAAEGLSGLYKGITPLWCRQIP 180
           K +                +  + PP     L    ++    GL GLY+G+ P     +P
Sbjct: 147 KTRLSIQTANLSSLNRSKAKSISKPPGIWQLLSETYRLEG--GLRGLYRGVWPTSLGVVP 204

Query: 181 YTMCKFTSFERIVEMIYAKLPRSKQEMSPSQQIGV-SFVGGYLAGILCAVVSHPADVMVS 239
           Y    F  +E++ E        +  +  PS +  +     G ++G +   +++P D++  
Sbjct: 205 YVALNFAVYEQLRE-----FGVNSSDAQPSWKSNLYKLTIGAISGGVAQTITYPFDLLRR 259

Query: 240 KVNADRKQGE-------SMVEASKRIYSRIGFGGLWNGLPVRIFMIGTLTSFQWLIYD 290
           +       G        S+ +A   I    G  G + GL   +F +   T+  WL+Y+
Sbjct: 260 RFQVLAMGGNELGFRYTSVWDALVTIGRAEGVSGYYKGLAANLFKVVPSTAVSWLVYE 317

 Score = 31.6 bits (70), Expect = 0.78,   Method: Compositional matrix adjust.
 Identities = 44/197 (22%), Positives = 80/197 (40%), Gaps = 24/197 (12%)

Query: 22  GVVACGPTHSSVTPLDLVKCRLQVN-PQLYRSNLDGWKTIVR--------SE------GL 66
           G +  G +  +  PLDL+K RL +    L   N    K+I +        SE      GL
Sbjct: 129 GALCGGCSVVATYPLDLIKTRLSIQTANLSSLNRSKAKSISKPPGIWQLLSETYRLEGGL 188

Query: 67  SKVFTGVGATFIGYSLQGACKYGGYEYFKQTYSNLLSPETAHRHRTAVY-LCASASAEFL 125
             ++ GV  T +G     A  +  YE  ++   N  S +     ++ +Y L   A +  +
Sbjct: 189 RGLYRGVWPTSLGVVPYVALNFAVYEQLREFGVN--SSDAQPSWKSNLYKLTIGAISGGV 246

Query: 126 ADILLCPWEAIKVKQQTTI---PPFCKNFLEGWSKITA---AEGLSGLYKGITPLWCRQI 179
           A  +  P++ ++ + Q            +   W  +     AEG+SG YKG+     + +
Sbjct: 247 AQTITYPFDLLRRRFQVLAMGGNELGFRYTSVWDALVTIGRAEGVSGYYKGLAANLFKVV 306

Query: 180 PYTMCKFTSFERIVEMI 196
           P T   +  +E + + +
Sbjct: 307 PSTAVSWLVYEVVCDSV 323

>KLLA0D04950g 424550..425374 similar to sp|P38921 Saccharomyces
           cerevisiae YNL003c PET8 member of the mitochondrial
           carrier (MCF) family, start by similarity
          Length = 274

 Score = 44.7 bits (104), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 41/183 (22%), Positives = 72/183 (39%), Gaps = 16/183 (8%)

Query: 13  EYYAACTLGGVVACGPTHSSVTPLDLVKCRLQVNPQLYRSNLDGWKTIVRSEGLSKVFTG 72
           + + A  + G  A   T  +  P+D +K RLQ     + +            G   V+ G
Sbjct: 4   QMFIASLVSGAAAGTSTDLAFFPIDTLKTRLQAKGGFFANG-----------GYKGVYRG 52

Query: 73  VGATFIGYSLQGACKYGGYEYFK----QTYSNLLSPETAHRHRTAVYLCASASAEFLADI 128
           +G+  +  +   +  +  Y+  K         LL         T  ++ +S+  E  A +
Sbjct: 53  LGSAVVASAPSASLFFVAYDSMKCWSRPVIGQLLPKGEDQTADTLSHMVSSSFGEISACM 112

Query: 129 LLCPWEAIKVKQQTTIPPFCKNFLEGWSKITAAEGLS-GLYKGITPLWCRQIPYTMCKFT 187
           +  P E IK + QT         L+   +    EGL   LY+G +    R+IP+T  +F 
Sbjct: 113 VRVPAEVIKQRTQTHRTNSSLQTLQALLRNENGEGLRRNLYRGWSTTIMREIPFTCIQFP 172

Query: 188 SFE 190
            +E
Sbjct: 173 LYE 175

 Score = 35.0 bits (79), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 34/59 (57%), Gaps = 1/59 (1%)

Query: 34  TPLDLVKCRLQVNPQLYRSNLDGWKTIVRSEGLSKVFTGVGATFIGYSLQGACKYGGYE 92
           TPLD++K R+ ++ +   S L   KT+++ EG+   F+GVG   +  S  GA   G YE
Sbjct: 211 TPLDVLKTRIMLHHKSV-SALHLAKTMLQEEGVKVFFSGVGPRTMWISAGGAIFLGVYE 268

>Sklu_2442.8 YNL003C, Contig c2442 12309-13136
          Length = 275

 Score = 44.3 bits (103), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 62/264 (23%), Positives = 113/264 (42%), Gaps = 28/264 (10%)

Query: 22  GVVACGPTHSSVTPLDLVKCRLQVNPQLYRSNLDGWKTIVRSEGLSKVFTGVGATFIGYS 81
           G  A   T  +  P+D +K RLQ     + +            G   V+ G+G+  I  +
Sbjct: 13  GAAAGTSTDLAFFPIDTLKTRLQAKGGFFANG-----------GYKGVYRGLGSAVIASA 61

Query: 82  LQGACKYGGYEYFKQTYSNLLSPETAHRHRTA---VYLCASASAEFLADILLCPWEAIKV 138
              +  +  Y+  K     ++S      ++ A    ++ +S+  E  A ++  P E IK 
Sbjct: 62  PSASLFFVSYDSMKVYSKPVISKYVTSNNQMADTLSHMFSSSIGEVSACLVRVPAEVIKQ 121

Query: 139 KQQTTIPPFCKNFLEGWSKITAAEG----LSGLYKGITPLWCRQIPYTMCKFTSFERIVE 194
           + QT       +  + ++KI   E     L  LY+G      R+IP+T  +F  +E  ++
Sbjct: 122 RTQTHK---TNSSWQTFTKILQNENGEGVLRNLYRGWNTTIMREIPFTCIQFPLYE-FLK 177

Query: 195 MIYAKLPRSKQEMSPSQQIGVSFVGGYLAGILCAVVSHPADVMVSKVNADRKQGESMVEA 254
             +AK  R+ Q+     Q  V    G +AG + A  + P DV+ +++    K    + + 
Sbjct: 178 KTWAK--RNGQDHVAPWQGSVC---GSVAGAIAAATTTPLDVLKTRLMLSHKS-IPVAQL 231

Query: 255 SKRIYSRIGFGGLWNGLPVRIFMI 278
           +K IY+  GF   ++G+  R   I
Sbjct: 232 AKNIYAEEGFKVFFSGVGPRTMWI 255

>YEL006W (YEL006W) [1417] chr5 (144326..145333) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters [1008 bp, 335 aa]
          Length = 335

 Score = 44.3 bits (103), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 53/277 (19%), Positives = 117/277 (42%), Gaps = 30/277 (10%)

Query: 33  VTPLDLVKCRLQVN--------PQLYRSNLDGWKTIVRSEGLSKVFTGVGATFIGYSLQG 84
           V P D+ K RLQ           Q Y+     + TI + EG + ++ G+  T +GY    
Sbjct: 56  VCPFDVAKTRLQAQGLQNMTHQSQHYKGFFGTFATIFKDEGAAGLYKGLQPTVLGYIPTL 115

Query: 85  ACKYGGYEYFKQTYSNLLSPETAHRHRTAVYLCASASAEFLADILLCPWEAIKVK--QQT 142
              +  Y++ ++ YS  + P +      +  + A A    ++ +   P   +K +   QT
Sbjct: 116 MIYFSVYDFCRK-YSVDIFPHSPFLSNASSAITAGA----ISTVATNPIWVVKTRLMLQT 170

Query: 143 TIPPFCKNF---LEGWSKITAAEGLSGLYKGITPLWCRQIPYTMCKFTSFERI-VEMIYA 198
            I  +  ++   ++ + KI   EG   LY G+ P     +   + +F  +E + +   Y+
Sbjct: 171 GIGKYSTHYKGTIDTFRKIIQQEGAKALYAGLVPALLGMLNVAI-QFPLYENLKIRFGYS 229

Query: 199 KLPRSKQEMSPSQQIGVSFVGGYLAGILCAVVSHPADVMVSKVNADRKQGES----MVEA 254
           +      +++ S       +   L+ ++ + V++P +++ +++        +    ++  
Sbjct: 230 ESTDVSTDVT-SSNFQKLILASMLSKMVASTVTYPHEILRTRMQLKSDLPNTVQRHLLPL 288

Query: 255 SKRIYSRIGFGGLWNGLPVRIF-----MIGTLTSFQW 286
            K  Y + GF G ++G    +       + TL SF++
Sbjct: 289 IKITYRQEGFAGFYSGFATNLVRTVPAAVVTLVSFEY 325

 Score = 40.8 bits (94), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 43/187 (22%), Positives = 79/187 (42%), Gaps = 24/187 (12%)

Query: 125 LADILLCPWEAIKVKQQ-------TTIPPFCKNFLEGWSKITAAEGLSGLYKGITPLWCR 177
           L+ +L+CP++  K + Q       T      K F   ++ I   EG +GLYKG+ P    
Sbjct: 51  LSAMLVCPFDVAKTRLQAQGLQNMTHQSQHYKGFFGTFATIFKDEGAAGLYKGLQPTVLG 110

Query: 178 QIPYTMCKFTSFERIVEMIYAKLPRSKQEMSPSQQIGVSFVGGYLAGILCAVVSHPADVM 237
            IP  M  F+ ++   +      P S    + S  I         AG +  V ++P  V+
Sbjct: 111 YIPTLMIYFSVYDFCRKYSVDIFPHSPFLSNASSAI--------TAGAISTVATNPIWVV 162

Query: 238 VSKVNADRKQG------ESMVEASKRIYSRIGFGGLWNGL-PVRIFMIGTLTSFQWLIYD 290
            +++      G      +  ++  ++I  + G   L+ GL P  + M+    + Q+ +Y+
Sbjct: 163 KTRLMLQTGIGKYSTHYKGTIDTFRKIIQQEGAKALYAGLVPALLGMLN--VAIQFPLYE 220

Query: 291 SFKAYIG 297
           + K   G
Sbjct: 221 NLKIRFG 227

 Score = 29.3 bits (64), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 32/109 (29%), Positives = 51/109 (46%), Gaps = 20/109 (18%)

Query: 199 KLPRSKQEMSPSQQIGVSFVGGYLAGILCAVVSHPADVMVSKVNADRKQG-ESMVEASKR 257
           KL R K+   P     V+ + G L+G L A++  P DV  +++ A   QG ++M   S+ 
Sbjct: 28  KLNRLKKNADPR----VAAISGALSGALSAMLVCPFDVAKTRLQA---QGLQNMTHQSQH 80

Query: 258 ----------IYSRIGFGGLWNGL-PVRIFMIGTLTSFQWLIYDSFKAY 295
                     I+   G  GL+ GL P  +  I TL  + + +YD  + Y
Sbjct: 81  YKGFFGTFATIFKDEGAAGLYKGLQPTVLGYIPTLMIY-FSVYDFCRKY 128

>Sklu_2117.2 YDL198C, Contig c2117 3737-4633
          Length = 298

 Score = 43.9 bits (102), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 46/176 (26%), Positives = 72/176 (40%), Gaps = 20/176 (11%)

Query: 17  ACTLGGVVACGPTHSSVTPLDLVKCRLQVNPQLYRSNLDGWKTIVRSEGLSKVFTGVGAT 76
           + T G ++  G     + PLD++K + Q NP+ ++    G+  I++ EGL  ++ G G T
Sbjct: 121 SATAGSMIGIGEI--VLLPLDVLKIKRQTNPEAFKGR--GFVKILKDEGLG-LYRGWGWT 175

Query: 77  FIGYSLQGACKYGGYEYFKQTYSNLLSPETAHRHRTAVYLCASASAEFLADILLCPWEAI 136
               +      +GG  + K+    L     A   +  V     ASA     I+  P + I
Sbjct: 176 AARNAPGSFALFGGNAFAKEYILGLKDYSQATWSQNFVSSIVGASASL---IISAPLDVI 232

Query: 137 KVKQQTTIPPFCKNFLEGWSKIT------AAEGLSGLYKGITPLWCRQIPYTMCKF 186
           K + Q       KNF    S  T        EG S  +KG+TP      P  +  F
Sbjct: 233 KTRIQN------KNFENPESGFTIVKNTLKNEGFSAFFKGLTPKLLTTGPKLVFSF 282

>Kwal_55.21106
          Length = 328

 Score = 43.9 bits (102), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 61/286 (21%), Positives = 116/286 (40%), Gaps = 44/286 (15%)

Query: 22  GVVACGPTHSSVTPLDLVKCRLQ-------------VNPQL---------YRSNLDGWKT 59
           G VA    +  V PLDLVK  +Q             V PQ          Y+ +LD    
Sbjct: 10  GAVASSLANVVVYPLDLVKTLIQTQNKEPNIGSEAGVKPQAKKSRVQEIRYKHSLDALIK 69

Query: 60  IVRSEGLSKVFTGVGATFIGYSLQGACKYGGYEYFKQTY--SNLLSPETAHRHRTAVYLC 117
           I +++G+  ++ G+  + I   LQ    +  Y   ++++    LL      +  T   L 
Sbjct: 70  IFKTKGVLGLYQGLWTSIIAGFLQSFSYFFWYSIVRKSFFRYKLLRGRLG-KFSTPEELL 128

Query: 118 ASASAEFLADILLCPWEAIKVKQQTTIPPFCKNFLEGWSKITAAE-GLSGLYKGITPLWC 176
               A  ++ I   P   I  +QQT+       F E   +I + +  ++G ++G      
Sbjct: 129 LGIVAAAVSQIFTSPIGVISTRQQTSTSGSKGGFREVLHQIYSEQNNITGFWRGFKVSLI 188

Query: 177 RQIPYTMCKFTSFERIVEMIY---------AKLPRSKQEMSPSQQIGVSFVGGYLAGILC 227
             +  ++  F S+E++ ++            +L  +  ++SP Q    +F+ G  + ++ 
Sbjct: 189 LTVNPSIT-FASYEKLQDIFITSKRAVDENGQLLETSGQLSPRQ----NFLLGVFSKVIS 243

Query: 228 AVVSHPADVMVSKVNADR--KQGESMVEASKRIYSRIGFGGLWNGL 271
            +++ P  ++VSK    R     +S  +    +Y + G   LW GL
Sbjct: 244 TLITQP--LIVSKAYLQRTGSNFQSFQQVLLYLYKQEGLISLWKGL 287

>AGR191W [4502] [Homologous to ScYDL198C (YHM1) - SH]
           complement(1114974..1115870) [897 bp, 298 aa]
          Length = 298

 Score = 43.9 bits (102), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 46/186 (24%), Positives = 77/186 (41%), Gaps = 20/186 (10%)

Query: 17  ACTLGGVVACGPTHSSVTPLDLVKCRLQVNPQLYRSNLDGWKTIVRSEGLSKVFTGVGAT 76
           + T G ++  G     + PLD++K + Q NP+ +R    G+  I+R EG+  ++ G G T
Sbjct: 121 SATAGSLIGIGEI--VLLPLDVLKIKRQTNPESFRGR--GFLRILRDEGMG-LYRGWGWT 175

Query: 77  FIGYSLQGACKYGGYEYFKQTYSNLLSPETAHRHRTAVYLCASASAEFLADILLCPWEAI 136
               +      +GG  + K+    L     A   +  V     ASA     I+  P + I
Sbjct: 176 AARNAPGSFALFGGNAFAKEYILGLKDYSQATWGQNFVSSIFGASASL---IVSAPLDVI 232

Query: 137 KVKQQTTIPPFCKNFLEGWSKIT------AAEGLSGLYKGITPLWCRQIPYTMCKFTSFE 190
           K + Q+      +NF    S  T        EG +  +KG+TP      P  +  F   +
Sbjct: 233 KTRIQS------RNFESAESGFTIVKNTLKNEGATAFFKGLTPKLLTTGPKLVFSFAIAQ 286

Query: 191 RIVEMI 196
            ++ M 
Sbjct: 287 TLIPMF 292

>Scas_696.9
          Length = 312

 Score = 43.5 bits (101), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 36/133 (27%), Positives = 62/133 (46%), Gaps = 12/133 (9%)

Query: 158 ITAAEGLSGLYKGITPLWCRQIPYTMCKFTSFERIVEMIYAKL---PRSKQEMSPSQQIG 214
           I A EGL G+YKG+  +  RQ+     +F  F R+VE    K     + +  ++  ++IG
Sbjct: 160 IYAKEGLRGIYKGVNAVAIRQMTNWGSRF-GFSRLVEDWVRKATGKTKPEDRLNAWEKIG 218

Query: 215 VSFVGGYLAGILCAVVSHPADVMVSKVNADRKQGESMVEASKRIYSRIGFGGLWNGLPVR 274
            + VGG L+     +     ++   K + +R +  ++ +  K I    G  GL+ G+  R
Sbjct: 219 ATAVGGGLSAWNQPIEVIRVEMQSKKEDPNRPKNLTVAKTFKYIMKTNGVKGLYRGVTPR 278

Query: 275 I--------FMIG 279
           I        FM+G
Sbjct: 279 IGLGIWQTVFMVG 291

>CAGL0C02013g complement(209930..210919) weakly similar to sp|P38152
           Saccharomyces cerevisiae YBR291c CTP1, hypothetical
           start
          Length = 329

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 37/154 (24%), Positives = 65/154 (42%), Gaps = 17/154 (11%)

Query: 150 NFLEGWSKITAAEGLSGLYKGITPLWCRQIPYTMCKFTSFERIVEMIYAKLPRSKQEMSP 209
           N L   +++    GL   +KG  P   RQ+  ++ +FT+F  +            ++ +P
Sbjct: 180 NVLTTAAELYRQHGLRAYFKGTMPTLMRQVGNSVVRFTTFTML------------KQFAP 227

Query: 210 SQQIGVSFVGGYLAGI-LCAVV--SHPADVMVSKVNADRK--QGESMVEASKRIYSRIGF 264
            +     +    L  I  CAVV  + P DV+ +++ A        + +  + RI+   GF
Sbjct: 228 KEYQNNEYFATLLGLISSCAVVGATQPLDVIKTRMQAKDSVLLYRNSINCAYRIFVEEGF 287

Query: 265 GGLWNGLPVRIFMIGTLTSFQWLIYDSFKAYIGL 298
             LW G   R+  +G   S  + IY   +  I L
Sbjct: 288 AMLWKGWLPRLMKVGLSGSVSFGIYQYTENMIAL 321

 Score = 39.3 bits (90), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 24/83 (28%), Positives = 43/83 (51%), Gaps = 4/83 (4%)

Query: 13  EYYAACTLGGVVACGPTHSSVTPLDLVKCRLQVNPQ--LYRSNLDGWKTIVRSEGLSKVF 70
           EY+A  TL G+++      +  PLD++K R+Q      LYR++++    I   EG + ++
Sbjct: 234 EYFA--TLLGLISSCAVVGATQPLDVIKTRMQAKDSVLLYRNSINCAYRIFVEEGFAMLW 291

Query: 71  TGVGATFIGYSLQGACKYGGYEY 93
            G     +   L G+  +G Y+Y
Sbjct: 292 KGWLPRLMKVGLSGSVSFGIYQY 314

>AFR542W [3734] [Homologous to ScYMR241W (YHM2) - SH]
           complement(1408478..1409410) [933 bp, 310 aa]
          Length = 310

 Score = 43.1 bits (100), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 41/143 (28%), Positives = 71/143 (49%), Gaps = 21/143 (14%)

Query: 152 LEGWSKITAAEGLSGLYKGITPLWCRQIPYTMCKFTSFERIVEMIYAKL--PRSKQEMSP 209
           L+ + +I AAEGL G+ KG+  +  RQ+     +F    R+VE    ++   RS +++S 
Sbjct: 154 LQVFKQIFAAEGLRGINKGVNAVAIRQMTNWGSRF-GLSRLVEDGIRRVTHKRSDEKLSA 212

Query: 210 SQQIGVSFVGGYLAGILCAVVSHPADV----MVSKVNA-DRKQGESMVEASKRIYSRIGF 264
            ++I  S +GG L     +  + P +V    M S+ N  +R +  ++ +  + IY   G 
Sbjct: 213 MEKIVASALGGGL-----SAWNQPIEVIRVEMQSRTNDPNRPKNLTVGKTFRYIYENNGL 267

Query: 265 GGLWNGLPVR--------IFMIG 279
            GL+ G+  R        IFM+G
Sbjct: 268 RGLYRGVTPRIGLGVWQTIFMVG 290

 Score = 35.0 bits (79), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 35/126 (27%), Positives = 52/126 (41%), Gaps = 5/126 (3%)

Query: 52  SNLDGWKTIVRSEGLSKVFTGVGATFIGYSLQGACKYGGYEYFKQTYSNLLSPETAHRHR 111
           S+L  +K I  +EGL  +  GV A  I        ++G     +     +    +  +  
Sbjct: 152 SSLQVFKQIFAAEGLRGINKGVNAVAIRQMTNWGSRFGLSRLVEDGIRRVTHKRSDEKLS 211

Query: 112 TAVYLCASASAEFLADILLCPWEAIKVKQQ--TTIPPFCKNFLEG--WSKITAAEGLSGL 167
               + ASA    L+     P E I+V+ Q  T  P   KN   G  +  I    GL GL
Sbjct: 212 AMEKIVASALGGGLS-AWNQPIEVIRVEMQSRTNDPNRPKNLTVGKTFRYIYENNGLRGL 270

Query: 168 YKGITP 173
           Y+G+TP
Sbjct: 271 YRGVTP 276

>KLLA0D14036g complement(1203522..1204817) some similarities with
           sp|P40556 Saccharomyces cerevisiae YIL006w, hypothetical
           start
          Length = 431

 Score = 43.1 bits (100), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 62/315 (19%), Positives = 122/315 (38%), Gaps = 46/315 (14%)

Query: 20  LGGVVACGPTHSSVTPLDLVKCRLQVNP-QL------------------YRSNLDG-WKT 59
           L GV+ C        PLD+ K RLQ    QL                  Y S + G   T
Sbjct: 116 LAGVIVC--------PLDVAKTRLQAQGLQLNGPVTRPVGSVATTFGGKYYSGIWGTLTT 167

Query: 60  IVRSEGLSKVFTGVGATFIGYSLQGACKYGGYEYFKQTYSNLLSPETAHRHRTAVYLCAS 119
           IVR E +  ++ G+    +GY       +  YE  K +Y    +      H  +  L A 
Sbjct: 168 IVRDESIRGLYKGIVPIVLGYFPTWMIYFSVYERCKLSYPRYFNNSEFLSHSMSA-LTAG 226

Query: 120 ASAEFLADILLCPWEAIKVKQQTTIPPFC--KNFLEGWSKITAAEGLSGLYKGITPLWCR 177
           A +  L + +      + ++    I      KN L+ + KI   EG+   Y G+ P    
Sbjct: 227 AISTTLTNPIWVVKTRLMLQSGKNIKGMTHYKNTLDAFIKIYKVEGIKSFYSGLIPSLF- 285

Query: 178 QIPYTMCKFTSFERIVEMIYA-KLPRSKQEM-------------SPSQQIGVSFVGGYLA 223
            + +    F  +E++ ++++     R  QE              S + Q+G   V    +
Sbjct: 286 GLLHVAIHFPVYEKLKKVLHCYPSGRPNQETMNVNGNSNPQTTGSTNFQLGRLIVASCGS 345

Query: 224 GILCAVVSHPADVMVSKVNADRKQGESMVEASKRIYSRIGFGGLWNGLPVRIFMIGTLTS 283
            ++ + +++P +++ +++        S+    +  Y++ G  G ++G    +F     ++
Sbjct: 346 KMIASTLTYPHEILRTRLQLKSDMKPSIKSIIRTTYAKEGIRGFYSGFLTNMFRTVPASA 405

Query: 284 FQWLIYDSFKAYIGL 298
              + ++ F+ +  L
Sbjct: 406 ITLVSFEYFRKHFKL 420

 Score = 42.4 bits (98), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 43/198 (21%), Positives = 82/198 (41%), Gaps = 34/198 (17%)

Query: 105 ETAHRHRTAVYLCASASAEFLADILLCPWEAIKVKQQ---------------TTIPPFCK 149
           E  H + T +   + A A FLA +++CP +  K + Q               +    F  
Sbjct: 96  EEGHFNDTEITALSGALAGFLAGVIVCPLDVAKTRLQAQGLQLNGPVTRPVGSVATTFGG 155

Query: 150 NFLEG-WSKITA---AEGLSGLYKGITPLWCRQIPYTMCKFTSFERIVEMIYAKLPRSKQ 205
            +  G W  +T     E + GLYKGI P+     P  M  F+ +ER  ++ Y +   + +
Sbjct: 156 KYYSGIWGTLTTIVRDESIRGLYKGIVPIVLGYFPTWMIYFSVYER-CKLSYPRYFNNSE 214

Query: 206 EMSPSQQIGVSFVGGYLAGILCAVVSHPADVMVSKVNADRKQG-------ESMVEASKRI 258
            +S S       +    AG +   +++P  V+ +++     +        ++ ++A  +I
Sbjct: 215 FLSHS-------MSALTAGAISTTLTNPIWVVKTRLMLQSGKNIKGMTHYKNTLDAFIKI 267

Query: 259 YSRIGFGGLWNGLPVRIF 276
           Y   G    ++GL   +F
Sbjct: 268 YKVEGIKSFYSGLIPSLF 285

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 42/207 (20%), Positives = 83/207 (40%), Gaps = 30/207 (14%)

Query: 10  FSPEYYAACTLGGVVACGPTHSSVTPLDLVKCRLQVNP-------QLYRSNLDGWKTIVR 62
           F+   + + ++  + A   + +   P+ +VK RL +           Y++ LD +  I +
Sbjct: 210 FNNSEFLSHSMSALTAGAISTTLTNPIWVVKTRLMLQSGKNIKGMTHYKNTLDAFIKIYK 269

Query: 63  SEGLSKVFTGVGATFIGYSLQGACKYGGYEYFKQ---------------TYSNLLSPET- 106
            EG+   ++G+  +  G  L  A  +  YE  K+                 +   +P+T 
Sbjct: 270 VEGIKSFYSGLIPSLFGL-LHVAIHFPVYEKLKKVLHCYPSGRPNQETMNVNGNSNPQTT 328

Query: 107 -AHRHRTAVYLCASASAEFLADILLCPWEAIKVKQQ--TTIPPFCKNFLEGWSKITAAEG 163
            +   +    + AS  ++ +A  L  P E ++ + Q  + + P  K+ +       A EG
Sbjct: 329 GSTNFQLGRLIVASCGSKMIASTLTYPHEILRTRLQLKSDMKPSIKSIIR---TTYAKEG 385

Query: 164 LSGLYKGITPLWCRQIPYTMCKFTSFE 190
           + G Y G      R +P +     SFE
Sbjct: 386 IRGFYSGFLTNMFRTVPASAITLVSFE 412

>KLLA0E02750g 260854..261768 similar to ca|CA6127|IPF149 Candida
           albicans peroxisomal membrane protein (by homology),
           start by similarity
          Length = 304

 Score = 42.4 bits (98), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 62/279 (22%), Positives = 112/279 (40%), Gaps = 21/279 (7%)

Query: 1   MSTKQPIPLFSPEYYAACTLGGVVACGPTHSSVTPLDLVKCRLQVNPQLYRSNLDGWKTI 60
           MS   P  +    +  A +LGG  +   T+    PL  +   LQ      R  L+  K I
Sbjct: 1   MSEINPNDVDELAHAIAGSLGGAASIAVTY----PLVTITTNLQTKENEARPKLETIKEI 56

Query: 61  VRSEGLSKVFTGVGATFIGYSLQGACKYGGYEYFKQTYSNLLSPETAHRHRTAVYLCASA 120
               G+   F G+ +   G +      Y  YE+  +T   L    T     T   + AS 
Sbjct: 57  YNKNGIIGYFLGLESAVYGMATTNFVYYYFYEWCAKTARTL---TTKQYLSTWESILAST 113

Query: 121 SAEFLADILLCP-WEAIKVKQQTTIPPFCKNFLEGWSKITAAEGLSGLYKGITPLWCRQI 179
            A  +  +   P W A     + T+     + L     I   +G   L  G+ P     +
Sbjct: 114 IAGSMTAVASNPIWVA---NTRMTVAKSNHSTLRTVIDIVKTDGPLTLLNGLKPALVL-V 169

Query: 180 PYTMCKFTSFERIVEMIYAKLPRSKQEMSPSQQIGVSFVGGYLAGILCAVVSHPADVMVS 239
              + ++T +E++  ++  +L R K+ +SPS     +F+ G +  +     ++P   + +
Sbjct: 170 SNPIIQYTVYEQLKNLVL-RLQR-KKVLSPSW----AFLLGAIGKLAATGTTYPYITLKT 223

Query: 240 KVN---ADRKQGESMVEASKRIYSRIGFGGLWNGLPVRI 275
           +++    D K  +SM      I  + G  GL+NG+ V++
Sbjct: 224 RMHLMQNDPKHQKSMWSLIVEIVKKDGVSGLYNGVAVKL 262

>Sklu_2398.4 , Contig c2398 9476-10405
          Length = 309

 Score = 42.4 bits (98), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 49/235 (20%), Positives = 101/235 (42%), Gaps = 14/235 (5%)

Query: 35  PLDLVKCRLQVNPQLYRSNLDGWKTIVRSEGLSKVFTGVGATFIGYSLQGACKYGGYEYF 94
           P D+ K R+Q +     + +D   +++++EG+   + G  A  +G     +C++G  E  
Sbjct: 43  PFDITKVRMQTSAG-SATAVDVVTSLIKNEGILGFYKGTLAPLVGVGACVSCQFGVNEAM 101

Query: 95  KQTYSNLLSPETAHRHRTAVYLCASASAEFLADILLCPWEAIKVKQQTTIPPFCKNFLEG 154
           K+ +  +    +        Y+C  AS    A  L  P E ++++ Q           +G
Sbjct: 102 KRRFRRMNGDPSKPLSLKQYYVCGVASGCANA-FLATPIEHVRIRLQLQTKSLANAEYQG 160

Query: 155 WSKITAAEGLSG-LYKGITPLWCRQIPYTMCKFTSFERIVEMIYAK-LPRSKQEMSPSQQ 212
                      G L +G T    R        F+++E ++   + K +PR  ++++P + 
Sbjct: 161 SLDCMRKLLKQGALMRGFTATLMRTCHGFGIYFSTYEALIANQHKKGIPR--KDIAPWKV 218

Query: 213 IGVSFVGGYLAGILCAVVSHPADVMVSKVNADR----KQGESMVEASKRIYSRIG 263
                + G  +G     +++P DV+ S + +DR      G ++ + +K IY+  G
Sbjct: 219 C----IFGAFSGACYWAMAYPIDVVKSIMQSDRLVSPVHGTNVWQVAKSIYTTRG 269

 Score = 31.6 bits (70), Expect = 0.81,   Method: Compositional matrix adjust.
 Identities = 45/208 (21%), Positives = 80/208 (38%), Gaps = 39/208 (18%)

Query: 8   PLFSPEYYAACTLGGVVACGPTHSSVTPLDLVKCRLQVNPQL-----YRSNLDGWKTIVR 62
           PL   +YY      GV +        TP++ V+ RLQ+  +      Y+ +LD  + +++
Sbjct: 115 PLSLKQYYVC----GVASGCANAFLATPIEHVRIRLQLQTKSLANAEYQGSLDCMRKLLK 170

Query: 63  SEGLSKVFTGVGATFIGYSLQGACKYGGYEYFKQTYSNLLSPETAHRHRTAV-------- 114
              L + FT         +L   C   G+  +  TY  L+    A++H+  +        
Sbjct: 171 QGALMRGFTA--------TLMRTCH--GFGIYFSTYEALI----ANQHKKGIPRKDIAPW 216

Query: 115 YLC---ASASAEFLADILLCPWEAIKVKQQT---TIPPFCKNFLEGWSKITAAEGLSGLY 168
            +C   A + A + A  +  P + +K   Q+     P    N  +    I    G     
Sbjct: 217 KVCIFGAFSGACYWA--MAYPIDVVKSIMQSDRLVSPVHGTNVWQVAKSIYTTRGKRAFI 274

Query: 169 KGITPLWCRQIPYTMCKFTSFERIVEMI 196
           KG  P   R +P     F +FE  + ++
Sbjct: 275 KGFMPAMLRSLPVNGATFATFEMTMRLL 302

>Scas_687.15*
          Length = 328

 Score = 42.4 bits (98), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 32/134 (23%), Positives = 58/134 (43%), Gaps = 15/134 (11%)

Query: 150 NFLEGWSKITAAEGLSGLYKGITPLWCRQIPYTMCKFTSFERIVEMIYAKLPRSKQEMSP 209
           N      +I    GL G  +G  P   RQ+  +  +FT++  +           KQ +SP
Sbjct: 179 NIFSVVKEIYLTRGLRGFAQGAMPTVFRQVSNSTVRFTAYTTL-----------KQLISP 227

Query: 210 SQQIGVSFVGGYLAGILCAVV--SHPADVMVSKVNADRKQ--GESMVEASKRIYSRIGFG 265
           +Q +   +  G      CAVV  + P DV+ +++ +       ++ +  + R++   G  
Sbjct: 228 TQPLNEVYAFGIGLFSSCAVVALTQPIDVVKTRMQSKTAHYFYKNSLNCAYRVFVEEGMV 287

Query: 266 GLWNGLPVRIFMIG 279
            LW G   R+F +G
Sbjct: 288 SLWKGWLPRLFKVG 301

 Score = 28.9 bits (63), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 17/69 (24%), Positives = 31/69 (44%), Gaps = 2/69 (2%)

Query: 35  PLDLVKCRLQVNPQ--LYRSNLDGWKTIVRSEGLSKVFTGVGATFIGYSLQGACKYGGYE 92
           P+D+VK R+Q       Y+++L+    +   EG+  ++ G         L G   +G Y+
Sbjct: 253 PIDVVKTRMQSKTAHYFYKNSLNCAYRVFVEEGMVSLWKGWLPRLFKVGLSGGISFGVYQ 312

Query: 93  YFKQTYSNL 101
           Y +     L
Sbjct: 313 YVENLSHTL 321

>AGL064W [4247] [Homologous to ScYBR291C (CTP1) - SH]
           complement(587623..588513) [891 bp, 296 aa]
          Length = 296

 Score = 42.0 bits (97), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 57/255 (22%), Positives = 108/255 (42%), Gaps = 24/255 (9%)

Query: 35  PLDLVKCRLQVNPQ---LYRSNLDGWKTIVRSEGLSKVFTGVGATFIGYSLQGACKYGGY 91
           P +  K RLQ+  Q     R+ L       R++G   ++ G  A  +G + +   ++ G+
Sbjct: 30  PFEFAKTRLQLAQQGSGESRNPLVLLYRTARTQGAGALYVGCPAFVVGNTCKAGVRFLGF 89

Query: 92  EYFKQTYSNLLSPETAHRHRTAVYLCASASAEFLADIL-LCPWEAIKV----KQQTTIPP 146
           +  ++   +     +  R      + A   A  L  +L + P+EA+K      +Q   P 
Sbjct: 90  DALRRALQDERGALSGPRG-----MLAGLGAGLLESVLAVTPFEAVKTALIDDRQAARPR 144

Query: 147 FCKN---FLEGWSKITAAEGLSGLYKGITPLWCRQIPYTMCKFTSFERIVEMI--YAKLP 201
           +  N       ++ +    GL GLY G+ P+  RQ      +F  + ++ + +  YA  P
Sbjct: 145 YQHNGRGAARNYALLLRELGLRGLYGGLVPVALRQASNQAVRFGCYTQLKQAVQRYAGTP 204

Query: 202 RSKQEMSPSQQIGVSFVGGYLAGILCAVVSHPADVMVSKVNA-DRKQGESMVEASKRIYS 260
            + Q +   Q    +F+ G L+GI+    + P D + +++ A D  +  S V   + +  
Sbjct: 205 -ADQPLGSGQ----TFLVGALSGIVTVYATMPVDTVKTRMQALDAARYGSTVGCFRAVVR 259

Query: 261 RIGFGGLWNGLPVRI 275
             G   LW G   R+
Sbjct: 260 EEGVRALWRGATPRL 274

>ADR036C [1777] [Homologous to ScYPR128C (ANT1) - SH]
           (771097..772119) [1023 bp, 340 aa]
          Length = 340

 Score = 42.0 bits (97), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 49/232 (21%), Positives = 98/232 (42%), Gaps = 17/232 (7%)

Query: 50  YRSNLDGWKTIVRSEGLSKVFTGVGATFIGYSLQGACKYGGYEYFKQTYSNLLSPETAH- 108
           Y+  LD  + I  +EG++ ++ G+G++ +   +Q    +  Y   ++ Y  L        
Sbjct: 72  YKGALDALQRIYGAEGVAGLYRGLGSSTVAGFIQSFSYFFWYTLVRKHYFRLKQARGGDA 131

Query: 109 RHRTAVYLCASASAEFLADILLCPWEAIKVKQQTTIPPFCKNFLEGWSKITAAE-GLSGL 167
           R  T   L     A   + + + P   +  +QQT         +   ++   AE G  G 
Sbjct: 132 RFSTPEELVLGIVAAATSQLFVNPINVVATRQQTRGQAAGAADMRTVAREVHAENGWRGF 191

Query: 168 YKGITPLWCRQIPYTMCKFTSFERIVEMIY------AKLPRSKQEMSPSQQIGVSFVGGY 221
           + G+       +  ++  + ++ER+ E ++      + L  S   +SP Q    +FV G 
Sbjct: 192 WAGLKVSLVLTVNPSIT-YATYERLREALFPTPAAASHLVDSAALLSPGQ----NFVMGV 246

Query: 222 LAGILCAVVSHPADVMVSKVNADRKQG--ESMVEASKRIYSRIGFGGLWNGL 271
           L+ I+  V++ P  ++++K +  R     +   +    +YS  G   LW GL
Sbjct: 247 LSKIVSTVLTQP--LIIAKASLQRSGSCFQDFHQVLHHLYSTEGPLSLWKGL 296

>AGL047C [4264] [Homologous to ScYPR011C - NSH] (616853..617803)
           [951 bp, 316 aa]
          Length = 316

 Score = 41.6 bits (96), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 60/301 (19%), Positives = 113/301 (37%), Gaps = 38/301 (12%)

Query: 15  YAACTLGGVVACGPTHSSVTPLDLVKCRLQVNPQLYRSN---LDGWKTIVRSEGLSKVFT 71
           + A  +GG V    + + V+P++ VK  LQV       N   +   K + + EG+  +F 
Sbjct: 20  FVAGGVGGAV----SRTVVSPVERVKILLQVQSSTTAYNGGLVHAVKQVYKEEGVKGLFR 75

Query: 72  GVGATFIGYSLQGACKYGGYEYFKQTYSNLLSPETAHRH-RTAVYLCASASAEFLADILL 130
           G G   +      A +Y  YE+ K    ++   ++ H   R+   L   A     + ++ 
Sbjct: 76  GNGINCLRIFPYSAVQYAVYEFCKTRVFHV--GQSGHEQLRSWERLVGGALGGGASVLVT 133

Query: 131 CPWEAIKVKQQTTIPPFCK-------------NFLEGWSKITAAE-GLSGLYKGITPLWC 176
            P + ++ +         K               +E   +I   E GL G Y+G+ P   
Sbjct: 134 YPLDLVRTRLSIQTANLAKLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTSL 193

Query: 177 RQIPYTMCKFTSFERIVEMIYAKLPRSKQEMSPSQQIGVSFVGGYLAGILCAVVSHPADV 236
             +P+    F  +ER+  +I         +             G ++G +   V +P D+
Sbjct: 194 GVVPFVALNFALYERLKALI-------PHDYDAGSVAAAKLAIGAVSGGIAQTVVYPFDL 246

Query: 237 MVSKVNA-DRKQGE------SMVEASKRIYSRIGFGGLWNGLPVRIFMIGTLTSFQWLIY 289
           +  +       Q E      S+ +A   I  + G  G + GL   +  +    + QW +Y
Sbjct: 247 LRRRFQVLTMGQSELGFRYASVADALWTIGRQEGLRGYYKGLTANLVKVVPAMAVQWFVY 306

Query: 290 D 290
           +
Sbjct: 307 E 307

 Score = 34.7 bits (78), Expect = 0.072,   Method: Compositional matrix adjust.
 Identities = 43/184 (23%), Positives = 76/184 (41%), Gaps = 25/184 (13%)

Query: 35  PLDLVKCRLQVN----PQLYRSN----------LDGWKTIVRSEG-LSKVFTGVGATFIG 79
           PLDLV+ RL +      +L+RS           ++  + I R EG L   + GV  T +G
Sbjct: 135 PLDLVRTRLSIQTANLAKLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTSLG 194

Query: 80  YSLQGACKYGGYEYFKQTYSNLLSPETAHRHRTAVYLCASASAEFLADILLCPWEAIKVK 139
                A  +  YE  K     L+  +       A  L   A +  +A  ++ P++ ++ +
Sbjct: 195 VVPFVALNFALYERLKA----LIPHDYDAGSVAAAKLAIGAVSGGIAQTVVYPFDLLRRR 250

Query: 140 ------QQTTIPPFCKNFLEGWSKITAAEGLSGLYKGITPLWCRQIPYTMCKFTSFERIV 193
                  Q+ +     +  +    I   EGL G YKG+T    + +P    ++  +E I 
Sbjct: 251 FQVLTMGQSELGFRYASVADALWTIGRQEGLRGYYKGLTANLVKVVPAMAVQWFVYELIS 310

Query: 194 EMIY 197
           E ++
Sbjct: 311 ENMH 314

 Score = 32.3 bits (72), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 29/94 (30%), Positives = 40/94 (42%), Gaps = 8/94 (8%)

Query: 16  AACTLG-GVVACGPTHSSVTPLDLVKCRLQV----NPQL---YRSNLDGWKTIVRSEGLS 67
           AA  L  G V+ G   + V P DL++ R QV      +L   Y S  D   TI R EGL 
Sbjct: 223 AAAKLAIGAVSGGIAQTVVYPFDLLRRRFQVLTMGQSELGFRYASVADALWTIGRQEGLR 282

Query: 68  KVFTGVGATFIGYSLQGACKYGGYEYFKQTYSNL 101
             + G+ A  +      A ++  YE   +    L
Sbjct: 283 GYYKGLTANLVKVVPAMAVQWFVYELISENMHGL 316

 Score = 28.1 bits (61), Expect = 9.1,   Method: Compositional matrix adjust.
 Identities = 17/79 (21%), Positives = 37/79 (46%), Gaps = 3/79 (3%)

Query: 215 VSFVGGYLAGILCAVVSHPAD---VMVSKVNADRKQGESMVEASKRIYSRIGFGGLWNGL 271
           ++FV G + G +   V  P +   +++   ++       +V A K++Y   G  GL+ G 
Sbjct: 18  IAFVAGGVGGAVSRTVVSPVERVKILLQVQSSTTAYNGGLVHAVKQVYKEEGVKGLFRGN 77

Query: 272 PVRIFMIGTLTSFQWLIYD 290
            +    I   ++ Q+ +Y+
Sbjct: 78  GINCLRIFPYSAVQYAVYE 96

>Sklu_2433.8 YFR045W, Contig c2433 11995-13257 reverse complement
          Length = 420

 Score = 42.0 bits (97), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 29/133 (21%), Positives = 58/133 (43%), Gaps = 15/133 (11%)

Query: 151 FLEGWSKITAAEGLSGLYKGITPLWCRQIPYTMCKFTSFERIVEMIYAKLPRSKQEMSPS 210
           F     +I    GL G  +G  P   RQ+  +  +FT++  +           KQ +SP+
Sbjct: 270 FFSTVKEIYLTRGLRGFVQGTAPTIFRQMGNSAVRFTTYTSL-----------KQLISPN 318

Query: 211 QQIG--VSFVGGYLAGILCAVVSHPADVMVSKVNADRKQG--ESMVEASKRIYSRIGFGG 266
           + +    +FV G+++      V+ P DV+ +++ +       ++ +  + RI+   G   
Sbjct: 319 KPLNEYYAFVLGFISSCAVVAVTQPIDVIKTRMQSKYAWANYKNSLNCAYRIFVEEGIPK 378

Query: 267 LWNGLPVRIFMIG 279
            W G   R+  +G
Sbjct: 379 FWKGWAPRLMKVG 391

 Score = 35.4 bits (80), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 29/96 (30%), Positives = 45/96 (46%), Gaps = 6/96 (6%)

Query: 2   STKQPIPLFSP--EYYAACTLGGVVACGPTHSSVTPLDLVKCRLQVNPQL--YRSNLDGW 57
           S KQ I    P  EYYA   LG + +C    +   P+D++K R+Q       Y+++L+  
Sbjct: 310 SLKQLISPNKPLNEYYA-FVLGFISSCAVV-AVTQPIDVIKTRMQSKYAWANYKNSLNCA 367

Query: 58  KTIVRSEGLSKVFTGVGATFIGYSLQGACKYGGYEY 93
             I   EG+ K + G     +   L G   +G Y+Y
Sbjct: 368 YRIFVEEGIPKFWKGWAPRLMKVGLSGGVSFGVYQY 403

>YMR241W (YHM2) [4197] chr13 (751960..752904) Suppressor of abf1
           mutant that affects mitochondrial HMG-like DNA-binding
           protein, member of the mitochondrial carrier family
           (MCF) of membrane transporters [945 bp, 314 aa]
          Length = 314

 Score = 41.6 bits (96), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 36/139 (25%), Positives = 63/139 (45%), Gaps = 15/139 (10%)

Query: 155 WS---KITAAEGLSGLYKGITPLWCRQIPYTMCKFTSFERIVEMIYAKLP---RSKQEMS 208
           WS    I   EG+ G+ KG+  +  RQ+     +F    R+VE    K+        +++
Sbjct: 156 WSVFKNIYKKEGIRGINKGVNAVAIRQMTNWGSRF-GLSRLVEDGIRKITGKTNKDDKLN 214

Query: 209 PSQQIGVSFVGGYLAGILCAVVSHPADVMVSKVNADRKQGESMVEASKRIYSRIGFGGLW 268
           P ++IG S +GG L+     +     ++   K + +R +  ++ +  K IY   G  GL+
Sbjct: 215 PFEKIGASALGGGLSAWNQPIEVIRVEMQSKKEDPNRPKNLTVGKTFKYIYQSNGLKGLY 274

Query: 269 NGLPVRI--------FMIG 279
            G+  RI        FM+G
Sbjct: 275 RGVTPRIGLGIWQTVFMVG 293

>KLLA0E09680g complement(860245..861168) similar to ca|CA5146|CaYMC2
           Candida albicans Carnitine/acylcarnitine translocase (by
           homology), start by similarity
          Length = 307

 Score = 41.6 bits (96), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 44/191 (23%), Positives = 76/191 (39%), Gaps = 13/191 (6%)

Query: 16  AACTLGGVVACGPTHSSVTPLDLVKCRLQVN----PQLYRSNLDGWKTIVRSEGLSKVFT 71
           + C + GV+A         P++L K +LQV        Y+  LD  K I  ++G+  ++ 
Sbjct: 122 SGCIISGVLAGWSVSFIAPPIELAKAKLQVQYDKTTTRYKGPLDVIKKIYSAQGIRGLYK 181

Query: 72  GVGATFIGYSLQGACKYGGYEYFKQTYSNLLSPETAHRHRTAVYLCASA-SAEFLADILL 130
           G+ +T I +       +G YE   + +      E       A+   A   SA F      
Sbjct: 182 GLISTLI-FRTHFVYWWGSYELLTRWFR-----ENTKMSEAAINFWAGGFSASFGFWTTA 235

Query: 131 CPWEAIK--VKQQTTIPPFCKNFLEGWSKITAAEGLSGLYKGITPLWCRQIPYTMCKFTS 188
            P + +K  V          K++      I  ++G++G +KG  P + R  P       +
Sbjct: 236 YPSDVVKQVVLCNDKYDGSFKSWRTAVKDIYQSKGINGFFKGFVPSFLRSFPANAAALAA 295

Query: 189 FERIVEMIYAK 199
           FE ++    AK
Sbjct: 296 FEFVLRTSGAK 306

 Score = 30.4 bits (67), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 41/178 (23%), Positives = 76/178 (42%), Gaps = 12/178 (6%)

Query: 99  SNLLSPETAHRHRTAVYLCASASAEFLADILLCPWEAIKVKQQTT-IPPFCKNFLEGWSK 157
           ++L+S ET  R    V    S  A+   + +  P++ IKV+ QT+      K  L+   K
Sbjct: 13  NSLISNETYSRIMGFVAGVFSGVAK---NAVGHPFDTIKVRLQTSQNETRFKGPLDCVYK 69

Query: 158 ITAAEGLSGLYKGITPLWCRQIPYTMCKFTSFERIVEMIYAKLPRSKQEMSPSQQIGVSF 217
               +G+ G Y G TP     I               +++  +  + +++  S  I    
Sbjct: 70  TFRNQGIRGFYLGFTPPLVGWILMDSVMLGCLHNYRMLMHKYVYPNDEKLPLSGCI---- 125

Query: 218 VGGYLAGILCAVVSHPADVMVSKVNADRKQGESM----VEASKRIYSRIGFGGLWNGL 271
           + G LAG   + ++ P ++  +K+     +  +     ++  K+IYS  G  GL+ GL
Sbjct: 126 ISGVLAGWSVSFIAPPIELAKAKLQVQYDKTTTRYKGPLDVIKKIYSAQGIRGLYKGL 183

>AFR253W [3445] [Homologous to ScYFR045W - SH]
           complement(892939..892986,893047..894033) [1035 bp, 344
           aa]
          Length = 344

 Score = 41.6 bits (96), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 29/126 (23%), Positives = 57/126 (45%), Gaps = 15/126 (11%)

Query: 157 KITAAEGLSGLYKGITPLWCRQIPYTMCKFTSFERIVEMIYAKLPRSKQEMSPSQQIG-- 214
           +I    G+ G  +G  P   RQ+  ++ +FT++  IV           Q +SP + +   
Sbjct: 201 EIYRTRGVRGFLQGAMPTIFRQLGNSVVRFTTYAWIV-----------QSLSPHKALDEY 249

Query: 215 VSFVGGYLAGILCAVVSHPADVMVSKVNADRK--QGESMVEASKRIYSRIGFGGLWNGLP 272
            +F  G L+      ++ P DV+ +++ +       +S +  + RI+   GF  +W G  
Sbjct: 250 QAFAAGALSSAAVVALTQPIDVIKTRMQSKTAWFTYKSSLNCAYRIFVEEGFRYMWKGWV 309

Query: 273 VRIFMI 278
            R+F +
Sbjct: 310 PRLFKV 315

 Score = 31.2 bits (69), Expect = 0.88,   Method: Compositional matrix adjust.
 Identities = 19/78 (24%), Positives = 34/78 (43%), Gaps = 2/78 (2%)

Query: 21  GGVVACGPTHSSVTPLDLVKCRLQVNPQ--LYRSNLDGWKTIVRSEGLSKVFTGVGATFI 78
            G ++     +   P+D++K R+Q       Y+S+L+    I   EG   ++ G      
Sbjct: 254 AGALSSAAVVALTQPIDVIKTRMQSKTAWFTYKSSLNCAYRIFVEEGFRYMWKGWVPRLF 313

Query: 79  GYSLQGACKYGGYEYFKQ 96
             SL G   +G Y+Y + 
Sbjct: 314 KVSLSGGISFGVYQYVEN 331

>Sklu_2374.7 YNL083W, Contig c2374 13874-15415 reverse complement
          Length = 513

 Score = 41.6 bits (96), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 54/254 (21%), Positives = 103/254 (40%), Gaps = 17/254 (6%)

Query: 59  TIVRSEGLSKVFTGVGATFIGYSLQGACKYGGYEYFKQTYSNLLS-PETAHRHRTAVYLC 117
           T+ R  G+   + G G   I    + A K+G +E  KQ  ++L     T+   + + Y+ 
Sbjct: 262 TLYRQGGIRAFYVGNGLNVIKVFPESAMKFGSFELAKQLMAHLEGVHHTSELSKFSTYI- 320

Query: 118 ASASAEFLADILLCPWEAIKVKQQ----TTIPPFCKNFLEGWSKITAAEGLSGLYKGITP 173
           A      +A   + P + +K + Q     T     +  +    ++    GL   Y+G+T 
Sbjct: 321 AGGMGGVVAQFSVYPIDTLKYRVQCAPLDTALKGNELLISTARQMYRDGGLKLFYRGVTV 380

Query: 174 LWCRQIPYTMCKFTSFERIVEMIYAKLPRSKQEMSPSQQIGVS-FV---GGYLAGILCAV 229
                 PY      +F  + +   A+  ++K    P  Q+ +S F+    G  +G + A 
Sbjct: 381 GVMGIFPYAALDLGTFSALKKWYIAR--QAKMTGVPVDQVTISNFIVLPMGAFSGTVGAT 438

Query: 230 VSHPADVMVSKVNADRKQGESMVEASKR-----IYSRIGFGGLWNGLPVRIFMIGTLTSF 284
           V +P +++ +++ A             R        R G+ GL+ GL   +  +    S 
Sbjct: 439 VVYPINLLRTRLQAQGTYAHPHTYTGFRDVLWKTVQREGYQGLFKGLVPNLAKVCPAVSI 498

Query: 285 QWLIYDSFKAYIGL 298
            +L Y++FK  + L
Sbjct: 499 SYLCYENFKRLMKL 512

>AAR036W [222] [Homologous to ScYGR096W - SH]
           complement(406887..407840) [954 bp, 317 aa]
          Length = 317

 Score = 40.8 bits (94), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 36/157 (22%), Positives = 65/157 (41%), Gaps = 13/157 (8%)

Query: 17  ACTLGGVVACGPTHSSVTPLDLVKCRLQV---NPQLYRSNLDGWKTIVRSEGLSKVFTGV 73
           A ++ G+VA     S   P+D VK R Q+   +   Y   L  ++T+ R EG+  ++ G 
Sbjct: 30  AGSVSGLVA----RSVTAPMDTVKIRRQLQLASEHKYHGILHTFRTVAREEGVRALWKGN 85

Query: 74  GATFIGYSLQGACKYGGYEYFKQTYSNLLSPETAHRHRTAVYLCASASAEFLADILLCPW 133
                 Y L G+ ++G Y +     ++   P  AH       L   A A  ++ +L  P 
Sbjct: 86  VPASAMYVLYGSLQFGTYAWLNTAAASAGLPPQAHS------LAVGALAGLVSSLLTYPL 139

Query: 134 EAIKVKQQTTIPPFCKNFLEGWSKITAAEGLSGLYKG 170
           + ++ +          +       I   EG +G ++G
Sbjct: 140 DLLRTRLVANRSAHFFSLRRQARVIWDTEGPAGFFRG 176

 Score = 40.0 bits (92), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 40/178 (22%), Positives = 71/178 (39%), Gaps = 24/178 (13%)

Query: 35  PLDLVKCRLQVNPQLYRSNLDGWKTIV-RSEGLSKVFTGVGATFIGYSLQGACKYGGYEY 93
           PLDL++ RL  N   +  +L     ++  +EG +  F G        +L     +G YE 
Sbjct: 138 PLDLLRTRLVANRSAHFFSLRRQARVIWDTEGPAGFFRGGAWAIAATTLTTGLIFGIYET 197

Query: 94  FKQTYSNLLSPETAHRHRTAVYLCASASAEFLADILLCPWEAIKVKQQTT----IPPFCK 149
                     P  A          AS +A  ++   + P + ++ + Q      IP F +
Sbjct: 198 CTIAADTYGLPWLA--------AAASPTAGLVSKAAVFPLDTVRRRLQIVDAKHIPFFTR 249

Query: 150 N-----------FLEGWSKITAAEGLSGLYKGITPLWCRQIPYTMCKFTSFERIVEMI 196
           +           FL     +  AEG++ LYKG+T   C+  P T+     ++R + ++
Sbjct: 250 DPGAYSALRGTRFLGLAVHMVRAEGIASLYKGLTMALCKSTPTTVITLWVYQRCLRLL 307

 Score = 36.2 bits (82), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 30/158 (18%), Positives = 70/158 (44%), Gaps = 12/158 (7%)

Query: 116 LCASASAEFLADILLCPWEAIKVKQQTTIPPFCK--NFLEGWSKITAAEGLSGLYKGITP 173
           + A + +  +A  +  P + +K+++Q  +    K    L  +  +   EG+  L+KG  P
Sbjct: 28  VVAGSVSGLVARSVTAPMDTVKIRRQLQLASEHKYHGILHTFRTVAREEGVRALWKGNVP 87

Query: 174 LWCRQIPYTMCKFTSFERIVEMIYAKLPRSKQEMSPSQQIGVSFVGGYLAGILCAVVSHP 233
                + Y   +F ++       +     +   + P      S   G LAG++ +++++P
Sbjct: 88  ASAMYVLYGSLQFGTYA------WLNTAAASAGLPPQAH---SLAVGALAGLVSSLLTYP 138

Query: 234 ADVMVSKVNADRKQG-ESMVEASKRIYSRIGFGGLWNG 270
            D++ +++ A+R     S+   ++ I+   G  G + G
Sbjct: 139 LDLLRTRLVANRSAHFFSLRRQARVIWDTEGPAGFFRG 176

>Scas_718.5
          Length = 324

 Score = 40.8 bits (94), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 52/247 (21%), Positives = 98/247 (39%), Gaps = 17/247 (6%)

Query: 35  PLDLVKCRLQVNPQLYRSNLDGWKTIVRSEGLSKVFTGVGATFIGYSLQGACKYGGYEYF 94
           P D  K R+Q + +   + LD  + +V++EG+   + G     +G     + ++G  E  
Sbjct: 59  PFDTTKVRMQTSAKSVGA-LDIIRKLVKNEGVWAFYKGSLIPIVGVGACVSVQFGVNEAM 117

Query: 95  KQTYSNL-LSPETAHRHRT----AVYLCASASAEFLADILLCPWEAIKVKQQTTIPPFCK 149
           K+ +     S  T HR  T      Y+C   +   +   L  P E ++++ QT      +
Sbjct: 118 KRFFREWNTSRGTQHRDGTLQLGQYYICG-LTGGVVNSFLASPIEHVRIRLQTQTGNGNE 176

Query: 150 NFLEG-WSKITAAEGLSGLYKGITPLWCRQIPYTMCKFTSFERIVEMIYAKLPRSKQEMS 208
              +G    I        L +G+ P+  R      C F ++E    +I  ++ + K    
Sbjct: 177 REFKGPLDCIRKLVKEKSLMRGLRPMMLRAGHGLGCYFLTYE---ALIANEIKKGKDRSE 233

Query: 209 PSQQIGVSFVGGYLAGILCAVVSHPADVMVSKVNADRKQG----ESMVEASKRIYSRIGF 264
            +     S+  G L+G++  +  +P DV+ S +  D  +      SM      +Y   G 
Sbjct: 234 IASWKLCSY--GSLSGVVLWLAIYPLDVVKSMIQTDTLRNPRFKNSMKNVINHLYREQGI 291

Query: 265 GGLWNGL 271
              + G 
Sbjct: 292 SAFFKGF 298

 Score = 37.0 bits (84), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 46/200 (23%), Positives = 83/200 (41%), Gaps = 33/200 (16%)

Query: 13  EYYAACTLGGVVACGPTHSSVTPLDLVKCRLQV-----NPQLYRSNLDGWKTIVRSEGLS 67
           +YY     GGVV         +P++ V+ RLQ      N + ++  LD  + +V+ + L 
Sbjct: 141 QYYICGLTGGVV----NSFLASPIEHVRIRLQTQTGNGNEREFKGPLDCIRKLVKEKSLM 196

Query: 68  KVFTGVGATFIGYSLQGACKYGGYEYFKQTYSNLLSPETAH-RHRTAV---YLCASASAE 123
           +   G+    +       C      YF  TY  L++ E    + R+ +    LC+  S  
Sbjct: 197 R---GLRPMMLRAGHGLGC------YF-LTYEALIANEIKKGKDRSEIASWKLCSYGS-- 244

Query: 124 FLADILL----CPWEAIKVKQQTTI---PPFCKNFLEGWSKITAAEGLSGLYKGITPLWC 176
            L+ ++L     P + +K   QT     P F  +     + +   +G+S  +KG  P   
Sbjct: 245 -LSGVVLWLAIYPLDVVKSMIQTDTLRNPRFKNSMKNVINHLYREQGISAFFKGFAPTML 303

Query: 177 RQIPYTMCKFTSFERIVEMI 196
           R  P     F +FE ++ ++
Sbjct: 304 RAAPVNGATFVTFELVMRLL 323

>YDL119C (YDL119C) [751] chr4 complement(246689..247612) Member of
           the mitochondrial carrier family (MCF) of membrane
           transporters [924 bp, 307 aa]
          Length = 307

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 16/72 (22%), Positives = 36/72 (50%)

Query: 21  GGVVACGPTHSSVTPLDLVKCRLQVNPQLYRSNLDGWKTIVRSEGLSKVFTGVGATFIGY 80
             V++     +   P D +K R+Q+ P  + ++ + + +IV++E + K+F+G+       
Sbjct: 229 SAVLSASLATTVTAPFDTIKTRMQLEPSKFTNSFNTFTSIVKNENVLKLFSGLSMRLARK 288

Query: 81  SLQGACKYGGYE 92
           +      +G YE
Sbjct: 289 AFSAGIAWGIYE 300

 Score = 29.6 bits (65), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 9/30 (30%), Positives = 18/30 (60%)

Query: 217 FVGGYLAGILCAVVSHPADVMVSKVNADRK 246
            +GG+  G+  AV   P D++ +++  D+K
Sbjct: 14  LIGGFFGGLTSAVALQPLDLLKTRIQQDKK 43

>KLLA0F04697g complement(461126..462049) similar to sp|P40464
           Saccharomyces cerevisiae YIL134w FLX1 FAD carrier
           protein (MCF), mitochondrial, start by similarity
          Length = 307

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 62/298 (20%), Positives = 118/298 (39%), Gaps = 34/298 (11%)

Query: 20  LGGVVACGPTHSSVTPLDLVKCRLQVNP----------QLYRSNLDGWKTIVRSEGLSKV 69
           + G+ A   T     PLDL+K RLQ+            Q+ R   DG  T    + L + 
Sbjct: 17  ISGLTAGTITTIVTHPLDLIKLRLQLAAIDLKPSSYYNQVQRIIKDGSGT---QQLLKEA 73

Query: 70  FTGVGATFIGYSLQGACKYGGYEYFKQ-TYSNLLSPETAHRHR--------TAVYLCASA 120
           + G+G   IG ++     +G Y   K   YS  LS E A +++        +++YL ++ 
Sbjct: 74  YRGLGINIIGNAVAWGLYFGLYRCSKDVVYS--LSSEPALQNKFMNDRKMTSSMYLVSAG 131

Query: 121 SAEFLADILLCPWEAIKVK-QQTTIPPFCKNFLEGWSKITAAEGLSGLYKGITPLWCRQI 179
           ++     +L  P   IK +   T       + L   ++I   EGL   ++G+ P      
Sbjct: 132 ASGLATALLTNPMWVIKTRIMSTKSSQGYTSILNAITRIYTEEGLKTFWRGLVPSL---- 187

Query: 180 PYTMCKFTSFERIVEMIYAKLPRSKQEMSPSQQIGVSFVGGYLAGILCAVVS-HPADVMV 238
            + + +   +  I + +  K    + ++   +   V  +G      + +V S +P  ++ 
Sbjct: 188 -FGVTQGALYFAIYDTLKLKYLHDRNDIQERRLNAVETIGIISLSKMISVSSVYPLQLLK 246

Query: 239 SKVNADR---KQGESMVEASKRIYSRIGFGGLWNGLPVRIFMIGTLTSFQWLIYDSFK 293
           + +   R    +   M    + I+   G  G + GL   +      T   + +Y+ FK
Sbjct: 247 TNLQTFRTEHNENSKMNSLIRSIWHTNGIAGFYKGLFANLVRAIPSTCITFGVYEHFK 304

>Scas_578.3*
          Length = 524

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 65/324 (20%), Positives = 126/324 (38%), Gaps = 50/324 (15%)

Query: 14  YYAACTLGGVVACGPTHSSVTPLDLVKCRL---------QVNPQLY-----------RSN 53
           Y+ A  L GV+    + +   PLD +K  L          +NP+++           RS 
Sbjct: 211 YFIAGGLSGVI----SRTCTAPLDRIKVFLIARTDLSSTLLNPKMHLRIQGLNLAKIRSP 266

Query: 54  L-DGWKTIVRSEGLSKVFTGVGATFIGYSLQGACKYGGYEYFKQTYSNLLSPETAHRHRT 112
           +    +++ R  GL   + G G +      + + K+G +E  K+  +NL   +  +    
Sbjct: 267 IIKAIRSLYRQGGLRAFYVGNGLSVFKICPESSIKFGTFELAKRLMANLSGDKLVNDLSK 326

Query: 113 AVYLCASASAEFLADILLCPWEAIKVKQQTTIPPFCKNFLEGWSKITAAE------GLSG 166
                A   A  +A I + P + +K + Q    P   N       I+ A+      G+  
Sbjct: 327 LQTYVAGGIAGVMAQISIYPIDTLKFRIQCA--PLEGNLKGNALLISTAKEMYKEGGIRV 384

Query: 167 LYKGITPLWCRQIPYTMCKFTSFERIVEMIYAKLPRSKQEMSPSQQIGVSFV----GGYL 222
            Y+G+        PY      +F  + +    +  +SK+   P + + +S++     G  
Sbjct: 385 FYRGVLLGALGIFPYAALDLGTFSALKKWYIKR--QSKKLNIPEKDVMLSYLLVLPMGAF 442

Query: 223 AGILCAVVSHPADVMVSKVNADRKQG--------ESMVEASKRIYSRIGFGGLWNGLPVR 274
           +G + A   +P +++ +++ A   QG            +   +   R G  G + GL   
Sbjct: 443 SGTVGATAVYPINLLRTRLQA---QGTYAHPYTYTGFRDVFMQTLKREGVPGFYKGLVPT 499

Query: 275 IFMIGTLTSFQWLIYDSFKAYIGL 298
           +  +    S  +L Y+ FKA + L
Sbjct: 500 LVKVCPAVSIGYLCYEKFKAAMSL 523

>Sklu_2435.2 YPR128C, Contig c2435 2489-3523 reverse complement
          Length = 344

 Score = 40.0 bits (92), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 61/300 (20%), Positives = 110/300 (36%), Gaps = 53/300 (17%)

Query: 20  LGGVVACGPTHSSVTPLDLVKC-------------RLQVNPQ------------------ 48
           L G VA    ++ V PLDLVK              +L+  PQ                  
Sbjct: 8   LSGAVASAMANTVVYPLDLVKTLVQTQLKQDEQLKQLETEPQSQDKDEPVKDIPPVPIKL 67

Query: 49  ------LYRSNLDGWKTIVRSEGLSKVFTGVGATFIGYSLQGACKYGGYEYFKQTYSNL- 101
                  Y S  D    I + EG+  ++ G+  + +    Q    +  Y + ++ Y  + 
Sbjct: 68  NENNYLQYNSTFDAIYKIYKQEGIRGLYQGLTTSVMAGFFQTFSYFFWYSFVRKCYFRVK 127

Query: 102 LSPETAHRHRTAVYLCASASAEFLADILLCPWEAIKVKQQTTIPPFCKN-FLEGWSKITA 160
           L      +  T   L     A   + I   P   I  +QQT       N FL    +I  
Sbjct: 128 LINRKNTKFTTIEELLLGIVAAATSQIFTNPISLISARQQTRQGIDGDNDFLTVAKEIYK 187

Query: 161 AE-GLSGLYKGITPLWCRQIPYTMCKFTSFERIVEMIYA--------KLPRSKQEMSPSQ 211
            +  + G +KG+       I  ++  +TS+E++ + ++         +L  S  ++SP Q
Sbjct: 188 EQRSIKGFWKGLKVSLMLTINPSIT-YTSYEKLKDALFTTDTMNLKKELVDSSSQLSPYQ 246

Query: 212 QIGVSFVGGYLAGILCAVVSHPADVMVSKVNADRKQGESMVEASKRIYSRIGFGGLWNGL 271
               +F  G L+ ++ A+++ P  +  + +  +     S  +    +Y   G    W GL
Sbjct: 247 ----NFTLGVLSKMISAIITMPLIISKAWLQRNGSNFSSFQQVLYYLYKNEGLRSWWKGL 302

>Kwal_56.23011
          Length = 303

 Score = 39.3 bits (90), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 55/241 (22%), Positives = 104/241 (43%), Gaps = 26/241 (10%)

Query: 35  PLDLVKCRLQVNPQLYRSNLDGWKTIVRSEGLSKVFTGVGATFIGYSLQGACKYGGYE-- 92
           P D+ K RLQ +P +  +     K++V++EGL   + G  A   G     +C++G  E  
Sbjct: 43  PFDITKVRLQTSP-VPTTAAQVIKSLVKNEGLLAFYKGTLAPLAGVGACVSCQFGVNEAL 101

Query: 93  --YFKQTYSNLLSPETAHRHRTAVYLCASASAEFLADILLCPWEAIKVKQQTTIPPFCKN 150
             +F++   N   P    ++    ++  +A+A FLA     P E ++++ Q  +     +
Sbjct: 102 KKWFRKKDGNFDQPLALRQYYACGFVSGTANA-FLA----TPIEHVRIRLQ--LQTASSS 154

Query: 151 FLEGWSKITAAEGL---SGLYKGITPLWCRQIPYTMCKFTSFERIV-EMIYAKLPRSKQE 206
             E    +  A  L     L +G T    R        F ++E ++    +  + R   E
Sbjct: 155 AAEYHGSLDCARKLLKQGALMRGFTATTLRTSHGFGIYFLTYETLIANQAHHGVLR---E 211

Query: 207 MSPSQQIGVSFVGGYLAGILCAVVSHPADVMVSKVNADRKQ----GESMVEASKRIYSRI 262
             P+ ++ V    G  +G     +++P DV+ S + AD+ +    G + +  +K IY   
Sbjct: 212 NIPAWKVCVY---GAFSGAFFWAMTYPFDVVKSVMQADKLKNPVYGRNPLAVAKAIYRER 268

Query: 263 G 263
           G
Sbjct: 269 G 269

 Score = 38.1 bits (87), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 51/206 (24%), Positives = 84/206 (40%), Gaps = 35/206 (16%)

Query: 8   PLFSPEYYAACTLGGVVACGPTHSSVTPLDLVKCRLQV-----NPQLYRSNLDGWKTIVR 62
           PL   +YYA     G V+        TP++ V+ RLQ+     +   Y  +LD  + +++
Sbjct: 115 PLALRQYYAC----GFVSGTANAFLATPIEHVRIRLQLQTASSSAAEYHGSLDCARKLLK 170

Query: 63  SEGLSKVFTGVGATFIGYSLQGACKYGGYEYFKQTYSNLLSPETAH----RHRTAVYLC- 117
              L + FT         +L+ +  +G Y     TY  L++ +  H     +  A  +C 
Sbjct: 171 QGALMRGFTAT-------TLRTSHGFGIYFL---TYETLIANQAHHGVLRENIPAWKVCV 220

Query: 118 --ASASAEFLA-----DILLCPWEAIKVKQQTTIPPFCKNFLEGWSKITAAEGLSGLYKG 170
             A + A F A     D++    +A K+K     P + +N L     I    G     KG
Sbjct: 221 YGAFSGAFFWAMTYPFDVVKSVMQADKLKN----PVYGRNPLAVAKAIYRERGPRAFTKG 276

Query: 171 ITPLWCRQIPYTMCKFTSFERIVEMI 196
            TP   R +P     F +FE  + +I
Sbjct: 277 FTPTMLRSLPVNGATFAAFEITMRLI 302

>Kwal_27.11419
          Length = 298

 Score = 39.3 bits (90), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 30/59 (50%)

Query: 34  TPLDLVKCRLQVNPQLYRSNLDGWKTIVRSEGLSKVFTGVGATFIGYSLQGACKYGGYE 92
           +P D +K R+Q+NP  Y   +  +K+I+R E    +F G+       +L     +G YE
Sbjct: 233 SPFDTIKTRMQLNPSQYYGFIQTFKSIIRYERPRNLFDGLSLRLSRKALSAGIAWGIYE 291

 Score = 38.5 bits (88), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 36/168 (21%), Positives = 67/168 (39%), Gaps = 10/168 (5%)

Query: 20  LGGVVACGPTHSSVTPLDLVKCRLQVNPQLYRSNLDGWKTIVRSEGLSKVFTGVGATFIG 79
           + G +       +  P+ ++K R +     Y+S  +    I RSEG+  +F+G GAT + 
Sbjct: 113 ISGAITRAAVGVATMPITVLKVRFESTMYNYKSLGEAATHIYRSEGIRGLFSGCGATVMR 172

Query: 80  YSLQGACKYGGYEYFKQTYSNLLSPETAHRHRTAVYLC---------ASASAEFLADILL 130
            +         YE  K     +L       + + V+           A+ S+  LA  + 
Sbjct: 173 DAPYAGLYVLFYEQSKLQLPRILPVWMVEHNESGVFSTKTSTIINSIAAFSSASLATTIT 232

Query: 131 CPWEAIKVKQQTTIPPFCKNFLEGWSKITAAEGLSGLYKGITPLWCRQ 178
            P++ IK + Q   P     F++ +  I   E    L+ G++    R+
Sbjct: 233 SPFDTIKTRMQLN-PSQYYGFIQTFKSIIRYERPRNLFDGLSLRLSRK 279

 Score = 38.1 bits (87), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 63/298 (21%), Positives = 110/298 (36%), Gaps = 41/298 (13%)

Query: 20  LGGVVACGPTHSSVTPLDLVKCRLQVNP---------------QLYRSNL-DGWKTIVRS 63
           +GG V    +   + P DL+K RLQ N                QL++  L    +T V S
Sbjct: 12  IGGFVGGLTSAVILQPFDLLKTRLQQNKSSNLLDVVRSIETPGQLWKGTLPSALRTSVGS 71

Query: 64  EGLSKVFTGVGATFIGYSLQG-ACKYGGYEYFKQ--TYSNLLSPETAHRHRTAVYLCASA 120
                    V +      ++G A K G   +  Q   Y NL+S       R AV      
Sbjct: 72  ALFLSTLNIVRSAIADKRVKGIAGKNGSSSFLPQLSMYENLISGAIT---RAAV------ 122

Query: 121 SAEFLADILLCPWEAIKVKQQTTIPPFCKNFLEGWSKITAAEGLSGLYKGITPLWCRQIP 180
                  +   P   +KV+ ++T+  + K+  E  + I  +EG+ GL+ G      R  P
Sbjct: 123 ------GVATMPITVLKVRFESTMYNY-KSLGEAATHIYRSEGIRGLFSGCGATVMRDAP 175

Query: 181 YTMCKFTSFERIVEMIYAKLPRSKQEMSPSQQIG------VSFVGGYLAGILCAVVSHPA 234
           Y       +E+    +   LP    E + S          ++ +  + +  L   ++ P 
Sbjct: 176 YAGLYVLFYEQSKLQLPRILPVWMVEHNESGVFSTKTSTIINSIAAFSSASLATTITSPF 235

Query: 235 DVMVSKVNADRKQGESMVEASKRIYSRIGFGGLWNGLPVRIFMIGTLTSFQWLIYDSF 292
           D + +++  +  Q    ++  K I        L++GL +R+          W IY+  
Sbjct: 236 DTIKTRMQLNPSQYYGFIQTFKSIIRYERPRNLFDGLSLRLSRKALSAGIAWGIYEEL 293

 Score = 29.3 bits (64), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 14/54 (25%), Positives = 29/54 (53%), Gaps = 5/54 (9%)

Query: 217 FVGGYLAGILCAVVSHPADVMVSKVNADRKQGESMVEASKRIYSRIGFGGLWNG 270
           F+GG++ G+  AV+  P D++  K    + +  ++++  + I +    G LW G
Sbjct: 11  FIGGFVGGLTSAVILQPFDLL--KTRLQQNKSSNLLDVVRSIETP---GQLWKG 59

>Scas_671.1*
          Length = 123

 Score = 37.4 bits (85), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 16/70 (22%), Positives = 36/70 (51%), Gaps = 1/70 (1%)

Query: 24  VACGPTHSSVT-PLDLVKCRLQVNPQLYRSNLDGWKTIVRSEGLSKVFTGVGATFIGYSL 82
           +A     +++T P D +K R+Q+ P+++ +       I ++E + ++F+G+       +L
Sbjct: 47  IASASLATAITAPFDTIKTRMQLKPKVFTNFFTTLVLITKNESIFQLFSGLSMRLTRKAL 106

Query: 83  QGACKYGGYE 92
                +G YE
Sbjct: 107 SAGIAWGIYE 116

>Kwal_55.21338
          Length = 323

 Score = 38.9 bits (89), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 57/251 (22%), Positives = 101/251 (40%), Gaps = 23/251 (9%)

Query: 35  PLDLVKCRLQVNPQLYR--SNLDGWKTIVRSEGLSKVFTGVGATFIGYSLQGACKYGGYE 92
           PL +V  +LQ         S  D  K I R +G    F G+ +   G +L     Y  YE
Sbjct: 42  PLIVVTTKLQTQDAKGEKLSLADTIKDIYRKDGAMGFFAGLESALFGTTLSNFVYYYCYE 101

Query: 93  YFKQTYSNLLSPETAHRHRTAVYLCASASAEFLADILLCP-WEAIKVKQQTTIPPFCKNF 151
              +    +L      R  TA  +   + A  L      P W A     + T+    +  
Sbjct: 102 ASSRC---VLRARHTQRLTTAESMLVGSIAGSLNATAANPLWVA---NTRMTVQKSDRGT 155

Query: 152 LEGWSKITAAEGLSGLYKGITPLWCRQIPYTMCKFTSFERIVEMIYAKLPRSKQEMSPSQ 211
           L     I   EG+SGL+KG+ P     I   + ++T +E++   I +   R  + +SPS 
Sbjct: 156 LSTIFDIVKDEGISGLFKGLNPALILVIN-PIIQYTVYEQLKNWILSS--RQTRTLSPSW 212

Query: 212 QIGVSFVGGYLAGILCAVVSHPADVMVSKVN--ADRKQG-----ESMVEASKRIYSRIGF 264
               +F+ G +  +     ++P   M ++++   + K        S++     I  + G 
Sbjct: 213 ----AFILGAVGKLAATGSTYPYVTMKARMHLLGEHKSSTAAPPRSLLSLMAEIIKKDGI 268

Query: 265 GGLWNGLPVRI 275
            GL+ G+ +++
Sbjct: 269 LGLYRGIGIKL 279

>KLLA0C11363g complement(975442..976995) similar to sp|P48233
           Saccharomyces cerevisiae YNL083w singleton, start by
           similarity
          Length = 517

 Score = 38.5 bits (88), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 48/196 (24%), Positives = 77/196 (39%), Gaps = 18/196 (9%)

Query: 15  YAACTLGGVVACGPTHSSVTPLDLVKCRLQ---VNPQLYRSN--LDGWKTIVRSEGLSKV 69
           Y A  LGGV A      SV P+D +K R+Q   +N  L +S+  L   K + +  G+   
Sbjct: 323 YIAGGLGGVAA----QFSVYPIDTLKYRIQCAPLNTNLKKSSILLQTAKEMYQQGGIRLF 378

Query: 70  FTGVGATFIGYSLQGACKYGGYE-----YFKQTYSNLLSPETAHRHRTAVYLCASASAEF 124
           + GV    +G     A   G +      Y K+       PE        + L   A +  
Sbjct: 379 YRGVHIGVMGIFPYAALDLGTFSALKKWYIKKEAKKTGLPEDEVIISNLIVLPMGAFSGT 438

Query: 125 LADILLCPWEAIKVKQQ---TTIPPFCKN-FLEGWSKITAAEGLSGLYKGITPLWCRQIP 180
           +   L+ P   ++ + Q   T   P   N F +   K    EG  GL+KG+ P   +  P
Sbjct: 439 VGATLVYPINLLRTRLQAQGTYAHPHTYNGFSDVLKKTIQREGYQGLFKGLVPNLAKVCP 498

Query: 181 YTMCKFTSFERIVEMI 196
                +  +E +  ++
Sbjct: 499 AVSISYLCYENLKRLM 514

>CAGL0J04114g complement(384321..385232) similar to sp|Q99297
           Saccharomyces cerevisiae YOR222w ODC2 or sp|Q03028
           Saccharomyces cerevisiae YPL134c ODC1, start by
           similarity
          Length = 303

 Score = 37.7 bits (86), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 36/168 (21%), Positives = 72/168 (42%), Gaps = 19/168 (11%)

Query: 114 VYLCASASAEFLADILLC-PWEAIKVKQQTTIPPFC------KNFLEGWSKITAAEGLSG 166
           +Y   S +A  ++++L+  P + +K + Q  +             ++   +I   EG S 
Sbjct: 9   IYQFVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIVKREGFSR 68

Query: 167 LYKGITPLWCRQIPYTMCKFT---SFERIVEMIYAKLPRSKQEMSPSQQIGVSFVGGYLA 223
           LYKGI+     + P    KF    S++++ + +Y     ++Q         +S + G LA
Sbjct: 69  LYKGISSPMLMEAPKRATKFACNDSYQKMFKDLYGVDKLTQQ---------ISILSGSLA 119

Query: 224 GILCAVVSHPADVMVSKVNADRKQGESMVEASKRIYSRIGFGGLWNGL 271
           G+  A V  P +++  ++     +    +E   +     G   L+NGL
Sbjct: 120 GVTEACVIVPFELVKIRLQDVNSKFNGPMEVVFKTIRETGILSLYNGL 167

>Sklu_2075.3 , Contig c2075 6414-7451 reverse complement
          Length = 345

 Score = 37.7 bits (86), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 46/198 (23%), Positives = 76/198 (38%), Gaps = 25/198 (12%)

Query: 16  AACTLGGVVACGPTHSSVTPLDLVKCRLQVNPQL----YRSNLDGWKTIVRSEGLSKVFT 71
           + C + GV+A         P++L K +LQV        Y   +D  K +  S G+  ++ 
Sbjct: 159 SGCIISGVMAGWSVSFIAAPVELAKAKLQVQYDAKTTKYTGPVDVIKKVYSSNGVRGLYK 218

Query: 72  GVGATFIGYSLQGACKYGGYEYFKQTYSNLLSPETAHRHRTAV-YLCASASAEFLADILL 130
           G+ +T I +       +G YE   + +      E  +   TA+ +     SA F      
Sbjct: 219 GLTSTLI-FRTNFVFWWGSYELLTRWFK-----EHTNMSDTAINFWSGGFSASFGFWTTA 272

Query: 131 CPWEAIKVKQQTTIPPFCKNFLEG----WS----KITAAEGLSGLYKGITPLWCRQIPYT 182
            P + IK   Q  +   C +  +G    W      I    G  G +KG  P + R  P  
Sbjct: 273 YPSDVIK---QVVL---CNDKYDGTFRSWKLAAKDIWRTRGYRGFFKGFVPSFLRSFPAN 326

Query: 183 MCKFTSFERIVEMIYAKL 200
                +FE ++    AK+
Sbjct: 327 AAALAAFEFVLRTSGAKV 344

 Score = 31.2 bits (69), Expect = 0.98,   Method: Compositional matrix adjust.
 Identities = 35/145 (24%), Positives = 60/145 (41%), Gaps = 9/145 (6%)

Query: 132 PWEAIKVKQQTTIPPF-CKNFLEGWSKITAAEGLSGLYKGITPLWCRQIPYTMCKFTSFE 190
           P++ IKV+ QT+      K  L+   K    +G+ G Y G TP     I           
Sbjct: 80  PFDTIKVRLQTSQDSTRFKGPLDCVYKTFTQQGIRGFYLGFTPPLVGWILMDSVMLGCLH 139

Query: 191 RIVEMIYAKLPRSKQEMSPSQQIGVSFVGGYLAGILCAVVSHPADVMVSKV----NADRK 246
               M+  K     +E  P   +    + G +AG   + ++ P ++  +K+    +A   
Sbjct: 140 N-YRMLLKKYVYYNEEKLP---LSGCIISGVMAGWSVSFIAAPVELAKAKLQVQYDAKTT 195

Query: 247 QGESMVEASKRIYSRIGFGGLWNGL 271
           +    V+  K++YS  G  GL+ GL
Sbjct: 196 KYTGPVDVIKKVYSSNGVRGLYKGL 220

>YNL083W (YNL083W) [4507] chr14 (471377..473014) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters [1638 bp, 545 aa]
          Length = 545

 Score = 37.7 bits (86), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 48/196 (24%), Positives = 77/196 (39%), Gaps = 18/196 (9%)

Query: 15  YAACTLGGVVACGPTHSSVTPLDLVKCRLQVNP---QLYRSNL--DGWKTIVRSEGLSKV 69
           Y A  L G+ A      SV P+D +K R+Q  P   +L  +NL     K + R  GL   
Sbjct: 351 YIAGGLAGMAA----QFSVYPIDTLKFRVQCAPLDTKLKGNNLLFQTAKDMFREGGLRLF 406

Query: 70  FTGVGATFIGYSLQGACKYGGYEYFKQTY-----SNLLSPETAHRHRTAVYLCASASAEF 124
           + GV    +G     A   G +   K+ Y       L  P+        V L   A +  
Sbjct: 407 YRGVTVGIVGIFPYAALDLGTFSALKKWYIAKQAKTLNLPQDQVTLSNLVVLPMGAFSGT 466

Query: 125 LADILLCPWEAIKVKQQ---TTIPPFCKN-FLEGWSKITAAEGLSGLYKGITPLWCRQIP 180
           +   ++ P   ++ + Q   T   P+  N F +   K    EG  GL+KG+ P   +  P
Sbjct: 467 VGASVVYPINLLRTRLQAQGTYAHPYVYNGFKDVLLKTLEREGYQGLFKGLVPTLAKVCP 526

Query: 181 YTMCKFTSFERIVEMI 196
                +  +E + + +
Sbjct: 527 AVSISYLCYENLKKFM 542

>CAGL0D04774g complement(467712..468680) similar to tr|Q06497
           Saccharomyces cerevisiae YPR128c, start by similarity
          Length = 322

 Score = 37.4 bits (85), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 59/279 (21%), Positives = 102/279 (36%), Gaps = 38/279 (13%)

Query: 22  GVVACGPTHSSVTPLDLVKCRLQVN-----------PQLYRSNLDGWKTIVRSEGLSKVF 70
           G VA     ++V PLDL K  +Q              + Y++ +D    I +  G   ++
Sbjct: 10  GAVASSLAATTVYPLDLAKTLIQTQHKNADSGDSKEEEKYKNVIDCIIKIFKKRGFLGLY 69

Query: 71  TGVGATFIGYSLQGACKY-------GGYEYFKQTYSNLLSPETAHRHRTAVYLCASASAE 123
            G+        +Q    +         Y  FK     L          T   L    SA 
Sbjct: 70  QGLATNVAANFVQNFIYFFWYSLIRSNYFVFKAGRLQLKDDSKFIELSTIEELALGMSAG 129

Query: 124 FLADILLCPWEAIKVKQQTT-------IPPFCKNFLEGWSKITAAEGLSGLYKGI-TPLW 175
            +  ++  P   I  +QQ T       +    K   E      +   L+  +KG    L 
Sbjct: 130 AMTQVVTNPISVISTRQQLTKDGEDASLKAVIKQIYE-----ESNGDLTAFWKGFKVALV 184

Query: 176 CRQIPYTMCKFTSFERIVEMIY-AKLPRSKQEMSPSQQIGVSFVGGYLAGILCAVVSHPA 234
               P     + S++++  MI  AK     Q++S     G +F+ G  + ++   V+ P 
Sbjct: 185 LSTNP--AITYGSYQKLKSMILTAKGLSGSQKISTQLSAGENFLLGMFSKMISTFVTQP- 241

Query: 235 DVMVSKVNADRK--QGESMVEASKRIYSRIGFGGLWNGL 271
            ++V+K+    K  + ++  E  + IY   GF  LW G+
Sbjct: 242 -LIVAKITLQGKGSKFKTFQEVLQHIYQNEGFLSLWKGV 279

>Sklu_2194.3 YMR241W, Contig c2194 5245-6183
          Length = 312

 Score = 36.6 bits (83), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 33/134 (24%), Positives = 62/134 (46%), Gaps = 12/134 (8%)

Query: 157 KITAAEGLSGLYKGITPLWCRQIPYTMCKFTSFERIVEM-IYAKLPRSK--QEMSPSQQI 213
           +I   +G+ G+ KG+  +  RQ+     +F  F R+VE  I     ++    +++  ++I
Sbjct: 159 EIYKKDGIKGINKGVNAVAIRQMTNWGSRF-GFSRLVEEGIRNATGKTNPDDKLTALEKI 217

Query: 214 GVSFVGGYLAGILCAVVSHPADVMVSKVNADRKQGESMVEASKRIYSRIGFGGLWNGLPV 273
             S +GG L+     +     ++   K + +R +  ++  A K IY   G  GL+ G+  
Sbjct: 218 AASAIGGGLSAWNQPIEVIRVEMQSKKEDPNRPKNLTVSSAFKYIYQSSGIKGLYRGVAP 277

Query: 274 RI--------FMIG 279
           RI        FM+G
Sbjct: 278 RIGLGVWQTVFMVG 291

>KLLA0D04290g 366536..367102 similar to sgd|S0006215 Saccharomyces
           cerevisiae YPR011c, hypothetical start
          Length = 188

 Score = 35.4 bits (80), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 24/137 (17%), Positives = 66/137 (48%), Gaps = 7/137 (5%)

Query: 109 RHRTAVYLCASASAEFLADILLCPWEAIKV--KQQTTIPPFCKNFLEGWSKITAAEGLSG 166
           +  +++   A   A  ++  ++ P+E +K+  + Q++   +    +    ++   EG++G
Sbjct: 8   KQESSIAFIAGGVAGAVSRTVVSPFERVKILLQVQSSTSAYNHGIINAVGQVYKEEGVAG 67

Query: 167 LYKGITPLWCRQIPYTMCKFTSFERIVEMIY-AKLPRSKQEMSPSQQIGVSFVGGYLAGI 225
           L++G      R  PY+  +F  +E   + I+       K+++   Q++      G L G 
Sbjct: 68  LFRGNGLNCVRIFPYSAVQFVVYEWCKKHIFHVDGTVGKEQLLNWQRLS----AGALCGG 123

Query: 226 LCAVVSHPADVMVSKVN 242
           +  + ++P D++ ++++
Sbjct: 124 MSVLATYPLDLVRTRLS 140

 Score = 29.6 bits (65), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 18/89 (20%), Positives = 43/89 (48%), Gaps = 3/89 (3%)

Query: 211 QQIGVSFVGGYLAGILCAVVSHPAD---VMVSKVNADRKQGESMVEASKRIYSRIGFGGL 267
           Q+  ++F+ G +AG +   V  P +   +++   ++       ++ A  ++Y   G  GL
Sbjct: 9   QESSIAFIAGGVAGAVSRTVVSPFERVKILLQVQSSTSAYNHGIINAVGQVYKEEGVAGL 68

Query: 268 WNGLPVRIFMIGTLTSFQWLIYDSFKAYI 296
           + G  +    I   ++ Q+++Y+  K +I
Sbjct: 69  FRGNGLNCVRIFPYSAVQFVVYEWCKKHI 97

>CAGL0F04213g 419473..420393 highly similar to sp|P18239
           Saccharomyces cerevisiae YBL030c AAC2 ADP/ATP carrier
           protein, hypothetical start
          Length = 306

 Score = 36.2 bits (82), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 23/68 (33%), Positives = 37/68 (54%), Gaps = 4/68 (5%)

Query: 14  YYAACTLGGVVACGPTHSSVTPLDLVKCRLQVNPQL---YRSNLDGWKTIVRSEGLSKVF 70
           + A+  LG VV  G + +S  PLD V+ R+ +       Y+  +D  + IV +EG+S +F
Sbjct: 215 FIASFLLGWVVTTGASTASY-PLDTVRRRMMMTSGQAVKYKGAMDCLQKIVAAEGVSSLF 273

Query: 71  TGVGATFI 78
            G GA  +
Sbjct: 274 KGCGANIL 281

 Score = 32.0 bits (71), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 36/187 (19%), Positives = 74/187 (39%), Gaps = 23/187 (12%)

Query: 3   TKQPIPLFSPEYYAACTLGGVVACGPTHSSVTPLDLVKCRLQVNPQL---------YRSN 53
           TK+P   F+ ++     L G V+     ++ +P++ VK  +Q   ++         Y+  
Sbjct: 4   TKKPQSNFAIDF-----LMGGVSAAVAKTAASPIERVKLLIQNQDEMIKQGSLDHRYKGI 58

Query: 54  LDGWKTIVRSEGLSKVFTGVGATFIGYSLQGACKYGGYEYFKQTYSNLLSPETAHRHRTA 113
           +D ++   R EG+   + G  A  I Y    A  +   +  K  +      E  +    A
Sbjct: 59  VDCFQRTARQEGIISFWRGNTANVIRYFPTQALNFAFKDQIKAMFG--FKKEEGYAKWFA 116

Query: 114 VYLCASASAEFLADILLCPWEAIKVKQQTTIPPFCKN-------FLEGWSKITAAEGLSG 166
             L +   A  L+ + +   +  + +         K         ++ + K  A++G++G
Sbjct: 117 GNLASGGIAGGLSLMFVYSLDYARTRLAADAKSSKKGGERQFNGLVDVYKKTIASDGVAG 176

Query: 167 LYKGITP 173
           LY+G  P
Sbjct: 177 LYRGFLP 183

 Score = 30.8 bits (68), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 34/162 (20%), Positives = 65/162 (40%), Gaps = 13/162 (8%)

Query: 140 QQTTIPPFCKNFLEGWSKITAAEGLSGLYKGITPLWCRQIPYTMCKFTSFERIVEMIYAK 199
           +Q ++    K  ++ + +    EG+   ++G T    R  P     F   ++I  M    
Sbjct: 47  KQGSLDHRYKGIVDCFQRTARQEGIISFWRGNTANVIRYFPTQALNFAFKDQIKAMF--- 103

Query: 200 LPRSKQEMSPSQQIGVSFVGGYLAGILCAVVSHPADVMVSKVNAD----RKQGE----SM 251
               K+E   ++    +   G +AG L  +  +  D   +++ AD    +K GE     +
Sbjct: 104 --GFKKEEGYAKWFAGNLASGGIAGGLSLMFVYSLDYARTRLAADAKSSKKGGERQFNGL 161

Query: 252 VEASKRIYSRIGFGGLWNGLPVRIFMIGTLTSFQWLIYDSFK 293
           V+  K+  +  G  GL+ G    +  I       + +YDS K
Sbjct: 162 VDVYKKTIASDGVAGLYRGFLPSVIGIVVYRGLYFGLYDSCK 203

 Score = 30.8 bits (68), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 38/181 (20%), Positives = 69/181 (38%), Gaps = 39/181 (21%)

Query: 12  PEYYAACTLGGVVACGPTHSSVTPLDLVKCRLQVNPQ--------LYRSNLDGWKTIVRS 63
            +++A     G +A G +   V  LD  + RL  + +         +   +D +K  + S
Sbjct: 112 AKWFAGNLASGGIAGGLSLMFVYSLDYARTRLAADAKSSKKGGERQFNGLVDVYKKTIAS 171

Query: 64  EGLSKVFTGVGATFIGYSLQGACKYGGYEYFKQTYSNLLSPETAHRHRTAVYLCASASAE 123
           +G++ ++ G   + IG  +     +G Y+  K                  + L  S    
Sbjct: 172 DGVAGLYRGFLPSVIGIVVYRGLYFGLYDSCK-----------------PLLLTGSLEGS 214

Query: 124 FLADILLC------------PWEAIKVKQQTTIPPFCK--NFLEGWSKITAAEGLSGLYK 169
           F+A  LL             P + ++ +   T     K    ++   KI AAEG+S L+K
Sbjct: 215 FIASFLLGWVVTTGASTASYPLDTVRRRMMMTSGQAVKYKGAMDCLQKIVAAEGVSSLFK 274

Query: 170 G 170
           G
Sbjct: 275 G 275

>Kwal_33.12988
          Length = 303

 Score = 35.8 bits (81), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 50/205 (24%), Positives = 81/205 (39%), Gaps = 27/205 (13%)

Query: 5   QPIPLFSPEYYAACTLGGVVACGPTHSSVTPLDLVKCRLQVNPQ-----LYRSNLDGWKT 59
           Q   L  PEYYA    G V  C     + TP++ V+  LQV  +      Y+  +D  K 
Sbjct: 112 QSTSLRLPEYYAC---GFVSGCANAFLA-TPIEHVRILLQVQTKSRADAEYQGAMDCIKK 167

Query: 60  IVRSEGLSKVFTGVGATFIGYSLQGACKYGGYEYFKQTYSNLLSPET----AHRHRTAVY 115
           +++   L + FT    T +  S        G+  +  +Y  ++  E     A +   A  
Sbjct: 168 LLKEGKLMRGFT---PTILRTS-------HGFGVYFTSYEAMICSEQRKGIARKDIPAWK 217

Query: 116 LCA-SASAEFLADILLCPWEAIKVKQQTT---IPPFCKNFLEGWSKITAAEGLSGLYKGI 171
           LC   A +  L   ++ P++ IK   Q+     P +  N  +    I    G     KG 
Sbjct: 218 LCLYGAFSGSLLWAMVYPFDVIKSVMQSDKLRTPVYGTNVFQVAKNIYNERGPKAFVKGF 277

Query: 172 TPLWCRQIPYTMCKFTSFERIVEMI 196
            P   R +P     FT+FE  + ++
Sbjct: 278 GPTMLRSLPVNGATFTAFEMAMRIL 302

>KLLA0A00979g complement(92561..93592) weakly similar to sp|P38152
           Saccharomyces cerevisiae YBR291c CTP1 citrate transport
           protein, mitochondrial (MCF), start by similarity
          Length = 343

 Score = 35.8 bits (81), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 30/134 (22%), Positives = 52/134 (38%), Gaps = 15/134 (11%)

Query: 150 NFLEGWSKITAAEGLSGLYKGITPLWCRQIPYTMCKFTSFERIVEMIYAKLPRSKQEMSP 209
           N      ++    G +  ++G  P   RQ+  +  +FT++  + +MI           SP
Sbjct: 192 NIFTTVREMVQTRGFTTFFQGSMPTIFRQVGNSAVRFTTYTTLKQMI-----------SP 240

Query: 210 SQQIGVSFVGGYLAGILCAVVSHPADVMVSKVNADRKQGESMVEAS----KRIYSRIGFG 265
           ++ +   +  G      CAVV+    + V K     K   S+   S     R +   G  
Sbjct: 241 NKPLSEYYAFGIGVFSSCAVVALTQPIDVVKTRMQSKYTWSLYRNSLNCVYRTFIEEGLT 300

Query: 266 GLWNGLPVRIFMIG 279
            LW G   R+F +G
Sbjct: 301 SLWKGWVPRLFKVG 314

 Score = 33.1 bits (74), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 25/83 (30%), Positives = 38/83 (45%), Gaps = 4/83 (4%)

Query: 13  EYYAACTLGGVVACGPTHSSVTPLDLVKCRLQVNP--QLYRSNLDGWKTIVRSEGLSKVF 70
           EYYA     GV +     +   P+D+VK R+Q      LYR++L+        EGL+ ++
Sbjct: 246 EYYAFGI--GVFSSCAVVALTQPIDVVKTRMQSKYTWSLYRNSLNCVYRTFIEEGLTSLW 303

Query: 71  TGVGATFIGYSLQGACKYGGYEY 93
            G         L G   +G Y+Y
Sbjct: 304 KGWVPRLFKVGLSGGVSFGVYQY 326

>YFR045W (YFR045W) [1727] chr6 (242129..242986) Member of the
           mitochondrial carrier family (MCF) family of membrane
           transporters [858 bp, 285 aa]
          Length = 285

 Score = 35.4 bits (80), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 29/166 (17%), Positives = 62/166 (37%), Gaps = 13/166 (7%)

Query: 137 KVKQQTTIPPFCKNFLEGWSKITAAEGLSGLYKGITPLWCRQIPYTMCKFTSFERIVEMI 196
           KV  ++T     +  L     +    G +   +G T    RQI  T  +FT++     ++
Sbjct: 129 KVATKSTPVARIEKLLPAVKHMYQTRGPAAFVQGTTATIFRQIANTSIQFTAYTAFKRLL 188

Query: 197 YAKLPRSKQEMSPSQQIGVSFVGGYLAGILCAVVSHPADVMVSKVNADRKQGE--SMVEA 254
            A+  ++            S + G         ++ P DV+ +++ +   + E  + +  
Sbjct: 189 QARNDKAS-----------SVITGLATSFTLVAMTQPIDVVKTRMMSQNAKTEYKNTLNC 237

Query: 255 SKRIYSRIGFGGLWNGLPVRIFMIGTLTSFQWLIYDSFKAYIGLPT 300
             RI+ + G    W G   R   +G      + +Y+     +G  +
Sbjct: 238 MYRIFVQEGMATFWKGSIFRFMKVGISGGLTFTVYEQVSLLLGFSS 283

>Kwal_34.15907
          Length = 312

 Score = 35.0 bits (79), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 36/149 (24%), Positives = 66/149 (44%), Gaps = 7/149 (4%)

Query: 155 WS---KITAAEGLSGLYKGITPLWCRQIPYTMCKFTSFERIVEM---IYAKLPRSKQEMS 208
           WS   +I + EG+ G+ KG+  +  RQ+     +F    R+VE     +        +++
Sbjct: 154 WSAFKEIYSKEGIKGINKGVNAVAIRQMTNWGSRF-GLSRLVEQGIRDFTGKTNPDDKLT 212

Query: 209 PSQQIGVSFVGGYLAGILCAVVSHPADVMVSKVNADRKQGESMVEASKRIYSRIGFGGLW 268
             ++I  S +GG L+     +     ++   K + +R +  ++  A K IY   G  GL+
Sbjct: 213 ALEKIFASALGGGLSAWNQPIEVIRVEMQSKKEDPNRPKKLTVGSAFKYIYQSSGIKGLY 272

Query: 269 NGLPVRIFMIGTLTSFQWLIYDSFKAYIG 297
            G+  RI +    T F     D  K ++G
Sbjct: 273 RGVAPRIGLGVWQTVFMVGFGDIAKEFVG 301

 Score = 29.3 bits (64), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 30/142 (21%), Positives = 56/142 (39%), Gaps = 4/142 (2%)

Query: 36  LDLVKCRLQVNPQLYRSNLDGWKTIVRSEGLSKVFTGVGATFIGYSLQGACKYGGYEYFK 95
           +++ K +  V   + +S+   +K I   EG+  +  GV A  I        ++G     +
Sbjct: 136 VEITKAKSAVAGAIPQSSWSAFKEIYSKEGIKGINKGVNAVAIRQMTNWGSRFGLSRLVE 195

Query: 96  QTYSNLLSPETAHRHRTAVYLCASASAEFLADILLCPWEAIKVKQQTT--IPPFCKNFLE 153
           Q   +           TA+    +++          P E I+V+ Q+    P   K    
Sbjct: 196 QGIRDFTGKTNPDDKLTALEKIFASALGGGLSAWNQPIEVIRVEMQSKKEDPNRPKKLTV 255

Query: 154 G--WSKITAAEGLSGLYKGITP 173
           G  +  I  + G+ GLY+G+ P
Sbjct: 256 GSAFKYIYQSSGIKGLYRGVAP 277

>Kwal_27.12481
          Length = 304

 Score = 35.0 bits (79), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 38/181 (20%), Positives = 68/181 (37%), Gaps = 39/181 (21%)

Query: 12  PEYYAACTLGGVVACGPTHSSVTPLDLVKCRLQVNPQ--------LYRSNLDGWKTIVRS 63
            +++A     G  A G +   V  LD  + RL  + +         +   +D +K  + S
Sbjct: 111 AKWFAGNLASGGAAGGLSLMFVYSLDYARTRLAADSKGAKKGGERQFNGLVDVYKKTLAS 170

Query: 64  EGLSKVFTGVGATFIGYSLQGACKYGGYEYFKQTYSNLLSPETAHRHRTAVYLCASASAE 123
           +G++ ++ G   + +G  +     +GGY+  K                  + L  S    
Sbjct: 171 DGIAGLYRGFLPSVVGIVVYRGLYFGGYDSLKP-----------------LLLTGSLEGS 213

Query: 124 FLADILLC------------PWEAIKVKQQTTIPPFCK--NFLEGWSKITAAEGLSGLYK 169
           FLA  LL             P + ++ +   T     K     + + KI AAEG+  L+K
Sbjct: 214 FLASFLLGWAVTTGASTASYPLDTVRRRMMMTSGQAVKYNGAFDAFRKIVAAEGIKSLFK 273

Query: 170 G 170
           G
Sbjct: 274 G 274

 Score = 34.7 bits (78), Expect = 0.065,   Method: Compositional matrix adjust.
 Identities = 21/68 (30%), Positives = 34/68 (50%), Gaps = 4/68 (5%)

Query: 14  YYAACTLGGVVACGPTHSSVTPLDLVKCRLQVNPQL---YRSNLDGWKTIVRSEGLSKVF 70
           + A+  LG  V  G + +S  PLD V+ R+ +       Y    D ++ IV +EG+  +F
Sbjct: 214 FLASFLLGWAVTTGASTASY-PLDTVRRRMMMTSGQAVKYNGAFDAFRKIVAAEGIKSLF 272

Query: 71  TGVGATFI 78
            G GA  +
Sbjct: 273 KGCGANIL 280

>YMR056C (AAC1) [4016] chr13 complement(387314..388243) ADP/ATP
           carrier protein of the mitochondrial carrier family
           (MCF) of membrane transporters [930 bp, 309 aa]
          Length = 309

 Score = 35.0 bits (79), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 40/205 (19%), Positives = 76/205 (37%), Gaps = 21/205 (10%)

Query: 105 ETAHRHRTAVYLCASASAEFLADILLCPWEAIKVKQQT--------TIPPFCKNFLEGWS 156
           +T   H    +L    SA  +A     P E +K+  Q         ++    K  L+ + 
Sbjct: 7   QTQQSHFGVDFLMGGVSAA-IAKTGAAPIERVKLLMQNQEEMLKQGSLDTRYKGILDCFK 65

Query: 157 KITAAEGLSGLYKGITPLWCRQIPYTMCKFTSFERIVEMIYAKLPRSKQEMSPSQQIGVS 216
           +    EG+   ++G T    R  P     F   ++I  +    L   ++    ++    +
Sbjct: 66  RTATHEGIVSFWRGNTANVLRYFPTQALNFAFKDKIKSL----LSYDRERDGYAKWFAGN 121

Query: 217 FVGGYLAGILCAVVSHPADVMVSKVNAD--------RKQGESMVEASKRIYSRIGFGGLW 268
              G  AG L  +  +  D   +++ AD        ++Q   +++  K+     G  GL+
Sbjct: 122 LFSGGAAGGLSLLFVYSLDYARTRLAADARGSKSTSQRQFNGLLDVYKKTLKTDGLLGLY 181

Query: 269 NGLPVRIFMIGTLTSFQWLIYDSFK 293
            G    +  I       + +YDSFK
Sbjct: 182 RGFVPSVLGIIVYRGLYFGLYDSFK 206

 Score = 32.0 bits (71), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 33/66 (50%), Gaps = 4/66 (6%)

Query: 14  YYAACTLGGVVACGPTHSSVTPLDLVKCRLQVNPQL---YRSNLDGWKTIVRSEGLSKVF 70
           + A+  LG V+  G + +S  PLD V+ R+ +       Y   LD  + IV+ EG   +F
Sbjct: 218 FVASFLLGWVITMGASTASY-PLDTVRRRMMMTSGQTIKYDGALDCLRKIVQKEGAYSLF 276

Query: 71  TGVGAT 76
            G GA 
Sbjct: 277 KGCGAN 282

>CAGL0K12210g 1193771..1194706 similar to sp|P38087 Saccharomyces
           cerevisiae YBR104w YMC2 or sp|P32331 Saccharomyces
           cerevisiae YPR058w YMC1, start by similarity
          Length = 311

 Score = 35.0 bits (79), Expect = 0.062,   Method: Compositional matrix adjust.
 Identities = 47/204 (23%), Positives = 80/204 (39%), Gaps = 29/204 (14%)

Query: 6   PIPLFSPEYYAACTLGGVVACGPTHSSVTPLDLVKCRLQV-----NPQLYRSNLDGWKTI 60
           P+PL   +YY     GGVV          P++ V+ RLQ      N + ++   D  K +
Sbjct: 123 PLPLH--QYYLCGLTGGVV----NSFLAAPIEHVRIRLQTQTSQGNERQFKGPFDCIKKL 176

Query: 61  VRSEGLSKVFTGVGATFIGYSLQGACKYGGYEYFKQTYSNLLSPE----TAHRHRTAVYL 116
            +++ L +   G+  T I         +G   YF   Y  L+  E    T      A  L
Sbjct: 177 AKAKALMR---GLLPTMI------RAGHGLGTYFA-AYEALVVKEFEKGTPRNQIPAWKL 226

Query: 117 CA-SASAEFLADILLCPWEAIKVKQQTTI---PPFCKNFLEGWSKITAAEGLSGLYKGIT 172
           C+  A +  +  + + P + +K   QT     P +  + ++    +    G+   +KG  
Sbjct: 227 CSFGALSGTILWLTVYPVDVVKSVLQTDSIENPKYKNSIIKATRALYKQHGIPAFFKGFV 286

Query: 173 PLWCRQIPYTMCKFTSFERIVEMI 196
           P   R  P     F SFE  + ++
Sbjct: 287 PTMIRAAPANAATFVSFEMTMRVL 310

>Scas_667.4
          Length = 308

 Score = 34.7 bits (78), Expect = 0.064,   Method: Compositional matrix adjust.
 Identities = 21/68 (30%), Positives = 36/68 (52%), Gaps = 4/68 (5%)

Query: 14  YYAACTLGGVVACGPTHSSVTPLDLVKCRLQVNPQL---YRSNLDGWKTIVRSEGLSKVF 70
           + A+  LG +V  G + +S  PLD V+ R+ +       Y    D ++ +V +EG+S +F
Sbjct: 217 FLASFLLGWIVTTGASTASY-PLDTVRRRMMMTSGQAVKYDGAFDCFRKVVAAEGVSSLF 275

Query: 71  TGVGATFI 78
            G GA  +
Sbjct: 276 KGCGANIL 283

 Score = 32.3 bits (72), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 33/162 (20%), Positives = 62/162 (38%), Gaps = 13/162 (8%)

Query: 140 QQTTIPPFCKNFLEGWSKITAAEGLSGLYKGITPLWCRQIPYTMCKFTSFERIVEMIYAK 199
           +Q ++    K  +E + +    EG+   ++G T    R  P     F   ++I  M    
Sbjct: 49  KQGSLDSKYKGIIECFQRTAKTEGIIAFWRGNTANVIRYFPTQALNFAFKDKIKAMF--- 105

Query: 200 LPRSKQEMSPSQQIGVSFVGGYLAGILCAVVSHPADVMVSKVNADRK--------QGESM 251
               K+E    +    +   G  AG L  +  +  D   +++ AD K        Q + +
Sbjct: 106 --GFKKEEGYGKWFAGNLASGGAAGGLSLLFVYSLDYARTRLAADAKSSKKGGSRQYKGL 163

Query: 252 VEASKRIYSRIGFGGLWNGLPVRIFMIGTLTSFQWLIYDSFK 293
           ++  K+  +  G  GL+ G    +  I       + +YDS K
Sbjct: 164 IDVYKQTLATDGMAGLYRGFLPSVVGIIVYRGLYFGLYDSLK 205

 Score = 30.8 bits (68), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 38/180 (21%), Positives = 69/180 (38%), Gaps = 39/180 (21%)

Query: 13  EYYAACTLGGVVACGPTHSSVTPLDLVKCRLQVNPQ--------LYRSNLDGWKTIVRSE 64
           +++A     G  A G +   V  LD  + RL  + +         Y+  +D +K  + ++
Sbjct: 115 KWFAGNLASGGAAGGLSLLFVYSLDYARTRLAADAKSSKKGGSRQYKGLIDVYKQTLATD 174

Query: 65  GLSKVFTGVGATFIGYSLQGACKYGGYEYFKQTYSNLLSPETAHRHRTAVYLCASASAEF 124
           G++ ++ G   + +G  +     +G Y+  K        P           L  S    F
Sbjct: 175 GMAGLYRGFLPSVVGIIVYRGLYFGLYDSLK--------PAV---------LTGSLEGSF 217

Query: 125 LADILLC------------PWEAIKVKQQTTIPPFCK--NFLEGWSKITAAEGLSGLYKG 170
           LA  LL             P + ++ +   T     K     + + K+ AAEG+S L+KG
Sbjct: 218 LASFLLGWIVTTGASTASYPLDTVRRRMMMTSGQAVKYDGAFDCFRKVVAAEGVSSLFKG 277

>YBR085W (AAC3) [275] chr2 (415940..416863) ADP/ATP transporter
           protein, member of the mitochondrial carrier family
           (MCF) of membrane transporters [924 bp, 307 aa]
          Length = 307

 Score = 34.7 bits (78), Expect = 0.069,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 34/68 (50%), Gaps = 4/68 (5%)

Query: 14  YYAACTLGGVVACGPTHSSVTPLDLVKCRLQVNPQL---YRSNLDGWKTIVRSEGLSKVF 70
           + A+  LG VV  G +  S  PLD V+ R+ +       Y   +D  K IV SEG+  +F
Sbjct: 216 FLASFLLGWVVTTGASTCSY-PLDTVRRRMMMTSGQAVKYNGAIDCLKKIVASEGVGSLF 274

Query: 71  TGVGATFI 78
            G GA  +
Sbjct: 275 KGCGANIL 282

 Score = 32.0 bits (71), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 51/281 (18%), Positives = 102/281 (36%), Gaps = 29/281 (10%)

Query: 15  YAACTLGGVVACGPTHSSVTPLDLVKCRLQVNPQL---------YRSNLDGWKTIVRSEG 65
           +A   L G V+     ++ +P++ VK  +Q   ++         Y   +D +K   + EG
Sbjct: 12  FAINFLMGGVSAAIAKTAASPIERVKILIQNQDEMIKQGTLDKKYSGIVDCFKRTAKQEG 71

Query: 66  LSKVFTGVGATFIGYSLQGACKYGGYEYFKQTYSNLLSPETAHRHRTAVYLCASASAEFL 125
           L   + G  A  I Y    A  +   +  K  +      E  +    A  L +  +A  L
Sbjct: 72  LISFWRGNTANVIRYFPTQALNFAFKDKIKLMFG--FKKEEGYGKWFAGNLASGGAAGAL 129

Query: 126 ADILLCPWEAIKVKQQTTIPPFCKN-------FLEGWSKITAAEGLSGLYKGITPLWCRQ 178
           + + +   +  + +         K          + + K   ++G++GLY+G  P     
Sbjct: 130 SLLFVYSLDFARTRLAADAKSSKKGGARQFNGLTDVYKKTLKSDGIAGLYRGFMPSVVGI 189

Query: 179 IPYTMCKFTSFERIVEMIYAKLPRSKQEMSPSQQIGVSFVGGYLAGILCAVVSHPADVMV 238
           + Y    F  F+ +  ++           S       SF+ G++     +  S+P D + 
Sbjct: 190 VVYRGLYFGMFDSLKPLVLTG--------SLDGSFLASFLLGWVVTTGASTCSYPLDTVR 241

Query: 239 SKVNADRKQG---ESMVEASKRIYSRIGFGGLWNGLPVRIF 276
            ++     Q       ++  K+I +  G G L+ G    I 
Sbjct: 242 RRMMMTSGQAVKYNGAIDCLKKIVASEGVGSLFKGCGANIL 282

>CAGL0K07436g complement(734496..735419) highly similar to sp|Q04013
           Saccharomyces cerevisiae YMR241w, hypothetical start
          Length = 307

 Score = 34.7 bits (78), Expect = 0.072,   Method: Compositional matrix adjust.
 Identities = 32/133 (24%), Positives = 59/133 (44%), Gaps = 12/133 (9%)

Query: 158 ITAAEGLSGLYKGITPLWCRQIPYTMCKFTSFERIVEMIYAKLPRS---KQEMSPSQQIG 214
           I   EG+ G+ KG+  +  RQ+     +F    R+VE    KL        +++  ++I 
Sbjct: 155 IYKKEGIRGINKGVNAVAIRQMTNWGSRF-GLSRLVEDGIRKLTGKTGKDDKLTALEKIM 213

Query: 215 VSFVGGYLAGILCAVVSHPADVMVSKVNADRKQGESMVEASKRIYSRIGFGGLWNGLPVR 274
            S +GG L+     +     ++   K + +R +  ++ +  K IY   G  GL+ G+  R
Sbjct: 214 ASAIGGGLSAWNQPIEVIRVEMQSKKEDPNRPKNLTVGKTFKYIYQSNGLKGLYRGVTPR 273

Query: 275 --------IFMIG 279
                   +FM+G
Sbjct: 274 VGLGIWQTVFMVG 286

 Score = 32.0 bits (71), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 30/121 (24%), Positives = 49/121 (40%), Gaps = 4/121 (3%)

Query: 57  WKTIVRSEGLSKVFTGVGATFIGYSLQGACKYGGYEYFKQTYSNLLSPETAHRHRTAVYL 116
           +K+I + EG+  +  GV A  I        ++G     +     L          TA+  
Sbjct: 152 FKSIYKKEGIRGINKGVNAVAIRQMTNWGSRFGLSRLVEDGIRKLTGKTGKDDKLTALEK 211

Query: 117 CASASAEFLADILLCPWEAIKVKQQTT--IPPFCKNFLEG--WSKITAAEGLSGLYKGIT 172
             +++          P E I+V+ Q+    P   KN   G  +  I  + GL GLY+G+T
Sbjct: 212 IMASAIGGGLSAWNQPIEVIRVEMQSKKEDPNRPKNLTVGKTFKYIYQSNGLKGLYRGVT 271

Query: 173 P 173
           P
Sbjct: 272 P 272

>CAGL0D01606g complement(169066..169983) highly similar to sp|P32331
           Saccharomyces cerevisiae YPR058w YMC1 or sp|P38087
           Saccharomyces cerevisiae YBR104w YMC2, start by
           similarity
          Length = 305

 Score = 34.7 bits (78), Expect = 0.083,   Method: Compositional matrix adjust.
 Identities = 19/72 (26%), Positives = 32/72 (44%), Gaps = 3/72 (4%)

Query: 128 ILLCPWEAIKVKQQT---TIPPFCKNFLEGWSKITAAEGLSGLYKGITPLWCRQIPYTMC 184
           +++ P + +K   QT     P   KN ++    + A EGL   +KG  P   R  P    
Sbjct: 233 LMVYPIDVVKSVMQTDNLNKPQNGKNMIQVARNLYAREGLKAFFKGFGPTMLRAAPANGG 292

Query: 185 KFTSFERIVEMI 196
            F +FE  + ++
Sbjct: 293 TFATFELAMRLL 304

>KLLA0E12353g complement(1092303..1093220)
           gi|1351895|sp|P49382|ADT_KLULA Kluyveromyces lactis ADP,
           ATP carrier protein (ADP/ATP translocase) (Adenine
           nucleotide translocator) (ANT), start by similarity
          Length = 305

 Score = 34.3 bits (77), Expect = 0.086,   Method: Compositional matrix adjust.
 Identities = 21/68 (30%), Positives = 34/68 (50%), Gaps = 4/68 (5%)

Query: 14  YYAACTLGGVVACGPTHSSVTPLDLVKCRLQVNPQL---YRSNLDGWKTIVRSEGLSKVF 70
           + A+  LG  V  G + +S  PLD V+ R+ +       Y    D ++ IV +EG+  +F
Sbjct: 214 FLASFLLGWAVTTGASTASY-PLDTVRRRMMMTSGQAVKYDGAFDAFRKIVAAEGIKSLF 272

Query: 71  TGVGATFI 78
            G GA  +
Sbjct: 273 KGCGANIL 280

>AFR147C [3339] [Homologous to NOHBY] (703270..704217) [948 bp, 315
           aa]
          Length = 315

 Score = 34.3 bits (77), Expect = 0.095,   Method: Compositional matrix adjust.
 Identities = 53/250 (21%), Positives = 104/250 (41%), Gaps = 19/250 (7%)

Query: 35  PLDLVKCRLQVNPQ------LYRSNLDGWKTIVRSEGLSKVFTGVGATFIGYSLQGACKY 88
           PL  +  R+QV+ Q        +S L+  + I R EG+   + G+ +   G     A   
Sbjct: 36  PLVTLATRMQVSEQDKEPGTRSKSKLEAVREIYRKEGVVGFYYGLESAMYG---MAANSL 92

Query: 89  GGYEYFKQTYSNLLSPETAHRHRTAVYLCASASAEFLADILLCP-WEAIKVKQQTTIPPF 147
             Y +++      +    + R  T+  + +SA A  +  I   P W    V  + T+   
Sbjct: 93  NYYYFYELAARATMRVRGSRRLNTSEAILSSAVAGSMTAIASNPIW---VVNTRMTVAKS 149

Query: 148 CKNFLEGWSKITAAEGLSGLYKGITPLWCRQIPYTMCKFTSFERIVEMIYAKLPRSKQE- 206
            ++ L     I   +G++ L+ G+ P     +   + ++T FE++  ++   L  S  + 
Sbjct: 150 EQSTLAVLLDIVRKDGVTALFNGLRPA-LMLVSNPIIQYTVFEQLKNVV---LKWSGSDV 205

Query: 207 MSPSQQIGVSFVGGYLA-GILCAVVSHPADVMVSKVNADRKQGESMVEASKRIYSRIGFG 265
           + PS    +  VG   A G     ++    + ++K   D    +SM      I  + G  
Sbjct: 206 LLPSWAFLLGAVGKLAATGSTYPYITLKTRMHLAKGKEDADTQQSMWSLMVDIVKKEGIQ 265

Query: 266 GLWNGLPVRI 275
           GL++G+ V++
Sbjct: 266 GLYHGIGVKL 275

>Scas_718.24
          Length = 337

 Score = 34.3 bits (77), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 36/68 (52%), Gaps = 4/68 (5%)

Query: 14  YYAACTLGGVVACGPTHSSVTPLDLVKCRLQVNPQL---YRSNLDGWKTIVRSEGLSKVF 70
           + A+  LG VV  G +  S  PLD V+ ++ +       Y+   D +K IV +EG++ +F
Sbjct: 246 FLASFLLGWVVTTGASTCSY-PLDTVRRKMMMTSGQAVKYKGAFDCFKKIVAAEGVASLF 304

Query: 71  TGVGATFI 78
            G GA  +
Sbjct: 305 KGCGANIL 312

 Score = 33.9 bits (76), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 39/180 (21%), Positives = 69/180 (38%), Gaps = 39/180 (21%)

Query: 13  EYYAACTLGGVVACGPTHSSVTPLDLVKCRLQVNPQ--------LYRSNLDGWKTIVRSE 64
           +++A     G  A G +   V  LD  + RL  + +         +   +D +K  ++S+
Sbjct: 144 KWFAGNLASGGAAGGLSLLFVYSLDFARTRLAADSKSSKKGGSRQFNGLIDVYKKTLKSD 203

Query: 65  GLSKVFTGVGATFIGYSLQGACKYGGYEYFKQTYSNLLSPETAHRHRTAVYLCASASAEF 124
           G++ ++ G   + +G  +     +G Y+  K                  V L  S    F
Sbjct: 204 GVAGLYRGFLPSVVGIIVYRGLYFGLYDSIK-----------------PVLLTGSLEGSF 246

Query: 125 LADILLC------------PWEAIKVKQQTTIPPFCK--NFLEGWSKITAAEGLSGLYKG 170
           LA  LL             P + ++ K   T     K     + + KI AAEG++ L+KG
Sbjct: 247 LASFLLGWVVTTGASTCSYPLDTVRRKMMMTSGQAVKYKGAFDCFKKIVAAEGVASLFKG 306

 Score = 33.1 bits (74), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 41/211 (19%), Positives = 81/211 (38%), Gaps = 22/211 (10%)

Query: 99  SNLLSPETAHRHRTAVYLCASASAEFLADILLCPWEAIKVK--------QQTTIPPFCKN 150
           + ++S E    +    +L    SA  +A     P E +K+         +Q T+    K 
Sbjct: 30  NTIMSTEKPQSNFAIDFLMGGVSAA-VAKTAASPIERVKLLIQNQNEMLKQGTLDTKYKG 88

Query: 151 FLEGWSKITAAEGLSGLYKGITPLWCRQIPYTMCKFTSFERIVEMIYAKLPRSKQEMSPS 210
            ++ + +    EG+   ++G T    R  P     F +F+  +++++      K+E    
Sbjct: 89  IVDCFRRTAQQEGIISFWRGNTANVIRYFPTQALNF-AFKDKIKLMFG----FKKEDGYG 143

Query: 211 QQIGVSFVGGYLAGILCAVVSHPADVMVSKVNADRK--------QGESMVEASKRIYSRI 262
           +    +   G  AG L  +  +  D   +++ AD K        Q   +++  K+     
Sbjct: 144 KWFAGNLASGGAAGGLSLLFVYSLDFARTRLAADSKSSKKGGSRQFNGLIDVYKKTLKSD 203

Query: 263 GFGGLWNGLPVRIFMIGTLTSFQWLIYDSFK 293
           G  GL+ G    +  I       + +YDS K
Sbjct: 204 GVAGLYRGFLPSVVGIIVYRGLYFGLYDSIK 234

 Score = 32.0 bits (71), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 39/208 (18%), Positives = 86/208 (41%), Gaps = 23/208 (11%)

Query: 1   MSTKQPIPLFSPEYYAACTLGGVVACGPTHSSVTPLDLVKCRLQVNPQL---------YR 51
           MST++P   F+ ++     L G V+     ++ +P++ VK  +Q   ++         Y+
Sbjct: 33  MSTEKPQSNFAIDF-----LMGGVSAAVAKTAASPIERVKLLIQNQNEMLKQGTLDTKYK 87

Query: 52  SNLDGWKTIVRSEGLSKVFTGVGATFIGYSLQGACKYGGYEYFKQTYSNLLSPETAHRHR 111
             +D ++   + EG+   + G  A  I Y    A  +   +  K  +      E  +   
Sbjct: 88  GIVDCFRRTAQQEGIISFWRGNTANVIRYFPTQALNFAFKDKIKLMFG--FKKEDGYGKW 145

Query: 112 TAVYLCASASAEFLADILLCPWEAIKVK----QQTTIPPFCKNF---LEGWSKITAAEGL 164
            A  L +  +A  L+ + +   +  + +     +++     + F   ++ + K   ++G+
Sbjct: 146 FAGNLASGGAAGGLSLLFVYSLDFARTRLAADSKSSKKGGSRQFNGLIDVYKKTLKSDGV 205

Query: 165 SGLYKGITPLWCRQIPYTMCKFTSFERI 192
           +GLY+G  P     I Y    F  ++ I
Sbjct: 206 AGLYRGFLPSVVGIIVYRGLYFGLYDSI 233

>CAGL0J05522g complement(524930..526489) highly similar to sp|P48233
           Saccharomyces cerevisiae YNL083w, hypothetical start
          Length = 519

 Score = 34.3 bits (77), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 45/198 (22%), Positives = 76/198 (38%), Gaps = 22/198 (11%)

Query: 15  YAACTLGGVVACGPTHSSVTPLDLVKCRLQVNPQLYRSNLDGWKTIVRSE-------GLS 67
           + A  L GV A      SV P+D +K R+Q  P    + L G K ++++        GL 
Sbjct: 324 FIAGGLAGVCA----QFSVYPIDTLKFRMQCAP--LNAELKGRKLMIQTAKEMYTEGGLK 377

Query: 68  KVFTGVGATFIGYSLQGACKYGGYEYFKQTY-----SNLLSPETAHRHRTAVYLCASASA 122
             + GV    +G     A   G +   K+ Y       L   E        V L   A +
Sbjct: 378 LFYRGVTVGVLGIFPYAALDLGTFSMLKKWYISSKAKKLNKKEEDVELSNLVVLPMGAFS 437

Query: 123 EFLADILLCPWEAIKVKQQ---TTIPPFCKN-FLEGWSKITAAEGLSGLYKGITPLWCRQ 178
                 ++ P   ++ + Q   T   P+  + F +   K    EG  GL+KG+ P   + 
Sbjct: 438 GTFGATVVYPINLLRTRLQAQGTFAHPYRYDGFRDVLLKTIQREGYPGLFKGLVPTLAKV 497

Query: 179 IPYTMCKFTSFERIVEMI 196
            P     +  +E + +++
Sbjct: 498 CPAVSISYLCYENLKKLM 515

>Kwal_23.3042
          Length = 542

 Score = 34.3 bits (77), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 43/192 (22%), Positives = 69/192 (35%), Gaps = 18/192 (9%)

Query: 15  YAACTLGGVVACGPTHSSVTPLDLVKCRLQVNPQLYRSN-----LDGWKTIVRSEGLSKV 69
           Y A  LGGV+A      SV P+D +K R+Q  P    S      +   K + +  GL   
Sbjct: 348 YLAGGLGGVMA----QLSVYPIDTLKYRVQCAPLNTESKGRQLLISTAKDMYKEGGLRIF 403

Query: 70  FTGVGATFIGYSLQGACKYGGYEYFKQTYSNLLS-----PETAHRHRTAVYLCASASAEF 124
           + G+    +G     A   G +   K+ Y    +     PE          L   A +  
Sbjct: 404 YRGITVGIMGIFPYAAMDLGTFSALKKWYIARQARLTGLPEDQVTMSNMFVLLMGAFSGT 463

Query: 125 LADILLCPWEAIKVKQQT----TIPPFCKNFLEGWSKITAAEGLSGLYKGITPLWCRQIP 180
           +    + P   ++ + Q       P     F +   K    EG  GL+KG+ P   +  P
Sbjct: 464 VGATAVYPVNLLRTRLQAQGTFAHPHRYNGFRDVLLKTVQREGYQGLFKGLVPNLAKVCP 523

Query: 181 YTMCKFTSFERI 192
                +  +E +
Sbjct: 524 AVSISYLCYENL 535

>AER184W [2686] [Homologous to ScYBL030C (PET9) - SH; ScYBR085W
           (AAC3) - SH] complement(978781..979698) [918 bp, 305 aa]
          Length = 305

 Score = 33.9 bits (76), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 21/70 (30%), Positives = 34/70 (48%), Gaps = 4/70 (5%)

Query: 12  PEYYAACTLGGVVACGPTHSSVTPLDLVKCRLQVNPQL---YRSNLDGWKTIVRSEGLSK 68
             + A+  LG  V  G + +S  PLD V+ R+ +       Y    D ++ IV +EG+  
Sbjct: 212 SSFIASFLLGWAVTTGASTASY-PLDTVRRRMMMTSGQAVKYDGAFDAFRKIVAAEGVKS 270

Query: 69  VFTGVGATFI 78
           +F G GA  +
Sbjct: 271 LFKGCGANIL 280

 Score = 30.4 bits (67), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 32/162 (19%), Positives = 63/162 (38%), Gaps = 12/162 (7%)

Query: 140 QQTTIPPFCKNFLEGWSKITAAEGLSGLYKGITPLWCRQIPYTMCKFTSFERIVEMIYAK 199
           +Q ++       ++ + +  A+EG+   ++G T    R  P     F   ++I  M   +
Sbjct: 45  KQGSLDRRYNGIVDCFKRTAASEGVISFWRGNTANVIRYFPTQALNFAFKDKIKAMFGFR 104

Query: 200 LPRSKQEMSPSQQIGVSFVGGYLAGILCAVVSHPADVMVSKVNADRK--------QGESM 251
               K+    ++    +   G  AG L  +  +  D   +++ AD K        Q   +
Sbjct: 105 ----KEVDGYAKWFAGNLASGGAAGGLSLLFVYSLDYARTRLAADSKSAKKGGERQFNGL 160

Query: 252 VEASKRIYSRIGFGGLWNGLPVRIFMIGTLTSFQWLIYDSFK 293
           V+  K+  +  G  GL+ G    +  I       + +YDS K
Sbjct: 161 VDVYKKTLASDGIAGLYRGFLPSVVGIVVYRGLYFGMYDSLK 202

 Score = 29.3 bits (64), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 35/181 (19%), Positives = 68/181 (37%), Gaps = 39/181 (21%)

Query: 12  PEYYAACTLGGVVACGPTHSSVTPLDLVKCRLQVNPQ--------LYRSNLDGWKTIVRS 63
            +++A     G  A G +   V  LD  + RL  + +         +   +D +K  + S
Sbjct: 111 AKWFAGNLASGGAAGGLSLLFVYSLDYARTRLAADSKSAKKGGERQFNGLVDVYKKTLAS 170

Query: 64  EGLSKVFTGVGATFIGYSLQGACKYGGYEYFKQTYSNLLSPETAHRHRTAVYLCASASAE 123
           +G++ ++ G   + +G  +     +G Y+  K                  + L  +  + 
Sbjct: 171 DGIAGLYRGFLPSVVGIVVYRGLYFGMYDSLK-----------------PLLLTGNLESS 213

Query: 124 FLADILLC------------PWEAIKVKQQTTIPPFCK--NFLEGWSKITAAEGLSGLYK 169
           F+A  LL             P + ++ +   T     K     + + KI AAEG+  L+K
Sbjct: 214 FIASFLLGWAVTTGASTASYPLDTVRRRMMMTSGQAVKYDGAFDAFRKIVAAEGVKSLFK 273

Query: 170 G 170
           G
Sbjct: 274 G 274

>Sklu_2127.4 , Contig c2127 6322-7293
          Length = 323

 Score = 33.1 bits (74), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 61/266 (22%), Positives = 102/266 (38%), Gaps = 41/266 (15%)

Query: 35  PLDLVKCRLQV-----NPQLYRSNLDGWKTIVRSEGLSKVFTGVGATFIGYSLQGACKYG 89
           PL  +  +LQ      N Q+ +S L+  K I R +GL   + G+ +   G +L     Y 
Sbjct: 33  PLVTITTKLQTQGNDENNQV-KSKLETIKEIYRKDGLLGFYAGLESAIYGMALTNFVYYY 91

Query: 90  GYEYFKQTYSNLLSPETAHRHRTAVYLCASASAEFLADILLCP-WEAIKVKQQTTIPPFC 148
            YE    T  N+L      +  T   +     A  +  I   P W A     + T+    
Sbjct: 92  FYEL---TSRNVLKVRKHKKLNTLESMLTGCVAGSVTAIASNPIWVA---NTRMTVTKSE 145

Query: 149 KNFLEGWSKITAAEGLSGLYKGITPLWCRQIPYTMCKFTSFERIVEMIYAKLPRSKQE-M 207
           K  L    +I   +    L+ G+ P     +   + ++T FE++  ++   L  +KQ  +
Sbjct: 146 KTALATIIEIVKKDSAKTLFNGLKPALVL-VMNPIVQYTVFEQLKNLV---LAWNKQGIL 201

Query: 208 SPSQQIGVSFVGGYLAGILCAVVS------------------HPADVMVSKVNADRKQGE 249
           SPS     +F+ G L G L A  S                  H  D    K    +   +
Sbjct: 202 SPSW----AFLLGAL-GKLAATGSTYPYITLKTRMHLSESGKHTDDDSGKKAKGHKASSK 256

Query: 250 SMVEASKRIYSRIGFGGLWNGLPVRI 275
           SM+     I  + G  GL+ G+ +++
Sbjct: 257 SMLSLITEIVKKDGVSGLYRGVGIKL 282

>YBL030C (PET9) [164] chr2 complement(163006..163962) ADP/ATP
           carrier protein of the mitochondrial carrier family
           (MCF) of membrane transporters [957 bp, 318 aa]
          Length = 318

 Score = 32.0 bits (71), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 33/162 (20%), Positives = 60/162 (37%), Gaps = 13/162 (8%)

Query: 140 QQTTIPPFCKNFLEGWSKITAAEGLSGLYKGITPLWCRQIPYTMCKFTSFERIVEMIYAK 199
           +Q T+       L+ + +    EG+   ++G T    R  P     F   ++I  M    
Sbjct: 59  KQGTLDRKYAGILDCFKRTATQEGVISFWRGNTANVIRYFPTQALNFAFKDKIKAMF--- 115

Query: 200 LPRSKQEMSPSQQIGVSFVGGYLAGILCAVVSHPADVMVSKVNADRK--------QGESM 251
               K+E   ++    +   G  AG L  +  +  D   +++ AD K        Q   +
Sbjct: 116 --GFKKEEGYAKWFAGNLASGGAAGALSLLFVYSLDYARTRLAADSKSSKKGGARQFNGL 173

Query: 252 VEASKRIYSRIGFGGLWNGLPVRIFMIGTLTSFQWLIYDSFK 293
           ++  K+     G  GL+ G    +  I       + +YDS K
Sbjct: 174 IDVYKKTLKSDGVAGLYRGFLPSVVGIVVYRGLYFGMYDSLK 215

 Score = 31.6 bits (70), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 33/68 (48%), Gaps = 4/68 (5%)

Query: 14  YYAACTLGGVVACGPTHSSVTPLDLVKCRLQVNPQL---YRSNLDGWKTIVRSEGLSKVF 70
           + A+  LG VV  G +  S  PLD V+ R+ +       Y    D  + IV +EG+  +F
Sbjct: 227 FLASFLLGWVVTTGASTCSY-PLDTVRRRMMMTSGQAVKYDGAFDCLRKIVAAEGVGSLF 285

Query: 71  TGVGATFI 78
            G GA  +
Sbjct: 286 KGCGANIL 293

>Scas_705.9
          Length = 323

 Score = 31.6 bits (70), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 33/135 (24%), Positives = 56/135 (41%), Gaps = 7/135 (5%)

Query: 149 KNFLEGWSKITAAEGLSGLYKGITPLWCRQIPYTMCKFTSFERIVEMIYA-KLPRSKQEM 207
           +N +    +I    GL GLY+G++     +   + C F  +  +    ++ KL R+ Q  
Sbjct: 54  ENVIRCLIRIFRKRGLRGLYQGMSTSVFSKFVQSFCYFFWYSFLRRKYFSLKLLRNTQA- 112

Query: 208 SPSQQIGV--SFVGGYLAGILCAVVSHPADVMVSKVN-ADRKQGESMVEASKRIY--SRI 262
            P   I      + G  A  L  VV++P +V+++K    D K         K+IY  S  
Sbjct: 113 RPINSISTVEELIVGVGAAALTQVVNNPIEVILTKQQTTDDKDNVDFYSVLKQIYVESNG 172

Query: 263 GFGGLWNGLPVRIFM 277
                W G  V + +
Sbjct: 173 KLSSYWKGFKVSLIL 187

 Score = 28.9 bits (63), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 18/76 (23%), Positives = 34/76 (44%), Gaps = 15/76 (19%)

Query: 216 SFVGGYLAGILCAVVSHPADVMVSKVNADRKQGES--MVEASKRI-------------YS 260
           S + G +A  +  V+ +P DV  + + ++ K  E+  + E  KRI             + 
Sbjct: 6   SAITGAIASTMANVIVYPLDVAKTVIQSETKAKETDELSEKDKRILRQENVIRCLIRIFR 65

Query: 261 RIGFGGLWNGLPVRIF 276
           + G  GL+ G+   +F
Sbjct: 66  KRGLRGLYQGMSTSVF 81

>CAGL0B03883g 383602..384522 weakly similar to sp|P32331
           Saccharomyces cerevisiae YPR058w YMC1 or sp|P38087
           Saccharomyces cerevisiae YBR104w YMC2, hypothetical
           start
          Length = 306

 Score = 31.2 bits (69), Expect = 0.87,   Method: Compositional matrix adjust.
 Identities = 43/203 (21%), Positives = 72/203 (35%), Gaps = 29/203 (14%)

Query: 16  AACTLGGVVACGPTHSSVTPLDLVKCRLQVNPQLYRSNLDGWKTIVRS------------ 63
           + C + GV+A         P++L K +LQV      +   G   +V+             
Sbjct: 112 SGCIISGVMAGWTVSFIAAPVELAKAKLQVQYDAKTTKYTGPIDVVQKVFKQGMATNGIL 171

Query: 64  EGLSKVFTGVGATFIGYSLQGACKYGGYEYFKQTY---SNLLSPETAHRHRTAVYLCASA 120
            G+  ++ G+ +T I +       +G YE   Q +   +NL +P          +     
Sbjct: 172 GGVRSLYKGLISTLI-FRSNFVFWWGSYELITQWFQKNTNLSAPAIN-------FWAGGL 223

Query: 121 SAEFLADILLCPWEAIKVKQQTTIPPFCKNFLEGW----SKITAAEGLSGLYKGITPLWC 176
           SA F        + +  VKQ            + W    S I    G+ G +KG  P + 
Sbjct: 224 SASF--GFWTSAYPSDVVKQVVLCNDKYDGSFKSWRTAVSDIYRQRGIHGFFKGFLPSFL 281

Query: 177 RQIPYTMCKFTSFERIVEMIYAK 199
           R  P       +FE ++    AK
Sbjct: 282 RSFPANAAALAAFEFVLRTSGAK 304

>Scas_613.24
          Length = 177

 Score = 29.6 bits (65), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 27/57 (47%)

Query: 20  LGGVVACGPTHSSVTPLDLVKCRLQVNPQLYRSNLDGWKTIVRSEGLSKVFTGVGAT 76
           L G +A G       P+ ++K R +     Y+S  +  K I + EG+S  F G G T
Sbjct: 111 LTGAMARGLVGYITMPITILKVRYESTYYSYKSMNEAIKDIYKMEGISGFFKGFGPT 167

 Score = 28.1 bits (61), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 20/65 (30%), Positives = 29/65 (44%), Gaps = 1/65 (1%)

Query: 116 LCASASAEFLADILLCPWEAIKVKQQTTIPPFCKNFLEGWSKITAAEGLSGLYKGITPLW 175
           L   A A  L   +  P   +KV+ ++T   + K+  E    I   EG+SG +KG  P  
Sbjct: 110 LLTGAMARGLVGYITMPITILKVRYESTYYSY-KSMNEAIKDIYKMEGISGFFKGFGPTV 168

Query: 176 CRQIP 180
              IP
Sbjct: 169 GIGIP 173

>YBR104W (YMC2) [293] chr2 (449624..450613) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters [990 bp, 329 aa]
          Length = 329

 Score = 29.6 bits (65), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 18/68 (26%), Positives = 30/68 (44%), Gaps = 3/68 (4%)

Query: 132 PWEAIK--VKQQTTIPPFCKNFLEGWSK-ITAAEGLSGLYKGITPLWCRQIPYTMCKFTS 188
           P + +K  ++      P  KN +   +K I A EG+   +KG  P   R  P     F +
Sbjct: 259 PLDVVKSIIQNDDLRKPKYKNSISYVAKTIYAKEGIRAFFKGFGPTMVRSAPVNGATFLT 318

Query: 189 FERIVEMI 196
           FE ++  +
Sbjct: 319 FELVMRFL 326

>CAGL0M04565g complement(499618..501930) similar to tr|Q12168
           Saccharomyces cerevisiae YLR144c ACF2 or sp|P53753
           Saccharomyces cerevisiae YNR067c, start by similarity
          Length = 770

 Score = 29.6 bits (65), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 24/44 (54%), Gaps = 1/44 (2%)

Query: 217 FVGGYLAGI-LCAVVSHPADVMVSKVNADRKQGESMVEASKRIY 259
           F G +L G   CA  +HP  V +SK NA      + V AS+R++
Sbjct: 114 FYGNFLLGSQTCATWTHPYSVWISKDNAFPGFAANHVRASQRVF 157

>Scas_328.1
          Length = 227

 Score = 28.9 bits (63), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 20/70 (28%), Positives = 33/70 (47%), Gaps = 4/70 (5%)

Query: 10  FSPEYYAACTLGGVVACGPTHSSVTPLDLVKCRLQVNPQL---YRSNLDGWKTIVRSEGL 66
           F   +  +  LG  V    + +S  PLD V+ R+ +       Y+  +D ++ IV  EG+
Sbjct: 132 FENAFLPSFLLGWAVTISASTTSY-PLDTVRRRMMMTSGQAVKYKGAIDCFQQIVSQEGV 190

Query: 67  SKVFTGVGAT 76
             +F G GA 
Sbjct: 191 YSLFKGCGAN 200

>Kwal_33.14546
          Length = 317

 Score = 29.3 bits (64), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 21/75 (28%), Positives = 34/75 (45%), Gaps = 8/75 (10%)

Query: 1  MSTKQPIPLFSPEYYAACTLGGVVACGPTHSSVTPLDLVKCRLQVNPQLYRSNLDGWKTI 60
          + +K P+PL S    +   + GV      H +V  +D    R+ + PQ Y  ++D   T+
Sbjct: 9  ICSKTPLPLCSVVKSSKHLVMGV------HQAVQDVDTKDLRIGILPQCYARSIDVANTV 62

Query: 61 VRSEGLSKVFTGVGA 75
          V   G    F  +GA
Sbjct: 63 VFQIG--NAFVNIGA 75

>Scas_706.2*
          Length = 190

 Score = 28.5 bits (62), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 17/61 (27%), Positives = 30/61 (49%), Gaps = 6/61 (9%)

Query: 233 PADVMVSKVNADRKQGESMVEASKRIYSRIGFGGLWNGLPVRIFMI------GTLTSFQW 286
           P  ++ +K++A     E+ +  +  + +   +GG  N  PV +FM       G L +FQW
Sbjct: 126 PFVILGNKIDAPTAVSEAELRNALGLNNTTNYGGAQNQRPVELFMCSVVTRNGYLEAFQW 185

Query: 287 L 287
           L
Sbjct: 186 L 186

>Sklu_2443.10 YJR133W, Contig c2443 23259-23900 reverse complement
          Length = 213

 Score = 28.9 bits (63), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 13/25 (52%), Positives = 18/25 (72%), Gaps = 1/25 (4%)

Query: 121 SAEFLADILLC-PWEAIKVKQQTTI 144
           +AE + D  LC PWEAI ++Q TT+
Sbjct: 182 AAETVPDKWLCYPWEAIDIEQHTTL 206

>KLLA0E22880g complement(2033077..2034387) similar to
           ca|CA2800|IPF11366 Candida albicans unknown function,
           hypothetical start
          Length = 436

 Score = 28.5 bits (62), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 27/58 (46%), Gaps = 5/58 (8%)

Query: 219 GGYLAGILCAVVSHPADVMVSKVNADRKQGESMVEASKRIYSR-----IGFGGLWNGL 271
            G+LAG   A+VS P D + ++ N D     +    +  +YSR     IG  G + G 
Sbjct: 166 AGFLAGAAQAIVSAPIDAIYTRANIDELLSSAKKYDNLWLYSRDKIREIGLIGCFGGF 223

>KLLA0F08547g 796328..797254 similar to sp|Q04013 Saccharomyces
           cerevisiae YMR241w YHM2 yeast suppressor gene of HM
           (mitochondrial histone) mutant (ABF2) singleton, start
           by similarity
          Length = 308

 Score = 28.5 bits (62), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 37/171 (21%), Positives = 62/171 (36%), Gaps = 14/171 (8%)

Query: 15  YAACTLGGVVACGPTHSSVTPLDLVKCRLQVNPQLYRSNLDG--------WKTIVRSEGL 66
           + A  +GGV   G    +   +    C   V    ++S   G        +K I   EG+
Sbjct: 105 FGAGIMGGV--SGGVAQAYLTMGFCTCMKTVEITKHKSAAAGAKQSSWAAFKEIYNKEGI 162

Query: 67  SKVFTGVGATFIGYSLQGACKYGGYEYFKQTYSNLLSPETAHRHRTAVYLCASASAEFLA 126
             +  GV A  I        ++G     ++               TA+    +++     
Sbjct: 163 RGINKGVNAVAIRQMTNWGSRFGFSRLVEEGLRKFTGKTNPDDKLTALEKIFASAIGGGL 222

Query: 127 DILLCPWEAIKVKQQ--TTIPPFCKNFLEG--WSKITAAEGLSGLYKGITP 173
                P E I+V+ Q  T  P   K+   G  +  I  + G+ GLY+G+TP
Sbjct: 223 SAWNQPIEVIRVEMQSKTNDPNRPKDLTVGKAFRYIYQSNGVKGLYRGVTP 273

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.322    0.137    0.431 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 9,358,063
Number of extensions: 364242
Number of successful extensions: 1682
Number of sequences better than 10.0: 209
Number of HSP's gapped: 1255
Number of HSP's successfully gapped: 432
Length of query: 302
Length of database: 16,596,109
Length adjustment: 101
Effective length of query: 201
Effective length of database: 13,099,691
Effective search space: 2633037891
Effective search space used: 2633037891
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 61 (28.1 bits)