Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Sklu_2260.352352327910.0
Kwal_47.1816352252323400.0
KLLA0F27599g52252321950.0
CAGL0J02882g53052821410.0
Scas_715.4452852921350.0
ADL086C55252520980.0
YER052C (HOM3)52752020670.0
Scas_34.1*23924012111e-166
YDL010W23188870.010
CAGL0H01441g42740740.58
Sklu_2395.979597730.87
Kwal_23.4943736164720.98
AAL061C42046674.0
CAGL0D03894g48540674.3
Scas_662.1591798656.9
Scas_538.148688649.1
KLLA0B07667g199997659.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Sklu_2260.3
         (523 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Sklu_2260.3 YER052C, Contig c2260 3320-4891 reverse complement       1079   0.0  
Kwal_47.18163                                                         905   0.0  
KLLA0F27599g 2558178..2559746 highly similar to sp|P10869 Saccha...   850   0.0  
CAGL0J02882g complement(277395..278987) highly similar to sp|P10...   829   0.0  
Scas_715.44                                                           827   0.0  
ADL086C [1655] [Homologous to ScYER052C (HOM3) - SH] (533181..53...   812   0.0  
YER052C (HOM3) [1480] chr5 complement(256374..257957) Aspartate ...   800   0.0  
Scas_34.1*                                                            471   e-166
YDL010W (YDL010W) [848] chr4 (432327..433022) Protein predicted ...    38   0.010
CAGL0H01441g complement(140740..142023) highly similar to sp|P32...    33   0.58 
Sklu_2395.9 YIL107C, Contig c2395 14041-16428                          33   0.87 
Kwal_23.4943                                                           32   0.98 
AAL061C [126] [Homologous to ScYDR300C (PRO1) - SH; ScYHR033W - ...    30   4.0  
CAGL0D03894g 389509..390966 similar to sp|P32264 Saccharomyces c...    30   4.3  
Scas_662.15                                                            30   6.9  
Scas_538.1                                                             29   9.1  
KLLA0B07667g 667863..673862 weakly similar to sp|P25356 Saccharo...    30   9.2  

>Sklu_2260.3 YER052C, Contig c2260 3320-4891 reverse complement
          Length = 523

 Score = 1079 bits (2791), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 523/523 (100%), Positives = 523/523 (100%)

Query: 1   MFEKSNWIVQKFGGTSVGKFPEQIVEQIVKVYTTQYENNVAVVCSARSSYTKAEGTTSRL 60
           MFEKSNWIVQKFGGTSVGKFPEQIVEQIVKVYTTQYENNVAVVCSARSSYTKAEGTTSRL
Sbjct: 1   MFEKSNWIVQKFGGTSVGKFPEQIVEQIVKVYTTQYENNVAVVCSARSSYTKAEGTTSRL 60

Query: 61  LNACELAANNDPTFTDVLQLVRNDHVSNAQEKIKDSTLQQKLVKDTNAELDLVEKYLSAS 120
           LNACELAANNDPTFTDVLQLVRNDHVSNAQEKIKDSTLQQKLVKDTNAELDLVEKYLSAS
Sbjct: 61  LNACELAANNDPTFTDVLQLVRNDHVSNAQEKIKDSTLQQKLVKDTNAELDLVEKYLSAS 120

Query: 121 QILGEVSSRTMDLVMSCGEKLSCLFMAALCNDLGVPAQYVDLSFVVPTDYECKDGSLDNN 180
           QILGEVSSRTMDLVMSCGEKLSCLFMAALCNDLGVPAQYVDLSFVVPTDYECKDGSLDNN
Sbjct: 121 QILGEVSSRTMDLVMSCGEKLSCLFMAALCNDLGVPAQYVDLSFVVPTDYECKDGSLDNN 180

Query: 181 FYTFLVNAFKEALQPVLKSHSIGKPVVPVITGFFGLVPMGLLNGVGRGYTDLCAALIAVG 240
           FYTFLVNAFKEALQPVLKSHSIGKPVVPVITGFFGLVPMGLLNGVGRGYTDLCAALIAVG
Sbjct: 181 FYTFLVNAFKEALQPVLKSHSIGKPVVPVITGFFGLVPMGLLNGVGRGYTDLCAALIAVG 240

Query: 241 LNADELQVWKEVDGIFTADPRKVPQARLLSSVTPEEASELTYYGSEVIHPFTMEQVIRAK 300
           LNADELQVWKEVDGIFTADPRKVPQARLLSSVTPEEASELTYYGSEVIHPFTMEQVIRAK
Sbjct: 241 LNADELQVWKEVDGIFTADPRKVPQARLLSSVTPEEASELTYYGSEVIHPFTMEQVIRAK 300

Query: 301 IPIRIKNVQNPTGEGTVIYPDNIAKKGESTPPHPPVTLTSSFFETKRRGATAITTKNDIV 360
           IPIRIKNVQNPTGEGTVIYPDNIAKKGESTPPHPPVTLTSSFFETKRRGATAITTKNDIV
Sbjct: 301 IPIRIKNVQNPTGEGTVIYPDNIAKKGESTPPHPPVTLTSSFFETKRRGATAITTKNDIV 360

Query: 361 VLNIHSNKKTLSHGFLAQIFSVLDKYKLVVDLISTSEVHVSMALPVPDAESSRALKSAVE 420
           VLNIHSNKKTLSHGFLAQIFSVLDKYKLVVDLISTSEVHVSMALPVPDAESSRALKSAVE
Sbjct: 361 VLNIHSNKKTLSHGFLAQIFSVLDKYKLVVDLISTSEVHVSMALPVPDAESSRALKSAVE 420

Query: 421 ELNRLGSIDLTKKMAIVSLVGKQMKQFIGIAGTMFTTLAEQNINIEMISQGANEINISCV 480
           ELNRLGSIDLTKKMAIVSLVGKQMKQFIGIAGTMFTTLAEQNINIEMISQGANEINISCV
Sbjct: 421 ELNRLGSIDLTKKMAIVSLVGKQMKQFIGIAGTMFTTLAEQNINIEMISQGANEINISCV 480

Query: 481 IDEQDSIKALQSIHAKLLDENSGSLDFEHAVNERLEQIKRLDF 523
           IDEQDSIKALQSIHAKLLDENSGSLDFEHAVNERLEQIKRLDF
Sbjct: 481 IDEQDSIKALQSIHAKLLDENSGSLDFEHAVNERLEQIKRLDF 523

>Kwal_47.18163
          Length = 522

 Score =  905 bits (2340), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 434/523 (82%), Positives = 479/523 (91%), Gaps = 1/523 (0%)

Query: 1   MFEKSNWIVQKFGGTSVGKFPEQIVEQIVKVYTTQYENNVAVVCSARSSYTKAEGTTSRL 60
           M  ++NWIVQKFGGTSVGKFPEQIV +IVKVYTT+Y+NNVAVVCSARSS TKAEGTTSRL
Sbjct: 1   MSSQTNWIVQKFGGTSVGKFPEQIVNEIVKVYTTKYKNNVAVVCSARSSDTKAEGTTSRL 60

Query: 61  LNACELAANNDPTFTDVLQLVRNDHVSNAQEKIKDSTLQQKLVKDTNAELDLVEKYLSAS 120
           L AC+L  N+DP F DVLQ VR+DH+SNA+++I    LQQKL+ DTNAELDLVEKYL+AS
Sbjct: 61  LRACDLVCNSDPAFADVLQKVRDDHISNAKQRITSPDLQQKLIHDTNAELDLVEKYLNAS 120

Query: 121 QILGEVSSRTMDLVMSCGEKLSCLFMAALCNDLGVPAQYVDLSFVVPTDYECKDGSLDNN 180
           Q+LGEVS RTMDLVMSCGEKLSCLFMAALCN+ GV AQYVDLS V+P DYEC+ G+LD +
Sbjct: 121 QVLGEVSLRTMDLVMSCGEKLSCLFMAALCNEYGVRAQYVDLSSVIPHDYECRQGTLDTS 180

Query: 181 FYTFLVNAFKEALQPVLKSHSIGKPVVPVITGFFGLVPMGLLNGVGRGYTDLCAALIAVG 240
           FYTFLV AFKE L PVL++HS G PVVPVITGFFGLVPMGLLNGVGRGYTDLCAALIAVG
Sbjct: 181 FYTFLVRAFKEKLAPVLEAHSQGTPVVPVITGFFGLVPMGLLNGVGRGYTDLCAALIAVG 240

Query: 241 LNADELQVWKEVDGIFTADPRKVPQARLLSSVTPEEASELTYYGSEVIHPFTMEQVIRAK 300
           LNADELQVWKEVDGIFTADPRKVPQARLL SVTPEEASELTYYGSEVIHPFTMEQVIRAK
Sbjct: 241 LNADELQVWKEVDGIFTADPRKVPQARLLGSVTPEEASELTYYGSEVIHPFTMEQVIRAK 300

Query: 301 IPIRIKNVQNPTGEGTVIYPDNIAKKGESTPPHPPVTLTSSFFETKRRGATAITTKNDIV 360
           IPIRIKNVQNPTG+GTVIYPDNIAKKGESTPPHPPVTL++SFFE K+RGATAIT+K+DIV
Sbjct: 301 IPIRIKNVQNPTGDGTVIYPDNIAKKGESTPPHPPVTLSNSFFEQKKRGATAITSKSDIV 360

Query: 361 VLNIHSNKKTLSHGFLAQIFSVLDKYKLVVDLISTSEVHVSMALPVPDAESSRALKSAVE 420
           V++IHSNKKTLSHGFLAQIF+ LDKYKLVVDLISTSEVHVSMALPVPD +SS+ALK AVE
Sbjct: 361 VVSIHSNKKTLSHGFLAQIFTTLDKYKLVVDLISTSEVHVSMALPVPDVDSSKALKKAVE 420

Query: 421 ELNRLGSIDLTKKMAIVSLVGKQMKQFIGIAGTMFTTLAEQNINIEMISQGANEINISCV 480
           EL  LG+++LTKK+ IVSLVGKQMKQFIGIAGTMFTTLAEQ INIEMISQGANEINISCV
Sbjct: 421 ELKVLGAVELTKKLVIVSLVGKQMKQFIGIAGTMFTTLAEQGINIEMISQGANEINISCV 480

Query: 481 IDEQDSIKALQSIHAKLLDENSGSLDFEHAVNERLEQIKRLDF 523
           IDE+D++KALQSIH+KLLD +S  +    AVNE+LEQIKRL+ 
Sbjct: 481 IDEEDALKALQSIHSKLLDLDS-DVGLGKAVNEKLEQIKRLEL 522

>KLLA0F27599g 2558178..2559746 highly similar to sp|P10869
           Saccharomyces cerevisiae YER052c HOM3 L-aspartate
           4-P-transferase singleton, start by similarity
          Length = 522

 Score =  850 bits (2195), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 397/523 (75%), Positives = 465/523 (88%), Gaps = 1/523 (0%)

Query: 1   MFEKSNWIVQKFGGTSVGKFPEQIVEQIVKVYTTQYENNVAVVCSARSSYTKAEGTTSRL 60
           M E SNW+VQKFGGTS+GKF +QIV +I+KVY+ +Y+NNVAVVCSARSSYTKAEGTTSRL
Sbjct: 1   MIETSNWVVQKFGGTSIGKFSKQIVNEIIKVYSQEYDNNVAVVCSARSSYTKAEGTTSRL 60

Query: 61  LNACELAANNDPTFTDVLQLVRNDHVSNAQEKIKDSTLQQKLVKDTNAELDLVEKYLSAS 120
           L AC+LA+NN+  + +VL LV  DHV+NA+E +KD T+Q+ L++DT  E+++V +YL AS
Sbjct: 61  LLACDLASNNNYEYKNVLDLVERDHVANAEESVKDITIQETLIEDTKREINIVRRYLDAS 120

Query: 121 QILGEVSSRTMDLVMSCGEKLSCLFMAALCNDLGVPAQYVDLSFVVPTDYECKDGSLDNN 180
           Q+LGEVS+RT+DLVMS GEKLSCL++ ALC D GV A+YVDLSF+VP+DYECK+G+LDN+
Sbjct: 121 QVLGEVSTRTLDLVMSLGEKLSCLYVTALCQDNGVNARYVDLSFIVPSDYECKEGTLDNS 180

Query: 181 FYTFLVNAFKEALQPVLKSHSIGKPVVPVITGFFGLVPMGLLNGVGRGYTDLCAALIAVG 240
           FYTFLV AF+E L P+LK    G  ++PVITGFFG+VPMGLLNGVGRGYTDLCAALIAV 
Sbjct: 181 FYTFLVTAFREKLSPILKETENGTKIIPVITGFFGVVPMGLLNGVGRGYTDLCAALIAVA 240

Query: 241 LNADELQVWKEVDGIFTADPRKVPQARLLSSVTPEEASELTYYGSEVIHPFTMEQVIRAK 300
           LNADELQVWKEVDGIFTADPRKVPQARLL +VTP+EA+ELTYYGSEVIHPFTMEQVIR  
Sbjct: 241 LNADELQVWKEVDGIFTADPRKVPQARLLDTVTPDEAAELTYYGSEVIHPFTMEQVIRTH 300

Query: 301 IPIRIKNVQNPTGEGTVIYPDNIAKKGESTPPHPPVTLTSSFFETKRRGATAITTKNDIV 360
           IPIRIKNVQNP G GT+IYP + AKKGESTPPHPPV LTSS FE+K++GATAITTK+DIV
Sbjct: 301 IPIRIKNVQNPKGNGTIIYPSDQAKKGESTPPHPPVALTSSIFESKKKGATAITTKSDIV 360

Query: 361 VLNIHSNKKTLSHGFLAQIFSVLDKYKLVVDLISTSEVHVSMALPVPDAESSRALKSAVE 420
           V+NIHSNKKTLSHGFLA++FS LDKYKLVVDLISTSEVHVSMALPVPD++S +AL+ AVE
Sbjct: 361 VVNIHSNKKTLSHGFLAEMFSTLDKYKLVVDLISTSEVHVSMALPVPDSDSLKALRCAVE 420

Query: 421 ELNRLGSIDLTKKMAIVSLVGKQMKQFIGIAGTMFTTLAEQNINIEMISQGANEINISCV 480
           EL RLG++D+ KKMAIVSLVGKQMKQF+GIAGTMFTTLAEQ+INIEMISQGANEINISCV
Sbjct: 421 ELKRLGTVDVIKKMAIVSLVGKQMKQFVGIAGTMFTTLAEQHINIEMISQGANEINISCV 480

Query: 481 IDEQDSIKALQSIHAKLLDENSGSLDFEHAVNERLEQIKRLDF 523
           IDE ++++ALQSIHAKLLD      +FE AVNERLEQIK++  
Sbjct: 481 IDESNAVRALQSIHAKLLDSPQNE-NFESAVNERLEQIKQMSL 522

>CAGL0J02882g complement(277395..278987) highly similar to sp|P10869
           Saccharomyces cerevisiae YER052c HOM3, hypothetical
           start
          Length = 530

 Score =  829 bits (2141), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 405/528 (76%), Positives = 458/528 (86%), Gaps = 15/528 (2%)

Query: 5   SNWIVQKFGGTSVGKFPEQIVEQIVKVYTTQ-----YENNVAVVCSARSSYTKAEGTTSR 59
           SNW+VQKFGGTSVGKFP QIV++IVK Y++      ++N+VAVVCSARSSYTK EGTTSR
Sbjct: 9   SNWVVQKFGGTSVGKFPVQIVDEIVKYYSSSKQDGGFDNDVAVVCSARSSYTKQEGTTSR 68

Query: 60  LLNACELAANNDPTFTDVLQLVRNDHVSNAQEKIKDSTLQQKLVKDTNAELDLVEKYLSA 119
           LL  C+LA+  D  ++D+++ +R DHVSNA+  ++DS L  KL+ DTN EL LV+KYLSA
Sbjct: 69  LLKCCDLASQ-DQEYSDIIETIRQDHVSNAERFLEDSPLVAKLIDDTNKELALVDKYLSA 127

Query: 120 SQILGEVSSRTMDLVMSCGEKLSCLFMAALCNDLGVPAQYVDLSFVVPTDYECKDGSLDN 179
           S++LGEVS+RT+DLVMSCGEKLSCLF+ ALCND G  A+YVDLS VVP+DY+    +LD 
Sbjct: 128 SKVLGEVSNRTIDLVMSCGEKLSCLFITALCNDRGCKAKYVDLSNVVPSDYQTT--TLDT 185

Query: 180 NFYTFLVNAFKEALQPVLKSHSIGKPVVPVITGFFGLVPMGLLNGVGRGYTDLCAALIAV 239
           +FYTFLV A KE L+P + S    + +VPV TGFFG +PMGLLNGVGRGYTDLCAALIAV
Sbjct: 186 SFYTFLVQALKEKLEPFVNSK---ERIVPVFTGFFGFIPMGLLNGVGRGYTDLCAALIAV 242

Query: 240 GLNADELQVWKEVDGIFTADPRKVPQARLLSSVTPEEASELTYYGSEVIHPFTMEQVIRA 299
            LNADELQVWKEVDGIFTADPRKVPQARLL SVTPEEASELTYYGSEVIHPFTMEQVIRA
Sbjct: 243 ALNADELQVWKEVDGIFTADPRKVPQARLLDSVTPEEASELTYYGSEVIHPFTMEQVIRA 302

Query: 300 KIPIRIKNVQNPTGEGTVIYPDNIAKKGESTPPHPPVTLTSSFFETKRRGATAITTKNDI 359
           KIPIRIKNVQNP G GT+IYPDN+AKKGESTPPHPP  L+S+FFE KRRGATAITTKNDI
Sbjct: 303 KIPIRIKNVQNPKGNGTIIYPDNVAKKGESTPPHPPEALSSTFFEKKRRGATAITTKNDI 362

Query: 360 VVLNIHSNKKTLSHGFLAQIFSVLDKYKLVVDLISTSEVHVSMALPVPDAESSRALKSAV 419
           VVLN+HSNKKTLSHGFLAQIF+VLDKYKLVVDLISTSEVHVSMALP+PD++S +AL+SAV
Sbjct: 363 VVLNVHSNKKTLSHGFLAQIFTVLDKYKLVVDLISTSEVHVSMALPIPDSDSMKALRSAV 422

Query: 420 EELNRLGSIDLTKKMAIVSLVGKQMKQFIGIAGTMFTTLAEQNINIEMISQGANEINISC 479
           E+L  LGS+D+ KKM+IVSLVGKQMKQFIGIAGTMFTTLAEQ INIEMISQGANEINISC
Sbjct: 423 EKLKPLGSVDIIKKMSIVSLVGKQMKQFIGIAGTMFTTLAEQGINIEMISQGANEINISC 482

Query: 480 VIDEQDSIKALQSIHAKLLDE----NSGSLDFEHAVNERLEQIKRLDF 523
           VIDE DSIKALQSIH KLLDE     SGS  FE AV+ERLEQIKRL+ 
Sbjct: 483 VIDEMDSIKALQSIHKKLLDELPENGSGSEQFEKAVDERLEQIKRLNL 530

>Scas_715.44
          Length = 528

 Score =  827 bits (2135), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 402/529 (75%), Positives = 456/529 (86%), Gaps = 16/529 (3%)

Query: 5   SNWIVQKFGGTSVGKFPEQIVEQIVKVYT----TQYENNVAVVCSARSSYTKAEGTTSRL 60
           SNW+VQKFGGTSVGKFP QIV+ I+K Y+      Y NNVAVVCSARSSYTKAEGTTSRL
Sbjct: 6   SNWVVQKFGGTSVGKFPVQIVDDIIKFYSDPSNKTYNNNVAVVCSARSSYTKAEGTTSRL 65

Query: 61  LNACELAANNDPTFTDVLQLVRNDHVSNAQEKIKDSTLQQKLVKDTNAELDLVEKYLSAS 120
           L  C+LA+  +  F D++++++ DH+ NA+  ++D  LQ KL+ DT  EL LV+KYL AS
Sbjct: 66  LRCCDLASQ-EMEFNDIIEVIKADHIDNAERYVQDPVLQTKLIADTTKELTLVKKYLDAS 124

Query: 121 QILGEVSSRTMDLVMSCGEKLSCLFMAALCNDLGVPAQYVDLSFVVPTDYECKDGSLDNN 180
           +ILGEVS+RT+DLVMS GEKLSCLFM AL ND G  A+YVDL+ +VP+DY      LDN+
Sbjct: 125 KILGEVSTRTIDLVMSVGEKLSCLFMTALLNDRGCKAKYVDLTHIVPSDYNAT--VLDNS 182

Query: 181 FYTFLVNAFKEALQPVLKSHSIGKPVVPVITGFFGLVPMGLLNGVGRGYTDLCAALIAVG 240
           FYTFL  AFKE LQP ++S    + V+PV TGFFGLVPMGLLNGVGRGYTDLCAALIAV 
Sbjct: 183 FYTFLFQAFKEKLQPFIESK---ERVIPVFTGFFGLVPMGLLNGVGRGYTDLCAALIAVA 239

Query: 241 LNADELQVWKEVDGIFTADPRKVPQARLLSSVTPEEASELTYYGSEVIHPFTMEQVIRAK 300
           +NADELQVWKEVDGIFTADPRKVPQARLL+SVTPEEASELTYYGSEVIHPFTMEQVI+AK
Sbjct: 240 VNADELQVWKEVDGIFTADPRKVPQARLLASVTPEEASELTYYGSEVIHPFTMEQVIQAK 299

Query: 301 IPIRIKNVQNPTGEGTVIYPDNIAKKGESTPPHPPVTLTSSFFETKRRGATAITTKNDIV 360
           IPIRIKNVQNP GEGT+IYPDNIAKKGESTPPHPP TL+SSFFE ++RGATAITTKNDIV
Sbjct: 300 IPIRIKNVQNPRGEGTIIYPDNIAKKGESTPPHPPETLSSSFFERRKRGATAITTKNDIV 359

Query: 361 VLNIHSNKKTLSHGFLAQIFSVLDKYKLVVDLISTSEVHVSMALPVPDAESSRALKSAVE 420
           V+NIHSNKKTLSHGFLAQIF++LDK+KLVVDLISTSEVHVSMALP+PD+ES ++L+ AVE
Sbjct: 360 VINIHSNKKTLSHGFLAQIFTILDKFKLVVDLISTSEVHVSMALPIPDSESHKSLRQAVE 419

Query: 421 ELNRLGSIDLTKKMAIVSLVGKQMKQFIGIAGTMFTTLAEQNINIEMISQGANEINISCV 480
           +L  LG +D+TKKMAIVSLVGKQMKQFIGIAGTMFTTLAEQ INIEMISQGANEINISCV
Sbjct: 420 KLRVLGHVDVTKKMAIVSLVGKQMKQFIGIAGTMFTTLAEQGINIEMISQGANEINISCV 479

Query: 481 IDEQDSIKALQSIHAKLLDENSGSLD------FEHAVNERLEQIKRLDF 523
           IDE DS+KALQSIHAKLLD +  SL+      FEHA+NERLEQIKRLD 
Sbjct: 480 IDETDSLKALQSIHAKLLDAHEASLEEMTTGNFEHAINERLEQIKRLDL 528

>ADL086C [1655] [Homologous to ScYER052C (HOM3) - SH]
           (533181..534839) [1659 bp, 552 aa]
          Length = 552

 Score =  812 bits (2098), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 394/525 (75%), Positives = 460/525 (87%), Gaps = 9/525 (1%)

Query: 3   EKSNWIVQKFGGTSVGKFPEQIVEQIVKVYTTQYENNVAVVCSARSSYTKAEGTTSRLLN 62
           +K+NW+VQKFGGTS+GKFP  IV  IVKV++  Y  NVAVVCSARSSYTK+EGTTSRLL 
Sbjct: 32  QKTNWVVQKFGGTSIGKFPTNIVNDIVKVFSHDYGKNVAVVCSARSSYTKSEGTTSRLLM 91

Query: 63  ACELAANNDPTFTDVLQLVRNDHVSNAQEKIKDSTLQQKLVKDTNAELDLVEKYLSASQI 122
           AC+ AA+ D TF D+++++R DHV NA   IKD+ ++ +LV+ TN ELD VE+YL ASQI
Sbjct: 92  ACDAAASYDETFQDIVRVIREDHVENASHHIKDAEIRVRLVEQTNDELDQVERYLQASQI 151

Query: 123 LGEVSSRTMDLVMSCGEKLSCLFMAALCNDLGVPAQYVDLSFVVPTDYECKDGSLDNNFY 182
           LGEVS+RTMDLVMS GEKLSCLF+ ALC D GV A+YVD S +VPTD+ C +GSLDN+FY
Sbjct: 152 LGEVSNRTMDLVMSVGEKLSCLFLTALCEDCGVTAEYVDFSSIVPTDFRCAEGSLDNSFY 211

Query: 183 TFLVNAFKEALQPVLKSHSIGKPVVPVITGFFGLVPMGLLNGVGRGYTDLCAALIAVGLN 242
             LV AFKE L  +++++  GK +VPVITGFFGL+PMGLLNGVGRGYTDLCAAL+AV LN
Sbjct: 212 ALLVVAFKERLAQIVQANKEGKRIVPVITGFFGLLPMGLLNGVGRGYTDLCAALVAVALN 271

Query: 243 ADELQVWKEVDGIFTADPRKVPQARLLSSVTPEEASELTYYGSEVIHPFTMEQVIRAKIP 302
           ADELQVWKEVDGIFTADPRKVPQARLL +VTPEEA+ELTYYGSEVIHPFTMEQVIRAKIP
Sbjct: 272 ADELQVWKEVDGIFTADPRKVPQARLLETVTPEEAAELTYYGSEVIHPFTMEQVIRAKIP 331

Query: 303 IRIKNVQNPTGEGTVIYPDNIAKKGESTPPHPPVTLTSSFFETKRRGATAITTKNDIVVL 362
           IRIKNVQNPTG+GTVIY DNIAKKGESTPPHPP++++SSFFE ++RGATAITTKNDIVVL
Sbjct: 332 IRIKNVQNPTGDGTVIYADNIAKKGESTPPHPPISVSSSFFEQRKRGATAITTKNDIVVL 391

Query: 363 NIHSNKKTLSHGFLAQIFSVLDKYKLVVDLISTSEVHVSMALPVPDAESSRALKSAVEEL 422
           NIHSNKKTLSHGFLAQIF++LD YKL+VDLISTSEVHVSMALPVPD++S R+L++AVEEL
Sbjct: 392 NIHSNKKTLSHGFLAQIFTILDNYKLIVDLISTSEVHVSMALPVPDSDSQRSLRNAVEEL 451

Query: 423 NRLGSIDLTKKMAIVSLVGKQMKQFIGIAGTMFTTLAEQNINIEMISQGANEINISCVID 482
            +LG++DL KKMAIVSLVGKQMK FIGIAG MFTTL+EQNINIEMISQGANEINISCVID
Sbjct: 452 KKLGTVDLIKKMAIVSLVGKQMKHFIGIAGAMFTTLSEQNINIEMISQGANEINISCVID 511

Query: 483 EQDSIKALQSIHAKLLD----ENSGSLDFEHAVNERLEQIKRLDF 523
           E++S++ALQSIHAKLL+     +SG++     +N RLEQ+K LD 
Sbjct: 512 EKNSVRALQSIHAKLLEPLAPTSSGAV-----LNGRLEQLKSLDL 551

>YER052C (HOM3) [1480] chr5 complement(256374..257957) Aspartate
           kinase (L-aspartate 4-P-transferase), catalyzes the
           first step in the common pathway for methionine and
           threonine biosynthesis [1584 bp, 527 aa]
          Length = 527

 Score =  800 bits (2067), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 391/520 (75%), Positives = 447/520 (85%), Gaps = 9/520 (1%)

Query: 5   SNWIVQKFGGTSVGKFPEQIVEQIVKVYTTQ--YENNVAVVCSARSSYTKAEGTTSRLLN 62
           SNW+VQKFGGTSVGKFP QIV+ IVK Y+      NNVAVVCSARSSYTKAEGTTSRLL 
Sbjct: 12  SNWVVQKFGGTSVGKFPVQIVDDIVKHYSKPDGPNNNVAVVCSARSSYTKAEGTTSRLLK 71

Query: 63  ACELAANNDPTFTDVLQLVRNDHVSNAQEKIKDSTLQQKLVKDTNAELDLVEKYLSASQI 122
            C+LA+  +  F D+++++R DH+ NA   I +  LQ KLV DTN EL+LV+KYL+AS++
Sbjct: 72  CCDLASQ-ESEFQDIIEVIRQDHIDNADRFILNPALQAKLVDDTNKELELVKKYLNASKV 130

Query: 123 LGEVSSRTMDLVMSCGEKLSCLFMAALCNDLGVPAQYVDLSFVVPTDYECKDGSLDNNFY 182
           LGEVSSRT+DLVMSCGEKLSCLFM ALCND G  A+YVDLS +VP+D+     +LDN+FY
Sbjct: 131 LGEVSSRTVDLVMSCGEKLSCLFMTALCNDRGCKAKYVDLSHIVPSDFSA--SALDNSFY 188

Query: 183 TFLVNAFKEALQPVLKSHSIGKPVVPVITGFFGLVPMGLLNGVGRGYTDLCAALIAVGLN 242
           TFLV A KE L P +   S  + +VPV TGFFGLVP GLLNGVGRGYTDLCAALIAV +N
Sbjct: 189 TFLVQALKEKLAPFV---SAKERIVPVFTGFFGLVPTGLLNGVGRGYTDLCAALIAVAVN 245

Query: 243 ADELQVWKEVDGIFTADPRKVPQARLLSSVTPEEASELTYYGSEVIHPFTMEQVIRAKIP 302
           ADELQVWKEVDGIFTADPRKVP+ARLL SVTPEEASELTYYGSEVIHPFTMEQVIRAKIP
Sbjct: 246 ADELQVWKEVDGIFTADPRKVPEARLLDSVTPEEASELTYYGSEVIHPFTMEQVIRAKIP 305

Query: 303 IRIKNVQNPTGEGTVIYPDNIAKKGESTPPHPPVTLTSSFFETKRRGATAITTKNDIVVL 362
           IRIKNVQNP G GT+IYPDN+AKKGESTPPHPP  L+SSF+E ++RGATAITTKNDI V+
Sbjct: 306 IRIKNVQNPLGNGTIIYPDNVAKKGESTPPHPPENLSSSFYEKRKRGATAITTKNDIFVI 365

Query: 363 NIHSNKKTLSHGFLAQIFSVLDKYKLVVDLISTSEVHVSMALPVPDAESSRALKSAVEEL 422
           NIHSNKKTLSHGFLAQIF++LDKYKLVVDLISTSEVHVSMALP+PDA+S ++L+ A E+L
Sbjct: 366 NIHSNKKTLSHGFLAQIFTILDKYKLVVDLISTSEVHVSMALPIPDADSLKSLRQAEEKL 425

Query: 423 NRLGSIDLTKKMAIVSLVGKQMKQFIGIAGTMFTTLAEQNINIEMISQGANEINISCVID 482
             LGS+D+TKK++IVSLVGK MKQ+IGIAGTMFTTLAE+ INIEMISQGANEINISCVI+
Sbjct: 426 RILGSVDITKKLSIVSLVGKHMKQYIGIAGTMFTTLAEEGINIEMISQGANEINISCVIN 485

Query: 483 EQDSIKALQSIHAKLLDENSG-SLDFEHAVNERLEQIKRL 521
           E DSIKALQ IHAKLL E +  S  FEHA++ERLEQ+KRL
Sbjct: 486 ESDSIKALQCIHAKLLSERTNTSNQFEHAIDERLEQLKRL 525

>Scas_34.1*
          Length = 239

 Score =  471 bits (1211), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 229/240 (95%), Positives = 231/240 (96%), Gaps = 1/240 (0%)

Query: 57  TSRLLNACELAANNDPTFTDVLQLVRNDHVSNAQEKIKDSTLQQKLVKDTNAELDLVEKY 116
           TSRLLNACELAANNDPTFTDVLQLVRNDHVSNAQEKIKDSTLQQKLVKDTNAELDLVEKY
Sbjct: 1   TSRLLNACELAANNDPTFTDVLQLVRNDHVSNAQEKIKDSTLQQKLVKDTNAELDLVEKY 60

Query: 117 LSASQILGEVSSRTMDLVMSCGEKLSCLFMAALCNDLGVPAQYVDLSFVVPTDYECKDGS 176
           LSASQILGEVSSRTMDLVMSCGEKLSCLFMAALCNDLGVPAQYVDLSFVVPTDYECKDGS
Sbjct: 61  LSASQILGEVSSRTMDLVMSCGEKLSCLFMAALCNDLGVPAQYVDLSFVVPTDYECKDGS 120

Query: 177 LDNNFYTFLVNAFKEALQPVLKSHSIGKPVVPVITGFFGLVPMGLLNGVGRGYTDLCAAL 236
           LDNNFYTFLVNAFKEALQPVLKSHSIGKPVVPVITGFFGLVPMGLLNGVGRGYTDLCAAL
Sbjct: 121 LDNNFYTFLVNAFKEALQPVLKSHSIGKPVVPVITGFFGLVPMGLLNGVGRGYTDLCAAL 180

Query: 237 IAVGLNADELQVWKEVDGIFTADPRKVPQARLLSSVTPEEASELTYYGSEVIHPFTMEQV 296
           IAVGLNADELQVWKEVDGIFTADPR+  +   LSSVTPE A  LTYYGS VIHPFTMEQV
Sbjct: 181 IAVGLNADELQVWKEVDGIFTADPRRFLKQDCLSSVTPERAL-LTYYGSGVIHPFTMEQV 239

>YDL010W (YDL010W) [848] chr4 (432327..433022) Protein predicted to
           have structural similarity to disulfide oxidoreductases
           [696 bp, 231 aa]
          Length = 231

 Score = 38.1 bits (87), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 29/88 (32%), Positives = 42/88 (47%), Gaps = 10/88 (11%)

Query: 180 NFYTFLVNAFKEALQPVLKSHSIGKPV---VPVITGFFGLVPMGLLNGVGRGYTDLCAAL 236
           N Y F+ N +   L      H  G+ +   + ++TG  G VP  L+NGV RG  +    L
Sbjct: 148 NEYQFIPNYYIIELD----KHGHGEELQEYIKLVTGR-GTVPNLLVNGVSRGGNEEIKKL 202

Query: 237 IAVGLNADELQVWKEVDGIFTADPRKVP 264
              G   + LQVW   DG F+ + R+ P
Sbjct: 203 HTQGKLLESLQVWS--DGKFSVEQREKP 228

>CAGL0H01441g complement(140740..142023) highly similar to sp|P32264
           Saccharomyces cerevisiae YDR300c PRO1 glutamate
           5-kinase, hypothetical start
          Length = 427

 Score = 33.1 bits (74), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 16/40 (40%), Positives = 25/40 (62%)

Query: 228 GYTDLCAALIAVGLNADELQVWKEVDGIFTADPRKVPQAR 267
           G  D  +A+ A  ++AD L +  +VD ++TADPR  P A+
Sbjct: 154 GDNDTLSAITAGLIHADYLFLLTDVDCLYTADPRSDPDAK 193

>Sklu_2395.9 YIL107C, Contig c2395 14041-16428
          Length = 795

 Score = 32.7 bits (73), Expect = 0.87,   Method: Compositional matrix adjust.
 Identities = 26/97 (26%), Positives = 45/97 (46%), Gaps = 12/97 (12%)

Query: 129 RTMDLVMSCGEKLSCLFMAALCNDLGVPAQYVDLSFVVPTDYECKDGSLD-NNFYTFLVN 187
           R +D + S   ++  LF+ ++C+D     + + L    P DY+ KD S+   +F   L N
Sbjct: 292 RVLDKIHSRNSQIKILFLESICSDRATVEKNIQLKLFGP-DYKGKDPSVSLQDFKERLAN 350

Query: 188 AFKEALQPV--------LKSHSIGKPVVPV-ITGFFG 215
            +  A +P+        +K   +GK V+   I GF  
Sbjct: 351 -YLTAYEPIEDNENLQYIKMIDVGKKVISYNIQGFLA 386

>Kwal_23.4943
          Length = 736

 Score = 32.3 bits (72), Expect = 0.98,   Method: Compositional matrix adjust.
 Identities = 39/164 (23%), Positives = 68/164 (41%), Gaps = 18/164 (10%)

Query: 129 RTMDLVMSCGEKLSCLFMAALCNDLGVPAQYVDLSFVVPTDYECKDGSLDNNFYTFLVNA 188
           + +D + S   ++  LF+ ++C+D     + + L    P DY+ KD       +   ++ 
Sbjct: 260 KVLDKIYSRNNQIKVLFLESVCSDKATVEKNIKLKLFGP-DYKGKDPETSLQDFKERLSN 318

Query: 189 FKEALQPV--------LKSHSIGKPVVPV-ITGFFGLVPM-GLLNGVGRGYTDLCAALIA 238
           + +A +PV        +K   +GK V+   I GF     +  LLN       +L    I 
Sbjct: 319 YMKAYEPVDDDENLQYIKMIDVGKKVISYNIQGFLASQTVYYLLN------FNLAERQIW 372

Query: 239 VGLNAD-ELQVWKEVDGIFTADPRKVPQARLLSSVTPEEASELT 281
           +  N + E  V  ++ G     PR    AR LS    ++  E T
Sbjct: 373 ITRNGESEFNVQGKIGGDSDLTPRGRRYARALSKFIDQQRIEFT 416

>AAL061C [126] [Homologous to ScYDR300C (PRO1) - SH; ScYHR033W - SH]
           (239518..240780) [1263 bp, 420 aa]
          Length = 420

 Score = 30.4 bits (67), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 16/46 (34%), Positives = 27/46 (58%)

Query: 222 LNGVGRGYTDLCAALIAVGLNADELQVWKEVDGIFTADPRKVPQAR 267
           ++GV  G  D  +A+ A  + AD L +  +VD ++T +PR  P A+
Sbjct: 145 ISGVKFGDNDTLSAITAGLIGADYLFLMTDVDCLYTDNPRTNPDAK 190

>CAGL0D03894g 389509..390966 similar to sp|P32264 Saccharomyces
           cerevisiae YDR300c PRO1 or sp|P38690 Saccharomyces
           cerevisiae YHR033w, hypothetical start
          Length = 485

 Score = 30.4 bits (67), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 14/40 (35%), Positives = 24/40 (60%)

Query: 228 GYTDLCAALIAVGLNADELQVWKEVDGIFTADPRKVPQAR 267
           G  D  +A+ A  ++AD L +  +VD ++T +PR  P A+
Sbjct: 146 GDNDTLSAITAALVSADHLFLLTDVDCLYTENPRTNPDAK 185

>Scas_662.15
          Length = 917

 Score = 29.6 bits (65), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 26/98 (26%), Positives = 45/98 (45%), Gaps = 8/98 (8%)

Query: 63  ACELAANNDPTFTDVLQLVRNDHVSNAQ---EKIKDSTLQQKLVKDTNAELDLVEKYLSA 119
           AC L ++ND    D      +D     Q   + I DST+ +K + D  ++LDL ++ L  
Sbjct: 353 ACHLVSDNDTHDNDSHSYWNSDAYLLQQLEPQLISDSTITRKSIMDDISQLDLNKQDLIT 412

Query: 120 SQILGEVS-----SRTMDLVMSCGEKLSCLFMAALCND 152
           + I   ++     +    L +  G++L    M+ L ND
Sbjct: 413 NDIFNHIAYTKGITMLRSLQLCIGDQLLSKAMSDLFND 450

>Scas_538.1
          Length = 486

 Score = 29.3 bits (64), Expect = 9.1,   Method: Compositional matrix adjust.
 Identities = 22/88 (25%), Positives = 48/88 (54%), Gaps = 5/88 (5%)

Query: 23  QIVEQIVKVYTTQYENNVAVVCSARSSYTKAEGTTSRLLNACELAANNDPTFTDVLQLVR 82
           + V++  K   TQ EN   ++ ++ S+  + E     LL+ CEL    +     +L++  
Sbjct: 277 ETVKEQNKTLQTQLENTRQLLNNSTSNKDQYEEIVQTLLDKCELIVEANS----ILEIQE 332

Query: 83  NDHVSNAQEKIKDSTLQQKLVKDTNAEL 110
           N++V   QE +++ +L +++++D N +L
Sbjct: 333 NENVL-LQELLQNRSLNEQVLEDLNVKL 359

>KLLA0B07667g 667863..673862 weakly similar to sp|P25356
           Saccharomyces cerevisiae YCR032w BPH1g to human
           beige-like protein and mouse lysosomal trafficking
           regulator singleton, start by similarity
          Length = 1999

 Score = 29.6 bits (65), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 25/97 (25%), Positives = 49/97 (50%), Gaps = 9/97 (9%)

Query: 37  ENNVAVVCSARSSYTKAEGTTSRLLN-------ACELAANNDPTFTDVLQLVRNDHVSNA 89
           EN + +V  + +S+   + +   L+N       A EL + +D   +    ++RN  +++ 
Sbjct: 866 ENILHLVSISSASWKVHDASWEALINTNLVILKARELISKSDFESSFQTDILRN--LNSV 923

Query: 90  QEKIKDSTLQQKLVKDTNAELDLVEKYLSASQILGEV 126
           QE+I +  +   + KD+N E D++E+ L A     EV
Sbjct: 924 QEEIYNWIVANGIRKDSNIEHDMIEQLLHAMLYYQEV 960

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.316    0.132    0.370 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 16,390,246
Number of extensions: 699693
Number of successful extensions: 2418
Number of sequences better than 10.0: 29
Number of HSP's gapped: 2481
Number of HSP's successfully gapped: 29
Length of query: 523
Length of database: 16,596,109
Length adjustment: 106
Effective length of query: 417
Effective length of database: 12,926,601
Effective search space: 5390392617
Effective search space used: 5390392617
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 64 (29.3 bits)