Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Sklu_2260.426926911321e-158
Kwal_47.181722732795701e-72
KLLA0F27555g2792215449e-69
ADL084W2332805149e-65
Scas_704.423112274991e-61
YIL044C (AGE2)2982924816e-59
CAGL0L00825g2652864385e-53
Kwal_33.131018731142012e-17
Scas_685.258771101905e-16
KLLA0D18942g3571121861e-15
Kwal_23.4569370791861e-15
AFR725C8731111871e-15
Sklu_2181.34141251842e-15
ACL055W4711201842e-15
Scas_677.6357781833e-15
Scas_707.333961351833e-15
ABL164C360781823e-15
Sklu_2267.43591551814e-15
KLLA0E06787g515831808e-15
YDR524C (AGE1)4821151808e-15
CAGL0G05445g354781781e-14
CAGL0G03707g4861631772e-14
Kwal_47.172483111271743e-14
YDL226C (GCS1)352781726e-14
AGL279C451821736e-14
Kwal_27.10676466841737e-14
CAGL0H01617g3491401727e-14
YGL181W (GTS1)3961221657e-13
Scas_672.9485821658e-13
CAGL0L06028g5051341649e-13
YNL204C (SPS18)300951611e-12
YER122C (GLO3)493831595e-12
Scas_602.104471001542e-11
KLLA0C17138g3831231514e-11
CAGL0F03795g48459720.42
KLLA0B08679g36366710.45
YGL116W (CDC20)61026643.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Sklu_2260.4
         (269 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Sklu_2260.4 YIL044C, Contig c2260 5970-6779                           440   e-158
Kwal_47.18172                                                         224   1e-72
KLLA0F27555g complement(2554571..2555410) some similarities with...   214   9e-69
ADL084W [1657] [Homologous to ScYIL044C (AGE2) - SH] complement(...   202   9e-65
Scas_704.42                                                           196   1e-61
YIL044C (AGE2) [2623] chr9 complement(272949..273845) GTPase-act...   189   6e-59
CAGL0L00825g complement(102709..103506) similar to sp|P40529 Sac...   173   5e-53
Kwal_33.13101                                                          82   2e-17
Scas_685.25                                                            78   5e-16
KLLA0D18942g 1594560..1595633 similar to sp|P35197 Saccharomyces...    76   1e-15
Kwal_23.4569                                                           76   1e-15
AFR725C [3918] [Homologous to ScYDR524C (AGE1) - SH] (1771660..1...    77   1e-15
Sklu_2181.3 YGL181W, Contig c2181 6465-7709                            75   2e-15
ACL055W [994] [Homologous to ScYGL181W (GTS1) - SH] complement(2...    75   2e-15
Scas_677.6                                                             75   3e-15
Scas_707.33                                                            75   3e-15
ABL164C [428] [Homologous to ScYDL226C (GCS1) - SH; ScYNL204C (S...    75   3e-15
Sklu_2267.4 YDL226C, Contig c2267 4691-5770 reverse complement         74   4e-15
KLLA0E06787g 618131..619678 similar to sp|P38682 Saccharomyces c...    74   8e-15
YDR524C (AGE1) [1336] chr4 complement(1487530..1488978) ADP-ribo...    74   8e-15
CAGL0G05445g complement(514769..515833) similar to sp|P35197 Sac...    73   1e-14
CAGL0G03707g complement(355469..356929) similar to sp|P38682 Sac...    73   2e-14
Kwal_47.17248                                                          72   3e-14
YDL226C (GCS1) [649] chr4 complement(51116..52174) GTPase-activa...    71   6e-14
AGL279C [4033] [Homologous to ScYER122C (GLO3) - SH] (182187..18...    71   6e-14
Kwal_27.10676                                                          71   7e-14
CAGL0H01617g 157279..158328 similar to tr|Q04412 Saccharomyces c...    71   7e-14
YGL181W (GTS1) [1810] chr7 (157910..159100) Putative zinc-finger...    68   7e-13
Scas_672.9                                                             68   8e-13
CAGL0L06028g complement(675584..677101) weakly similar to sp|P40...    68   9e-13
YNL204C (SPS18) [4399] chr14 complement(258374..259276) Sporulat...    67   1e-12
YER122C (GLO3) [1552] chr5 complement(402867..404348) GTPase-act...    66   5e-12
Scas_602.10                                                            64   2e-11
KLLA0C17138g 1497245..1498396 some similarities with sp|P40956 S...    63   4e-11
CAGL0F03795g complement(368904..370358) similar to sp|Q03652 Sac...    32   0.42 
KLLA0B08679g 767808..768899 weakly similar to sgd|S0005415 Sacch...    32   0.45 
YGL116W (CDC20) [1869] chr7 (289810..291642) Activator of anapha...    29   3.9  

>Sklu_2260.4 YIL044C, Contig c2260 5970-6779
          Length = 269

 Score =  440 bits (1132), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 222/269 (82%), Positives = 222/269 (82%)

Query: 1   MSSPQVKKVLATLLRDPDNARCADCKVSSHPRWCSWSLGVFVCIKCAGIHRSLGTHISKV 60
           MSSPQVKKVLATLLRDPDNARCADCKVSSHPRWCSWSLGVFVCIKCAGIHRSLGTHISKV
Sbjct: 1   MSSPQVKKVLATLLRDPDNARCADCKVSSHPRWCSWSLGVFVCIKCAGIHRSLGTHISKV 60

Query: 61  KSVDLDTWQEQHLQQVIRWGNNKRANLYYEAKLQGSHTPDPSKLQSFIRTKYELKKWCGE 120
           KSVDLDTWQEQHLQQVIRWGNNKRANLYYEAKLQGSHTPDPSKLQSFIRTKYELKKWCGE
Sbjct: 61  KSVDLDTWQEQHLQQVIRWGNNKRANLYYEAKLQGSHTPDPSKLQSFIRTKYELKKWCGE 120

Query: 121 ADEVLSATETTTAPNPVAETAPPALVREFSTGIPATTAPPVXXXXXXXXXXXXXXXXXXX 180
           ADEVLSATETTTAPNPVAETAPPALVREFSTGIPATTAPPV                   
Sbjct: 121 ADEVLSATETTTAPNPVAETAPPALVREFSTGIPATTAPPVTTSSTSSSCSSSLLDLNLT 180

Query: 181 PVASSTQQRVTHTHSYSTRPELKKSILSLYAKPKVTQSAPSLRDXXXXXXXXXXXPLXXX 240
           PVASSTQQRVTHTHSYSTRPELKKSILSLYAKPKVTQSAPSLRD           PL   
Sbjct: 181 PVASSTQQRVTHTHSYSTRPELKKSILSLYAKPKVTQSAPSLRDTSTAAAATSAAPLNGN 240

Query: 241 XXXXXXXXXXXXXXDLALEDNELFKNVWS 269
                         DLALEDNELFKNVWS
Sbjct: 241 YSNSNAWNSSNNSSDLALEDNELFKNVWS 269

>Kwal_47.18172
          Length = 273

 Score =  224 bits (570), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 125/279 (44%), Positives = 151/279 (54%), Gaps = 16/279 (5%)

Query: 1   MSSPQVKKVLATLLRDPDNARCADCKVSSHPRWCSWSLGVFVCIKCAGIHRSLGTHISKV 60
           MSSP VKKVL+ LLRDP N  CADCK + HPRW SWSLGVF+CI+CAGIHRSLGTHISKV
Sbjct: 1   MSSPAVKKVLSALLRDPANGTCADCKTAGHPRWASWSLGVFICIRCAGIHRSLGTHISKV 60

Query: 61  KSVDLDTWQEQHLQQVIRWGNNKRANLYYEAKLQGSHTPDPSKLQSFIRTKYELKKWCGE 120
           KSVDLDTWQE+HL++V+ +GNN  AN  YE KL G+HTPD SKL  FIR+KYELKKW G 
Sbjct: 61  KSVDLDTWQEEHLRKVVEFGNNAAANAVYECKLSGNHTPDASKLSDFIRSKYELKKWLGS 120

Query: 121 ADEVLSATETTTAPNPVAETAPPALVREFSTGIPATTAPPVXXXXXXXXXXXXXXXXXX- 179
           +    +AT   +  N V   + P   +E +     T                        
Sbjct: 121 S---ANATTPASGSNSVVTNSKPERTQEKTQVSQQTHNSQTSLLSQTTSVSIGSGSSSQV 177

Query: 180 --------XPVASSTQQRVTHTHSYSTRPELKKSILSLYAKPKVTQ-SAPSLRDXXXXXX 230
                    P  ++T Q        + RP+LKKSILSLY++P+ +  S  S         
Sbjct: 178 DLNLAPPRAPTRTTTSQAA---RELNGRPDLKKSILSLYSRPRASATSVASGASNISLGS 234

Query: 231 XXXXXPLXXXXXXXXXXXXXXXXXDLALEDNELFKNVWS 269
                                     +LEDNELFKNVWS
Sbjct: 235 STGNSSNSTPGANFSVPAGSNTTASASLEDNELFKNVWS 273

>KLLA0F27555g complement(2554571..2555410) some similarities with
           sp|P40529 Saccharomyces cerevisiae YIL044c AGE2,
           hypothetical start
          Length = 279

 Score =  214 bits (544), Expect = 9e-69,   Method: Compositional matrix adjust.
 Identities = 118/221 (53%), Positives = 143/221 (64%), Gaps = 12/221 (5%)

Query: 1   MSSPQVKKVLATLLRDPDNARCADCKVSSHPRWCSWSLGVFVCIKCAGIHRSLGTHISKV 60
           M+S +VKKVL TLLRDP+N RC DCKV++HPRW SWSLGVFVCIKCAG HRS+GTHISKV
Sbjct: 1   MTSVEVKKVLTTLLRDPENNRCGDCKVATHPRWASWSLGVFVCIKCAGFHRSMGTHISKV 60

Query: 61  KSVDLDTWQEQHLQQVIRWGNNKRANLYYEAKL-QGSHTPDPSKLQSFIRTKYELKKWCG 119
           KSVDLDTW E+HL+ V+ +GNNK+ N YYE KL  G++ PD SK+  FIRTKYELKKW G
Sbjct: 61  KSVDLDTWTEEHLEAVLEFGNNKKFNEYYENKLGGGTYVPDQSKIGQFIRTKYELKKWVG 120

Query: 120 EAD--EVLSATETTTAPNPVAETAPPALVREFSTGIPATTAPPVXXXXXXXXXXXXXXXX 177
           +    +V S+  T  A + VA+ A  A VR        ++  P                 
Sbjct: 121 DDPIVDVKSSKHTAEAKDRVAQKA--AAVRN-----SPSSDSPRSLDLDLGLNLNSVVTD 173

Query: 178 XXXPVASSTQQRVTHTHSYS--TRPELKKSILSLYAKPKVT 216
              P  SS +   T+T+ Y    RP+LKKSILSLYA  K T
Sbjct: 174 KNVPQISSEKPSATNTNVYRPPDRPDLKKSILSLYANRKST 214

>ADL084W [1657] [Homologous to ScYIL044C (AGE2) - SH]
           complement(536243..536944) [702 bp, 233 aa]
          Length = 233

 Score =  202 bits (514), Expect = 9e-65,   Method: Compositional matrix adjust.
 Identities = 119/280 (42%), Positives = 151/280 (53%), Gaps = 58/280 (20%)

Query: 1   MSSPQVKKVLATLLRDPDNARCADCKVSSHPRWCSWSLGVFVCIKCAGIHRSLGTHISKV 60
           M+S +V++VL  LLRDP N +CADCK S+HPRW SWSLGVFVCI+CAG HRSLGTH+SKV
Sbjct: 1   MTSVEVRRVLEQLLRDPCNQQCADCKNSAHPRWASWSLGVFVCIRCAGFHRSLGTHVSKV 60

Query: 61  KSVDLDTWQEQHLQQVIRWGNNKRANLYYEAKL-QGSHTPDPSKLQSFIRTKYELKKWCG 119
           KSVDLDTW+E+HLQQV+R+GNN++AN  +E +L  GS+ PD SK+  FI+TKYE++KW  
Sbjct: 61  KSVDLDTWKEEHLQQVVRFGNNQQANKVFEGRLGGGSYVPDQSKMGQFIKTKYEVRKWYL 120

Query: 120 EADEVLSATETTTAPNPVAE-----TAPPALVREFSTG-----IPATTAPPVXXXXXXXX 169
           E      A                  +P  + RE S        PA  +PPV        
Sbjct: 121 EEGACEPALPEAAPAAASPLPVSVPMSPAGVGREASASPALAVSPAPASPPV-------- 172

Query: 170 XXXXXXXXXXXPVASSTQQRVTHTHSYSTRPELKKSILSLYAKPKVTQSAPSLRDXXXXX 229
                                   +S + RP+LKKSILSLYAKP+  Q +P +       
Sbjct: 173 ------------------------YSANARPDLKKSILSLYAKPR--QQSPGVAS----- 201

Query: 230 XXXXXXPLXXXXXXXXXXXXXXXXXDLALEDNELFKNVWS 269
                                      +LEDNELFKNVW+
Sbjct: 202 --------SASSLNSAAASAGVSYSAASLEDNELFKNVWT 233

>Scas_704.42
          Length = 311

 Score =  196 bits (499), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 112/227 (49%), Positives = 134/227 (59%), Gaps = 18/227 (7%)

Query: 2   SSPQVKKVLATLLRDPDNARCADCKVSSHPRWCSWSLGVFVCIKCAGIHRSLGTHISKVK 61
           +SP VKK L  LLRDP N+ CADCK+ SHPRW SWSLGVFVCIKCAG+HRSLGTHI+KVK
Sbjct: 3   TSPSVKKALTALLRDPGNSNCADCKLQSHPRWASWSLGVFVCIKCAGVHRSLGTHITKVK 62

Query: 62  SVDLDTWQEQHLQQVIRWGNNKRANLYYEAKLQGSHT-----PDPSKLQSFIRTKYELKK 116
           SVDLDTW+E+HL+ +I+  NN  AN YYEA L  S +      D +KLQ FIRTKYELKK
Sbjct: 63  SVDLDTWKEEHLEMLIKMRNNVEANRYYEANLPDSSSLKNGITDTNKLQLFIRTKYELKK 122

Query: 117 WCGEADEV----LSATETTTAPNPVAETAPPALVREFSTGIPATTAPPVXXXXXXXXXXX 172
           W G   EV    +S T    A   +  T+ P         I +     V           
Sbjct: 123 WVGTPREVSEPPMSTTHEQVAKLSLESTSNPNSNSSSLLDIGSAAKKSV---SANTNLKS 179

Query: 173 XXXXXXXXPVASSTQQRVTHTHSYST------RPELKKSILSLYAKP 213
                   P  S+   + TH+H+  T      RP+LKKSILSLY+KP
Sbjct: 180 TSLLNLATPSNSTEHVKKTHSHNERTDRVVTQRPDLKKSILSLYSKP 226

 Score = 28.1 bits (61), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 10/12 (83%), Positives = 12/12 (100%)

Query: 258 LEDNELFKNVWS 269
           LEDN+LFKNVW+
Sbjct: 300 LEDNDLFKNVWT 311

>YIL044C (AGE2) [2623] chr9 complement(272949..273845)
           GTPase-activating protein for Arf1p, has overlapping
           function with Gcs1p in transport from the trans-Golgi
           network (TGN), involved in endocytosis [897 bp, 298 aa]
          Length = 298

 Score =  189 bits (481), Expect = 6e-59,   Method: Compositional matrix adjust.
 Identities = 117/292 (40%), Positives = 150/292 (51%), Gaps = 28/292 (9%)

Query: 6   VKKVLATLLRDPDNARCADCKVSSHPRWCSWSLGVFVCIKCAGIHRSLGTHISKVKSVDL 65
           VKK L+ LLRDP N+ CADCK   HPRW SWSLGVF+CIKCAGIHRSLGTHISKVKSVDL
Sbjct: 7   VKKALSALLRDPGNSHCADCKAQLHPRWASWSLGVFICIKCAGIHRSLGTHISKVKSVDL 66

Query: 66  DTWQEQHLQQVIRWGNNKRANLYYEA----KLQGSHTPDPSKLQSFIRTKYELKKWCGEA 121
           DTW+E+HL ++I++ NN RAN YYEA    +L+     D S LQ+FI+ KYE KKW G+ 
Sbjct: 67  DTWKEEHLVKLIQFKNNLRANSYYEATLADELKQRKITDTSSLQNFIKNKYEYKKWIGDL 126

Query: 122 DEVLSATETT--TAPNPVAETAPP---ALVREFSTGIPAT-TAPP--------------- 160
             +    ++T      P A  + P   A + + S  +  T T PP               
Sbjct: 127 SSIEGLNDSTEPVLHKPSANHSLPASNARLDQSSNSLQKTQTQPPSHLLSTSRSNTSLLN 186

Query: 161 VXXXXXXXXXXXXXXXXXXXPVASSTQQRVTHTHSYSTRPELKKSILSLYAKPKV-TQSA 219
           +                    + ++  +       +  R +LKKSILSLY+KP   TQS 
Sbjct: 187 LQVSSLSKTTSNTSVTSSATSIGAANTKTGNRVGEFGQRNDLKKSILSLYSKPSAQTQSQ 246

Query: 220 PSLRDXXXXXXXXXXXPLXXX--XXXXXXXXXXXXXXDLALEDNELFKNVWS 269
            S              P                    +++L+DNELFKNVWS
Sbjct: 247 NSFFTSTTPQPCNTPSPFVNTGITATNNNSMNSNSSSNISLDDNELFKNVWS 298

>CAGL0L00825g complement(102709..103506) similar to sp|P40529
           Saccharomyces cerevisiae YIL044c AGE2, hypothetical
           start
          Length = 265

 Score =  173 bits (438), Expect = 5e-53,   Method: Compositional matrix adjust.
 Identities = 110/286 (38%), Positives = 139/286 (48%), Gaps = 38/286 (13%)

Query: 1   MSSPQVKKVLATLLRDPDNARCADCKVSSHPRWCSWSLGVFVCIKCAGIHRSLGTHISKV 60
           M+S  VKK L TLLRDP NA CADCK  SHPRW SWSLGVF+CIKCAG+HRSLGTHISKV
Sbjct: 1   MTSVPVKKALTTLLRDPGNASCADCKSQSHPRWASWSLGVFICIKCAGVHRSLGTHISKV 60

Query: 61  KSVDLDTWQEQHLQQVIRWGNNKRANLYYEAKLQGSHTPDPSK------------LQSFI 108
           KSVDLDTW+E+HL+++++  NN  AN  YEAKL     PD SK            LQ FI
Sbjct: 61  KSVDLDTWKEEHLKELVQMRNNVNANRVYEAKL-----PDSSKFNGKSLGNDINLLQEFI 115

Query: 109 RTKYELKKWCGEADEVLSATETTTAPNPVAETAPPALVR-----EFSTGIPATTAPPVXX 163
           R KYE K+W   + ++       +  N  + +    +         +  +     P    
Sbjct: 116 RQKYERKRWMDSSVDLSRDQPVVSQANSSSSSLVSTMSSSNESTNNTVAVEEKLKPQSTH 175

Query: 164 XXXXXXXXXXXXXXXXXPVASSTQQRVTHTHSYSTRPELKKSILSLYAKPKVTQSAPSLR 223
                              A  TQQ          R +LKKSILSLY+    ++S  +  
Sbjct: 176 SSSLLNLQGRKEIVENKRPARPTQQDTPQ------RNDLKKSILSLYSSANASKSNNN-S 228

Query: 224 DXXXXXXXXXXXPLXXXXXXXXXXXXXXXXXDLALEDNELFKNVWS 269
                       P                   L+++D+ELFKNVWS
Sbjct: 229 TMNVSSGMGMTTPFNTTPQNNSS---------LSIDDDELFKNVWS 265

>Kwal_33.13101
          Length = 873

 Score = 82.0 bits (201), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 42/114 (36%), Positives = 66/114 (57%), Gaps = 9/114 (7%)

Query: 16  DPDNARCADCKVSSHPRWCSWSLGVFVCIKCAGIHRSLGTHISKVKSVDLDTWQEQHLQQ 75
           D  N  C DC  S+   W S +L   +CI+C+ +HRSLG+HISKV+S+ LD++  + +++
Sbjct: 575 DASNTTCCDCGDSNQVEWISINLLCVLCIQCSAVHRSLGSHISKVRSLLLDSFTSREIKE 634

Query: 76  VIRWGNNKRANLYYEAKLQ------GSHTPDPSKLQSFIRTKYELKKWCGEADE 123
           ++++ +NK  N  YEA+L       GS   D ++   FI  KY  KK+     E
Sbjct: 635 LLKYVSNKNLNSIYEAELTQKSIIPGSSVADRTR---FITDKYVSKKYVSPLQE 685

>Scas_685.25
          Length = 877

 Score = 77.8 bits (190), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 39/110 (35%), Positives = 60/110 (54%), Gaps = 7/110 (6%)

Query: 17  PDNARCADCKVSSHP-RWCSWSLGVFVCIKCAGIHRSLGTHISKVKSVDLDTWQEQHLQQ 75
           P N RC DC  S     W S +L   VCIKC+G+HRS+G HISK++S+ LD +  + +  
Sbjct: 590 PSNQRCCDCNTSDGTVEWISLNLLCLVCIKCSGVHRSMGAHISKIRSLTLDNFTSKEMIY 649

Query: 76  VIR-WGNNKRANLYYEAKLQGSHT-----PDPSKLQSFIRTKYELKKWCG 119
           +I+ + +N++ N  YE+    + T        S+   +I  KY  KK+  
Sbjct: 650 LIKNYISNEKVNSIYESGTNNTQTRISSNATDSRRSQYINDKYRFKKFIN 699

>KLLA0D18942g 1594560..1595633 similar to sp|P35197 Saccharomyces
           cerevisiae YDL226c GCS1 ADP-ribosylation factor
           GTPase-activating protein (ARF-GAP), start by similarity
          Length = 357

 Score = 76.3 bits (186), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 40/112 (35%), Positives = 61/112 (54%), Gaps = 2/112 (1%)

Query: 4   PQVKKVLATLLRDPDNARCADCKVSSHPRWCSWSLGVFVCIKCAGIHRSLGTHISKVKSV 63
           P  ++ L  L +   N +C DC  + +P+W S   GVF+C++CAGIHR LG HIS V+S+
Sbjct: 8   PDNRRRLLQLQKVGGNKKCLDCG-AHNPQWASPKFGVFICLECAGIHRGLGVHISFVRSI 66

Query: 64  DLDTWQEQHLQQVIRWGNNKRANLYYEAKLQGSHTPDPSKLQSFIRTKYELK 115
            +D ++   L ++   GN+K    Y E     S  P   K  + I + Y+ K
Sbjct: 67  TMDQFKSDELVRMENGGNDKFTE-YLEDHGIDSSLPQKLKYDNVIASDYKDK 117

>Kwal_23.4569
          Length = 370

 Score = 76.3 bits (186), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 29/79 (36%), Positives = 52/79 (65%), Gaps = 1/79 (1%)

Query: 3  SPQVKKVLATLLRDPDNARCADCKVSSHPRWCSWSLGVFVCIKCAGIHRSLGTHISKVKS 62
          +P  ++ L  L +   N +C DC+   +P+W S   G+F+C++CAG+HR LG HIS V+S
Sbjct: 8  NPDNRRRLLQLQKVGSNKKCVDCEAP-NPQWASPKFGIFICLECAGLHRGLGVHISFVRS 66

Query: 63 VDLDTWQEQHLQQVIRWGN 81
          + +D ++ + L+++ + GN
Sbjct: 67 ITMDQFKPEELERMEKGGN 85

>AFR725C [3918] [Homologous to ScYDR524C (AGE1) - SH]
           (1771660..1774281) [2622 bp, 873 aa]
          Length = 873

 Score = 76.6 bits (187), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 37/111 (33%), Positives = 64/111 (57%), Gaps = 2/111 (1%)

Query: 16  DPDNARCADCKVSSHPRWCSWSLGVFVCIKCAGIHRSLGTHISKVKSVDLDTWQEQHLQQ 75
           DP N+ C DC+      W S ++   VCI C+G+HRSLG H+SK++S+ LD++      Q
Sbjct: 559 DPSNSACCDCRSDKQVEWISLNILCVVCINCSGVHRSLGAHVSKMRSLTLDSFSSPESLQ 618

Query: 76  VIRWGNNKRANLYYEAKLQGSHTPDPS--KLQSFIRTKYELKKWCGEADEV 124
           +++  +N+  N  YE++      P+ S  + +S+I  KY  KK+    +++
Sbjct: 619 LLKCVSNQNVNSLYESEDLPPIFPENSIDQRKSYITDKYVSKKYVNRTEDI 669

>Sklu_2181.3 YGL181W, Contig c2181 6465-7709
          Length = 414

 Score = 75.5 bits (184), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 48/125 (38%), Positives = 65/125 (52%), Gaps = 10/125 (8%)

Query: 2   SSPQVKKVLATLLRDPDNA-RCADCKVSSHPRWCSWSLGVFVCIKCAGIHRS-LGTHI-- 57
            S  V+K L  L+  P+N  RC +C  + +P WCS +LGVF+C +CA +HR  LG     
Sbjct: 5   GSKAVEKELKDLVNLPENGNRCGECG-APYPTWCSVNLGVFLCGRCASVHRKVLGNRDDD 63

Query: 58  --SKVKSVDLDTWQEQHLQQVIRWGNNKRANLYYEAK---LQGSHTPDPSKLQSFIRTKY 112
             S VKS+ LD W+E  L  V   G N+R    +  K          D S ++ FIR KY
Sbjct: 64  AHSDVKSLTLDRWKESDLDCVNNGGGNRRNKSVWNPKDHPFPFDGDDDKSAVEKFIRDKY 123

Query: 113 ELKKW 117
            L K+
Sbjct: 124 ILGKF 128

>ACL055W [994] [Homologous to ScYGL181W (GTS1) - SH]
           complement(267925..269340) [1416 bp, 471 aa]
          Length = 471

 Score = 75.5 bits (184), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 42/120 (35%), Positives = 66/120 (55%), Gaps = 10/120 (8%)

Query: 2   SSPQVKKVLATLLRDPDNA-RCADCKVSSHPRWCSWSLGVFVCIKCAGIHRSL-----GT 55
           SS  V++ L  L+  P+NA RC +C  +++P WCS +LG F+C +CA +HR +     G 
Sbjct: 5   SSRTVERELKALVSSPENANRCGECG-ATYPTWCSVNLGAFLCGRCAAVHRKVLTGEQGG 63

Query: 56  HISKVKSVDLDTWQEQHLQQVIRWGNNKRANLYYEAK---LQGSHTPDPSKLQSFIRTKY 112
             S VKS+ LD W    L+++   G N+R +  +  +          D S+++ FIR KY
Sbjct: 64  PESHVKSLTLDRWTVDELEEITNSGGNRRNHHTWNVRNVAFPYDGDDDRSRVEDFIRNKY 123

>Scas_677.6
          Length = 357

 Score = 75.1 bits (183), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 31/78 (39%), Positives = 51/78 (65%), Gaps = 1/78 (1%)

Query: 4  PQVKKVLATLLRDPDNARCADCKVSSHPRWCSWSLGVFVCIKCAGIHRSLGTHISKVKSV 63
          P  ++ L  L +   N +C DC  + +P+W S   GVF+C++CAG HRSLG HIS V+S+
Sbjct: 8  PDTRRRLLQLQKIGANKKCVDCH-APNPQWASPKFGVFICLECAGTHRSLGVHISFVRSI 66

Query: 64 DLDTWQEQHLQQVIRWGN 81
           +D ++ + L+++ + GN
Sbjct: 67 TMDQFKPEELERMEKGGN 84

>Scas_707.33
          Length = 396

 Score = 75.1 bits (183), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 47/135 (34%), Positives = 69/135 (51%), Gaps = 20/135 (14%)

Query: 3   SPQVKKVLATLLRDPDNA-RCADCKVSSHPRWCSWSLGVFVCIKCAGIHRSLGTH----- 56
           +P ++  L  LL  P+NA +C +C  S+ P WCS +LGVF+C +CA +HR +        
Sbjct: 18  NPNIENELRDLLNAPENANKCGECG-STFPTWCSINLGVFLCGRCASVHRKILNGREDDV 76

Query: 57  ISKVKSVDLDTWQEQHLQQVIRWGNNKRANLYYEAKLQGSHTP-------DPSKLQSFIR 109
            S +KS+ LD W    +  +   G NK  + ++  K    H P       D S ++ FIR
Sbjct: 77  FSNLKSLSLDKWNNDDMDILAELGGNKGNHKFWNPK----HEPFPFDGDDDKSIVEHFIR 132

Query: 110 TKYELKKWCGEADEV 124
            KY L K+    DEV
Sbjct: 133 DKYILGKF--RYDEV 145

>ABL164C [428] [Homologous to ScYDL226C (GCS1) - SH; ScYNL204C
          (SPS18) - SH] (91566..92648) [1083 bp, 360 aa]
          Length = 360

 Score = 74.7 bits (182), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 31/78 (39%), Positives = 51/78 (65%), Gaps = 1/78 (1%)

Query: 4  PQVKKVLATLLRDPDNARCADCKVSSHPRWCSWSLGVFVCIKCAGIHRSLGTHISKVKSV 63
          P  ++ L  L +   N +CADC  + +P+W S   G+F+C++CAGIHR LG HIS V+S+
Sbjct: 8  PDNRRRLLQLQKLGGNKKCADCG-APNPQWASPKFGIFICLECAGIHRGLGVHISFVRSI 66

Query: 64 DLDTWQEQHLQQVIRWGN 81
           +D ++ + L+++   GN
Sbjct: 67 TMDQFKPEELERMEHGGN 84

>Sklu_2267.4 YDL226C, Contig c2267 4691-5770 reverse complement
          Length = 359

 Score = 74.3 bits (181), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 47/155 (30%), Positives = 78/155 (50%), Gaps = 9/155 (5%)

Query: 4   PQVKKVLATLLRDPDNARCADCKVSSHPRWCSWSLGVFVCIKCAGIHRSLGTHISKVKSV 63
           P  ++ L  L +   N +C DC  + +P+W S   G+F+C++CAGIHR LG HIS V+S+
Sbjct: 9   PDNRRRLLQLQKIGSNKKCIDCN-APNPQWASPKFGIFICLECAGIHRGLGVHISFVRSI 67

Query: 64  DLDTWQEQHLQQVIRWGNNKRANLYYEAKLQGSHTPDPSKLQSFIRTKYELKKWCGEADE 123
            +D ++ + L ++ + G N+  N Y  +       P   K  + I T Y+ K        
Sbjct: 68  TMDQFKPEELARMEK-GGNEGFNEYMSSHGVDLKLPPKVKYDNPIATDYKNK-----LTS 121

Query: 124 VLSATETTTAPNPVAETAPPALVREFSTGIPATTA 158
           ++  TE T   +P  +  P  L  EF +   A+ +
Sbjct: 122 LVEGTEWTEPEHPGFD--PHVLTAEFDSATVASAS 154

>KLLA0E06787g 618131..619678 similar to sp|P38682 Saccharomyces
          cerevisiae YER122c GLO3 zinc finger protein, start by
          similarity
          Length = 515

 Score = 73.9 bits (180), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 34/83 (40%), Positives = 48/83 (57%), Gaps = 1/83 (1%)

Query: 6  VKKVLATLLRDPDNARCADCKVSSHPRWCSWSLGVFVCIKCAGIHRSLGTHISKVKSVDL 65
          V KV A L    +N  C DC    +P W S   GV +CI C+G HR++GTHI+ VKS +L
Sbjct: 17 VTKVFARLTTKSENRACFDCGAK-NPTWTSVPFGVLLCIDCSGEHRNMGTHITFVKSSNL 75

Query: 66 DTWQEQHLQQVIRWGNNKRANLY 88
          D W   +L++    GN+K  + +
Sbjct: 76 DKWTVNNLRRFKLGGNDKAKDFF 98

>YDR524C (AGE1) [1336] chr4 complement(1487530..1488978)
           ADP-ribosylation factor (ARF) GTPase activating protein
           (GAP) with effector functions, involved in endocytosis
           and protein secretion [1449 bp, 482 aa]
          Length = 482

 Score = 73.9 bits (180), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 37/115 (32%), Positives = 63/115 (54%), Gaps = 7/115 (6%)

Query: 16  DPDNARCADCKVSSHPRWCSWSLGVFVCIKCAGIHRSLGTHISKVKSVDLDTWQEQHLQQ 75
           D  N +C DC  ++   W S +L   +CIKC+G+HRSLG+HISK++S+ LD +    L  
Sbjct: 180 DKSNLKCCDCGSTATVEWVSINLLCILCIKCSGVHRSLGSHISKIRSLTLDNFTSLELMH 239

Query: 76  VIRWGNNKRANL-YYEAKLQG------SHTPDPSKLQSFIRTKYELKKWCGEADE 123
           +++   +       YE+ L+       +   D S+   FI  KY+ KK+  ++++
Sbjct: 240 LLQNNVSNSNVNAIYESNLRNFPVKKITANSDDSERSKFIIDKYQFKKFVIDSNQ 294

>CAGL0G05445g complement(514769..515833) similar to sp|P35197
          Saccharomyces cerevisiae YDL226c GCS1 ADP-ribosylation
          factor GTPase-activating protein, start by similarity
          Length = 354

 Score = 73.2 bits (178), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 30/78 (38%), Positives = 50/78 (64%), Gaps = 1/78 (1%)

Query: 4  PQVKKVLATLLRDPDNARCADCKVSSHPRWCSWSLGVFVCIKCAGIHRSLGTHISKVKSV 63
          P  ++ L  L +   N +C DC  + +P+W S   G+F+C++CAG HRSLG HIS V+S+
Sbjct: 8  PDNRRRLLQLQKIGANKKCVDCG-APNPQWASPKFGIFICLECAGTHRSLGVHISFVRSI 66

Query: 64 DLDTWQEQHLQQVIRWGN 81
           +D ++++ L ++   GN
Sbjct: 67 TMDQFKQEELVRMEEGGN 84

>CAGL0G03707g complement(355469..356929) similar to sp|P38682
           Saccharomyces cerevisiae YER122c GLO3, hypothetical
           start
          Length = 486

 Score = 72.8 bits (177), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 49/163 (30%), Positives = 80/163 (49%), Gaps = 24/163 (14%)

Query: 7   KKVLATLLRDPDNARCADCKVSSHPRWCSWSLGVFVCIKCAGIHRSLGTHISKVKSVDLD 66
           ++V   L    +N  C DC  + +P W S   GV +CI+C+ +HR+LG HI+ VKS  LD
Sbjct: 14  QQVFTKLGSRLENRVCFDCG-NKNPTWTSVPFGVLLCIQCSAVHRNLGVHITFVKSSTLD 72

Query: 67  TWQEQHLQQVIRWGNNKRANLYY-----EAKLQGSHTPDPSKLQSFIRTKY--------- 112
            W   +L++  ++G N +A  Y+     +  L  S+    +K  S +  KY         
Sbjct: 73  KWTVNNLRR-FKYGGNHKAKEYFMKNNGKQYLNSSNVNAQAKYTSLVAKKYKAHLDSKVE 131

Query: 113 -ELKKWCGEADEVLS-----ATETTTAPNPVAETAPPALVREF 149
            +++++ GE   VL+       ET++  N VA T     V +F
Sbjct: 132 KDMQQYPGEL--VLTEMDNQGDETSSDSNSVASTPKEGSVDDF 172

>Kwal_47.17248
          Length = 311

 Score = 71.6 bits (174), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 40/127 (31%), Positives = 67/127 (52%), Gaps = 14/127 (11%)

Query: 2   SSPQVKKVLATLLRDPDNA-RCADCKVSSHPRWCSWSLGVFVCIKCAGIHRS-LGTH--- 56
            S   ++ L  +L  P+N  +C +C  ++ P WCS +LGVF+C +CA +HR+ LG     
Sbjct: 6   GSKAAERELKNILNSPENGNKCGECG-NTFPTWCSINLGVFLCGRCASVHRNILGNRDDE 64

Query: 57  -ISKVKSVDLDTWQEQHLQQVIRWGNNKRANLYYEAK-----LQGSHTPDPSKLQSFIRT 110
             S V+S+ +D W  + L ++   G N+R  + +  +       G    D S ++ F+R 
Sbjct: 65  IYSDVRSLTMDRWSTRDLDEIAESGGNRRNRMLWNPQNVPFPFDGDE--DKSAVEQFVRE 122

Query: 111 KYELKKW 117
           KY L K+
Sbjct: 123 KYVLCKF 129

>YDL226C (GCS1) [649] chr4 complement(51116..52174)
          GTPase-activating protein (GAP) for ADP-ribosylation
          factors Arf1p and Arf2p, involved in endocytosis,
          exocytosis, secretion, and mitochondrial and vacuolar
          organization, member of the Gcs1p/Glo3p/Sps18p family
          [1059 bp, 352 aa]
          Length = 352

 Score = 70.9 bits (172), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 29/78 (37%), Positives = 49/78 (62%), Gaps = 1/78 (1%)

Query: 4  PQVKKVLATLLRDPDNARCADCKVSSHPRWCSWSLGVFVCIKCAGIHRSLGTHISKVKSV 63
          P  ++ L  L +   N +C DC  + +P+W +   G F+C++CAGIHR LG HIS V+S+
Sbjct: 8  PDTRRRLLQLQKIGANKKCMDCG-APNPQWATPKFGAFICLECAGIHRGLGVHISFVRSI 66

Query: 64 DLDTWQEQHLQQVIRWGN 81
           +D ++ + L ++ + GN
Sbjct: 67 TMDQFKPEELLRMEKGGN 84

>AGL279C [4033] [Homologous to ScYER122C (GLO3) - SH]
          (182187..183542) [1356 bp, 451 aa]
          Length = 451

 Score = 71.2 bits (173), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 31/82 (37%), Positives = 49/82 (59%), Gaps = 2/82 (2%)

Query: 8  KVLATLLRDPDNARCADCKVSSHPRWCSWSLGVFVCIKCAGIHRSLGTHISKVKSVDLDT 67
          ++ + L   P+N  C DC  + +P W S   G+ +CI+C+G HR LG HI+ VKS +LD 
Sbjct: 17 EIFSKLNSKPENRTCFDCG-NKNPTWTSVPFGIMLCIQCSGEHRKLGVHITFVKSSNLDK 75

Query: 68 WQEQHLQQVIRWGNNKRANLYY 89
          W   +L++  + G N RA  ++
Sbjct: 76 WTINNLRR-FKMGGNHRAREFF 96

>Kwal_27.10676
          Length = 466

 Score = 71.2 bits (173), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 32/84 (38%), Positives = 47/84 (55%), Gaps = 1/84 (1%)

Query: 5  QVKKVLATLLRDPDNARCADCKVSSHPRWCSWSLGVFVCIKCAGIHRSLGTHISKVKSVD 64
          +  KV   L    DN  C DC  + +P W S   GV +CI+C+ +HR+LG HI+ VKS +
Sbjct: 14 ETTKVFQKLASKQDNRACFDCG-TKNPTWTSVPFGVMLCIQCSAVHRNLGVHITFVKSSN 72

Query: 65 LDTWQEQHLQQVIRWGNNKRANLY 88
          LD W   +L++    GN+K    +
Sbjct: 73 LDKWTVNNLRRFKLGGNHKAREFF 96

>CAGL0H01617g 157279..158328 similar to tr|Q04412 Saccharomyces
           cerevisiae YDR524c AGE1, hypothetical start
          Length = 349

 Score = 70.9 bits (172), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 41/140 (29%), Positives = 63/140 (45%), Gaps = 6/140 (4%)

Query: 16  DPDNARCADCKVSSHPRWCSWSLGVFVCIKCAGIHRSLGTHISKVKSVDLDTWQEQHLQQ 75
           D  N RC DC    +  W S +L   VCI+C+G+HRSLG+HISKV+S+++D        +
Sbjct: 18  DESNKRCCDCGSRHNVDWVSINLLCVVCIQCSGVHRSLGSHISKVRSLNMDDLHSNRELK 77

Query: 76  VIRWGN--NKRANLYYEAKLQGS----HTPDPSKLQSFIRTKYELKKWCGEADEVLSATE 129
            +   +  N+  N  YEA++           P+    +I  KY  KK+     +      
Sbjct: 78  YLLVNHLINRNVNSVYEARIPAGIKIRKDAQPADRARYIVDKYMHKKYVERTMQATLTNS 137

Query: 130 TTTAPNPVAETAPPALVREF 149
                  + +T    LVR  
Sbjct: 138 QMANDKDIRDTEIEDLVRHI 157

>YGL181W (GTS1) [1810] chr7 (157910..159100) Putative zinc-finger
           transcription factor of the Gcs1p/Glo3p/Sps18p family,
           involved in heat resistance, flocculation, timing of bud
           emergence, and regulation of biological rhythms [1191
           bp, 396 aa]
          Length = 396

 Score = 68.2 bits (165), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 38/122 (31%), Positives = 64/122 (52%), Gaps = 10/122 (8%)

Query: 5   QVKKVLATLLRDPDNA-RCADCKVSSHPRWCSWSLGVFVCIKCAGIHRS-LGTH----IS 58
            V + L  L+   +NA +C +C  + +P WCS +LGVF+C +CA +HR   G+      S
Sbjct: 12  HVDRELKELINSSENANKCGECG-NFYPTWCSVNLGVFLCGRCASVHRKVFGSRDDDAFS 70

Query: 59  KVKSVDLDTWQEQHLQQVIRWGNNKRANLYYEAK---LQGSHTPDPSKLQSFIRTKYELK 115
            VKS+ +D W  + + +++  G NK    ++  K          D + ++ +IR KY L 
Sbjct: 71  NVKSLSMDRWTREDIDELVSLGGNKGNARFWNPKNVPFPFDGDDDKAIVEHYIRDKYILG 130

Query: 116 KW 117
           K+
Sbjct: 131 KF 132

>Scas_672.9
          Length = 485

 Score = 68.2 bits (165), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 31/82 (37%), Positives = 47/82 (57%), Gaps = 1/82 (1%)

Query: 7  KKVLATLLRDPDNARCADCKVSSHPRWCSWSLGVFVCIKCAGIHRSLGTHISKVKSVDLD 66
          ++V   L    +N  C DC  + +P W S   GV +CI+C+ +HR+LG HI+ VKS  LD
Sbjct: 16 QQVFQKLSSKLENRVCFDCG-NKNPTWTSVPFGVMLCIQCSAVHRNLGVHITFVKSSTLD 74

Query: 67 TWQEQHLQQVIRWGNNKRANLY 88
           W   +L++    GNNK  + +
Sbjct: 75 KWTINYLRRFKLGGNNKARDFF 96

>CAGL0L06028g complement(675584..677101) weakly similar to sp|P40956
           Saccharomyces cerevisiae YGL181w GTS1, start by
           similarity
          Length = 505

 Score = 67.8 bits (164), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 42/134 (31%), Positives = 67/134 (50%), Gaps = 19/134 (14%)

Query: 6   VKKVLATLLRDPDNA-RCADCKVSSHPRWCSWSLGVFVCIKCAGIHRS-LGTH------- 56
           +   L  ++  P+N  RC +C  S+ P WCS +LGVF+C +CA +HR  LGT        
Sbjct: 16  IDGELKDIVNAPENGNRCGECG-SAVPTWCSTNLGVFLCGRCASVHRKILGTDPDEESGI 74

Query: 57  ISKVKSVDLDTWQEQHLQQVIRWGNNKRANLYYEAK-----LQGSHTPDPSKLQSFIRTK 111
            S VKS+ ++ W+ + +  V   G NK     +  K       G    D S ++ F+R K
Sbjct: 75  FSNVKSLSMERWEAEDIDSVASSGGNKGNMRKWNPKNEPFPFDGDE--DKSAVERFVREK 132

Query: 112 YELKKWCGEADEVL 125
           Y + K+    D+++
Sbjct: 133 YIIGKY--RNDQIM 144

>YNL204C (SPS18) [4399] chr14 complement(258374..259276)
           Sporulation-specific zinc finger protein involved in
           activation of sporulation, member of Gcs1p/Glo3p/Sps18p
           family of zinc-finger proteins [903 bp, 300 aa]
          Length = 300

 Score = 66.6 bits (161), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 29/95 (30%), Positives = 55/95 (57%), Gaps = 1/95 (1%)

Query: 19  NARCADCKVSSHPRWCSWSLGVFVCIKCAGIHRSLGTHISKVKSVDLDTWQEQHLQQVIR 78
           N  C +CK S +P++ S S G+F+C+ CA + R +GT+I  VKS+ +D ++E+ +++V +
Sbjct: 25  NNNCFECK-SVNPQFVSCSFGIFICVNCANLLRGMGTNIFCVKSITMDNFEEKDVRRVEK 83

Query: 79  WGNNKRANLYYEAKLQGSHTPDPSKLQSFIRTKYE 113
            GNN+  +   +  +  +  P   K  +     Y+
Sbjct: 84  SGNNRFGSFLSKNGILQNGIPLREKYDNLFAKSYK 118

>YER122C (GLO3) [1552] chr5 complement(402867..404348)
          GTPase-activating protein (GAP) for ADP-ribosylation
          factors Arf1p and Arf2p, involved in retrograde
          transport between Golgi and ER as well as endocytosis
          [1482 bp, 493 aa]
          Length = 493

 Score = 65.9 bits (159), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 29/83 (34%), Positives = 48/83 (57%), Gaps = 1/83 (1%)

Query: 6  VKKVLATLLRDPDNARCADCKVSSHPRWCSWSLGVFVCIKCAGIHRSLGTHISKVKSVDL 65
           ++V   L  + +N  C DC  + +P W S   GV +CI+C+ +HR++G HI+ VKS  L
Sbjct: 15 TQQVFQKLGSNMENRVCFDCG-NKNPTWTSVPFGVMLCIQCSAVHRNMGVHITFVKSSTL 73

Query: 66 DTWQEQHLQQVIRWGNNKRANLY 88
          D W   +L++    GN+K  + +
Sbjct: 74 DKWTINNLRRFKLGGNHKARDFF 96

>Scas_602.10
          Length = 447

 Score = 63.9 bits (154), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 31/100 (31%), Positives = 54/100 (54%), Gaps = 6/100 (6%)

Query: 21  RCADCKVSSHPRWCSWSLGVFVCIKCAGIHRSLGTH---ISKVKSVDLDTWQEQHLQQVI 77
           +C +C +  +P WCS +  +F+C +CA +H+ +  H   +S +KS+ LD W    L + I
Sbjct: 24  KCGECGLP-NPTWCSTTYNLFLCTRCATVHKKILNHDPDLSIIKSIKLDYWTNDELNKFI 82

Query: 78  RWGNNKRANLYYEAKLQGSHTPDPSKLQSFIRTKYELKKW 117
             G N     ++  K   +   D +  ++F+R KY LKK+
Sbjct: 83  NSGGNAYNKRFWNPKDIKNF--DDANWENFLRDKYILKKF 120

>KLLA0C17138g 1497245..1498396 some similarities with sp|P40956
           Saccharomyces cerevisiae YGL181w GTS1 transcription
           factor of the GCS1P/GLO3P/SPS18P family singleton,
           hypothetical start
          Length = 383

 Score = 62.8 bits (151), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 42/123 (34%), Positives = 65/123 (52%), Gaps = 14/123 (11%)

Query: 6   VKKVLATLLRDPDNA-RCADCKVSSHPRWCSWSLGVFVCIKCAGIHRS-LGTH----ISK 59
           V+  L  LL   +N+ +C +C  +  P +CS +LGVF+C +CA +HR  LG+      S 
Sbjct: 9   VEHDLKFLLNAGENSNKCGECG-TPFPTYCSVNLGVFLCGRCASVHRKVLGSREDGATSI 67

Query: 60  VKSVDLDTWQEQHLQQVIRWGNNKRANLYYEAK-----LQGSHTPDPSKLQSFIRTKYEL 114
           VKS+ LD W ++ +Q V   G NK  + ++  K       G    D + ++ FIR KY  
Sbjct: 68  VKSLSLDRWSKRDVQTVADLGGNKHNSSFWNPKKEPFPFDGDE--DRTAVEMFIRDKYLK 125

Query: 115 KKW 117
            K+
Sbjct: 126 GKF 128

>CAGL0F03795g complement(368904..370358) similar to sp|Q03652
           Saccharomyces cerevisiae YMR211w, start by similarity
          Length = 484

 Score = 32.3 bits (72), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 17/59 (28%), Positives = 31/59 (52%), Gaps = 8/59 (13%)

Query: 27  VSSHPRWCSWSLGVFVCIKCAGIHRSL-GTHISKVKSVDLDTWQEQHLQQVIRWGNNKR 84
           V S P + +W +G  VC    G++  L GT   K +++       Q+L ++++ G+N R
Sbjct: 286 VYSDPEYSNWEIGSLVCPLFDGLNSVLDGTDTEKRRNM-------QYLSELLQNGDNNR 337

>KLLA0B08679g 767808..768899 weakly similar to sgd|S0005415
           Saccharomyces cerevisiae YOL054w, start by similarity
          Length = 363

 Score = 32.0 bits (71), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 18/66 (27%), Positives = 29/66 (43%), Gaps = 9/66 (13%)

Query: 20  ARCADCKVSSHPRWCSWSLGVFVCIKCAGIHRSLGTHISKVKSVDLDTWQEQHLQQVIRW 79
           ARC++C+         W +   VC  C    R+          VD+D + +  L++V R 
Sbjct: 154 ARCSNCQ---------WEVEGPVCPNCNATIRNYNAGAQNFDEVDVDEYSDGELEEVERD 204

Query: 80  GNNKRA 85
            +N RA
Sbjct: 205 LDNYRA 210

>YGL116W (CDC20) [1869] chr7 (289810..291642) Activator of anaphase
           promoting complex (APC), required for microtubule
           function at mitosis and for exit from anaphase, contains
           WD (WD-40) repeats [1833 bp, 610 aa]
          Length = 610

 Score = 29.3 bits (64), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 13/26 (50%), Positives = 18/26 (69%)

Query: 197 STRPELKKSILSLYAKPKVTQSAPSL 222
           S RP L+ S  S+Y++PK+T  AP L
Sbjct: 58  SKRPSLQASANSIYSRPKITIGAPPL 83

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.315    0.128    0.393 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 7,258,399
Number of extensions: 250896
Number of successful extensions: 858
Number of sequences better than 10.0: 43
Number of HSP's gapped: 835
Number of HSP's successfully gapped: 50
Length of query: 269
Length of database: 16,596,109
Length adjustment: 100
Effective length of query: 169
Effective length of database: 13,134,309
Effective search space: 2219698221
Effective search space used: 2219698221
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 61 (28.1 bits)