Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Sklu_2260.235035016950.0
Kwal_47.1815928728711621e-161
KLLA0F27621g28127610571e-145
ADL087W2872809541e-129
YIL043C (CBR1)3222568931e-119
CAGL0L00847g2852588871e-119
Scas_704.433162928521e-113
Sklu_2184.23102575122e-62
Scas_692.63142495036e-61
KLLA0C16918g3102805019e-61
AFR439C3102754966e-60
Kwal_33.142603082714941e-59
YML087C3122494871e-58
YML125C3122844826e-58
CAGL0B02519g3122524801e-57
KLLA0D04488g2962483963e-45
ACR054C3062153894e-44
YKL150W (MCR1)3022583781e-42
Kwal_23.54713122263772e-42
CAGL0E06424g2982833744e-42
Scas_678.62992823623e-40
Scas_699.4131897992e-04
KLLA0E21901g357114890.004
CAGL0I00990g343109860.009
Kwal_55.21561349114850.013
Scas_595.11398257850.015
Sklu_2216.5620100810.052
YOR037W (CYC2)36662800.058
Scas_690.29688117780.14
ACR090C36662720.54
CAGL0H08580g621115710.83
YPR048W (TAH18)623145700.99
Scas_718.1961663701.2
KLLA0C18931g55383691.4
YKL220C (FRE2)711139682.2
YOR384W (FRE5)694108672.5
YGR234W (YHB1)39992663.1
AER316C269166644.7
Scas_678.1868672638.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Sklu_2260.2
         (350 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Sklu_2260.2 YIL043C, Contig c2260 2185-3237                           657   0.0  
Kwal_47.18159                                                         452   e-161
KLLA0F27621g complement(2560055..2560900) similar to sp|P38626 S...   411   e-145
ADL087W [1654] [Homologous to ScYIL043C (CBR1) - SH] complement(...   372   e-129
YIL043C (CBR1) [2624] chr9 complement(274071..275039) Cytochrome...   348   e-119
CAGL0L00847g complement(104034..104891) similar to sp|P38626 Sac...   346   e-119
Scas_704.43                                                           332   e-113
Sklu_2184.2 YML125C, Contig c2184 1732-2664 reverse complement        201   2e-62
Scas_692.6                                                            198   6e-61
KLLA0C16918g 1478540..1479472 similar to sp|Q12746 Saccharomyces...   197   9e-61
AFR439C [3631] [Homologous to ScYML125C - SH; ScYML087C - SH] (1...   195   6e-60
Kwal_33.14260                                                         194   1e-59
YML087C (YML087C) [3882] chr13 complement(94431..95369) Protein ...   192   1e-58
YML125C (YML125C) [3847] chr13 complement(20762..21700) Protein ...   190   6e-58
CAGL0B02519g 240486..241424 highly similar to sp|Q12746 Saccharo...   189   1e-57
KLLA0D04488g complement(381861..382751) similar to sp|P36060 Sac...   157   3e-45
ACR054C [1102] [Homologous to ScYKL150W (MCR1) - SH] (454023..45...   154   4e-44
YKL150W (MCR1) [3118] chr11 (166549..167457) NADH-cytochrome b5 ...   150   1e-42
Kwal_23.5471                                                          149   2e-42
CAGL0E06424g 644026..644922 similar to sp|P36060 Saccharomyces c...   148   4e-42
Scas_678.6                                                            144   3e-40
Scas_699.41                                                            43   2e-04
KLLA0E21901g 1946190..1947263 similar to sp|P38909 Saccharomyces...    39   0.004
CAGL0I00990g complement(81437..82468) similar to sp|P38909 Sacch...    38   0.009
Kwal_55.21561                                                          37   0.013
Scas_595.11                                                            37   0.015
Sklu_2216.5 YPR048W, Contig c2216 7954-9816 reverse complement         36   0.052
YOR037W (CYC2) [4849] chr15 (401554..402654) Cytochrome c mitoch...    35   0.058
Scas_690.29                                                            35   0.14 
ACR090C [1137] [Homologous to ScYOR037W (CYC2) - SH] (519431..52...    32   0.54 
CAGL0H08580g complement(841038..842903) highly similar to tr|Q12...    32   0.83 
YPR048W (TAH18) [5480] chr16 (659177..661048) Protein of unknown...    32   0.99 
Scas_718.19                                                            32   1.2  
KLLA0C18931g 1680133..1681794 gi|29124348|gb|AAO47086.1 Kluyvero...    31   1.4  
YKL220C (FRE2) [3055] chr11 complement(9092..11227) Ferric and c...    31   2.2  
YOR384W (FRE5) [5157] chr15 (1061560..1063644) Protein with simi...    30   2.5  
YGR234W (YHB1) [2182] chr7 (959906..961105) Flavohemoglobin invo...    30   3.1  
AER316C [2817] [Homologous to ScYML025C - SH] (1221231..1221986,...    29   4.7  
Scas_678.18                                                            29   8.6  

>Sklu_2260.2 YIL043C, Contig c2260 2185-3237
          Length = 350

 Score =  657 bits (1695), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 336/350 (96%), Positives = 336/350 (96%)

Query: 1   MDISSMNSATIFLATVLVIAVFAIINKTLSSKSARPVLIKDQFQDFPLISKTVLTHNTAV 60
           MDISSMNSATIFLATVLVIAVFAIINKTLSSKSARPVLIKDQFQDFPLISKTVLTHNTAV
Sbjct: 1   MDISSMNSATIFLATVLVIAVFAIINKTLSSKSARPVLIKDQFQDFPLISKTVLTHNTAV 60

Query: 61  YRFGLPKPTDVLGLPIGQHISIQGIIDGKEIVRSYTPTSLDSDATGHFELLIKSYEKGNI 120
           YRFGLPKPTDVLGLPIGQHISIQGIIDGKEIVRSYTPTSLDSDATGHFELLIKSYEKGNI
Sbjct: 61  YRFGLPKPTDVLGLPIGQHISIQGIIDGKEIVRSYTPTSLDSDATGHFELLIKSYEKGNI 120

Query: 121 SKMIGELKIGDRIKVRGPKGFYTYTANMNSSLAMVAGGTGIAPMYQIIKAISVNLQDKTK 180
           SKMIGELKIGDRIKVRGPKGFYTYTANMNSSLAMVAGGTGIAPMYQIIKAISVNLQDKTK
Sbjct: 121 SKMIGELKIGDRIKVRGPKGFYTYTANMNSSLAMVAGGTGIAPMYQIIKAISVNLQDKTK 180

Query: 181 VALVYGNVSEEDILLKKELDAIVESNPDQFKIHYMLDKPTSETWNGGIGYVTADVMKEYL 240
           VALVYGNVSEEDILLKKELDAIVESNPDQFKIHYMLDKPTSETWNGGIGYVTADVMKEYL
Sbjct: 181 VALVYGNVSEEDILLKKELDAIVESNPDQFKIHYMLDKPTSETWNGGIGYVTADVMKEYL 240

Query: 241 PAAGEGVQLLVCGPPPMVSSIKRNAVALGFERAKPISKMGDQIFVFYVXXXXXXXXXXXX 300
           PAAGEGVQLLVCGPPPMVSSIKRNAVALGFERAKPISKMGDQIFVFYV            
Sbjct: 241 PAAGEGVQLLVCGPPPMVSSIKRNAVALGFERAKPISKMGDQIFVFYVDEDDKKKKAKQD 300

Query: 301 XXFYAFSTCSKYDLYIAISYLVFFYYKKIFFFSTHARKNLLKQFRYCYIF 350
             FYAFSTCSKYDLYIAISYLVFFYYKKIFFFSTHARKNLLKQFRYCYIF
Sbjct: 301 NKFYAFSTCSKYDLYIAISYLVFFYYKKIFFFSTHARKNLLKQFRYCYIF 350

>Kwal_47.18159
          Length = 287

 Score =  452 bits (1162), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 210/287 (73%), Positives = 255/287 (88%), Gaps = 1/287 (0%)

Query: 1   MDISSMNSATIFLATVLVIAVFAIINKTLSSKSARPVLIKDQFQDFPLISKTVLTHNTAV 60
           MD    +  TI +  ++ +     +++ LSSK+++P+L+KD+FQ+FPL+SKTVLTHNTAV
Sbjct: 1   MDSLPFSLKTILIGGLIALGAVYFVSQLLSSKASKPILLKDEFQEFPLVSKTVLTHNTAV 60

Query: 61  YRFGLPKPTDVLGLPIGQHISIQGII-DGKEIVRSYTPTSLDSDATGHFELLIKSYEKGN 119
           YRFGLPK TDVLGLPIGQHISIQG + DGKEI+RSYTPTSLDSD+ G FELLIKSYE+GN
Sbjct: 61  YRFGLPKHTDVLGLPIGQHISIQGTLKDGKEIMRSYTPTSLDSDSVGFFELLIKSYEQGN 120

Query: 120 ISKMIGELKIGDRIKVRGPKGFYTYTANMNSSLAMVAGGTGIAPMYQIIKAISVNLQDKT 179
           +SKMIGEL+IGD+IKVRGPKGFYTYT NMNS + M+AGGTGIAPMYQIIK+I  + +D+T
Sbjct: 121 VSKMIGELQIGDKIKVRGPKGFYTYTPNMNSEIGMIAGGTGIAPMYQIIKSIHSDPKDRT 180

Query: 180 KVALVYGNVSEEDILLKKELDAIVESNPDQFKIHYMLDKPTSETWNGGIGYVTADVMKEY 239
           KV+++YG+ +E+DILLKKE+DAIVESNPDQFK+HY+LDKP  +TW GG+GYVTA+VMKE+
Sbjct: 181 KVSIIYGSQTEDDILLKKEIDAIVESNPDQFKVHYLLDKPARDTWTGGVGYVTAEVMKEH 240

Query: 240 LPAAGEGVQLLVCGPPPMVSSIKRNAVALGFERAKPISKMGDQIFVF 286
           LPAAG+GVQLLVCGPP MVSSIKRNAVALGFE+AKPISKMGDQ+FVF
Sbjct: 241 LPAAGDGVQLLVCGPPGMVSSIKRNAVALGFEKAKPISKMGDQVFVF 287

>KLLA0F27621g complement(2560055..2560900) similar to sp|P38626
           Saccharomyces cerevisiae YIL043c CBR1 cytochrome-b5
           reductase, hypothetical start
          Length = 281

 Score =  411 bits (1057), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 196/276 (71%), Positives = 226/276 (81%), Gaps = 1/276 (0%)

Query: 11  IFLATVLVIAVFAIINKTLSSKSARPVLIKDQFQDFPLISKTVLTHNTAVYRFGLPKPTD 70
           IF AT +++     +     SK  +PVL K++ Q+FPL++KTVLTHNTA+YRFGLPK T 
Sbjct: 7   IFTATFVLLCTIIAVVLEYQSKKDKPVLDKEKLQEFPLVAKTVLTHNTAIYRFGLPKSTQ 66

Query: 71  VLGLPIGQHISIQGIIDGKEIVRSYTPTSLDSDATGHFELLIKSYEKGNISKMIGELKIG 130
           VLGLPIGQHIS+Q  I+GK+I+RSYTPTSLDSDA GHFELLIKSYEKGNISK   +L IG
Sbjct: 67  VLGLPIGQHISVQANINGKDILRSYTPTSLDSDAVGHFELLIKSYEKGNISKHFAQLNIG 126

Query: 131 DRIKVRGPKGFYTYTANMNSSLAMVAGGTGIAPMYQIIKAISVNLQDKTKVALVYGNVSE 190
           D+IKVRGPKGFY Y  NMN  + M+AGGTGIAPMYQI+K+I  N  DKTKV+LVYGN +E
Sbjct: 127 DKIKVRGPKGFYHYQPNMNEEIGMIAGGTGIAPMYQIMKSIFANDSDKTKVSLVYGNQTE 186

Query: 191 EDILLKKELDAIVESNPDQFKIHYMLDKPTSETWNGGIGYVTADVMKEYLPAAGEGVQLL 250
           EDILLKKELDA VE  PDQFK++Y+LDK   E W GG+GY+T D MKE LPA  EGVQLL
Sbjct: 187 EDILLKKELDAFVERKPDQFKVYYLLDK-APEAWTGGVGYITVDTMKERLPAPAEGVQLL 245

Query: 251 VCGPPPMVSSIKRNAVALGFERAKPISKMGDQIFVF 286
           VCGPPPMVSSIKRNAV LG+E+AKPISKMGDQIFVF
Sbjct: 246 VCGPPPMVSSIKRNAVTLGYEKAKPISKMGDQIFVF 281

>ADL087W [1654] [Homologous to ScYIL043C (CBR1) - SH]
           complement(532195..533058) [864 bp, 287 aa]
          Length = 287

 Score =  372 bits (954), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 182/280 (65%), Positives = 220/280 (78%), Gaps = 6/280 (2%)

Query: 13  LATVLVIAV--FAIINKTLSSKSARPVL---IKDQFQDFPLISKTVLTHNTAVYRFGLPK 67
           L T LV+AV    I  K   +K ++P +   +   +Q+F L++KTVLTHNTA+YRFGLP+
Sbjct: 8   LVTALVLAVSFIFIYGKFSGAKQSQPAVKTTLNKDWQEFSLLTKTVLTHNTAIYRFGLPE 67

Query: 68  PTDVLGLPIGQHISIQGIIDGKEIVRSYTPTSLDSDATGHFELLIKSYEKGNISKMIGEL 127
              VLGLPIGQHISI G+IDGKE++RSYTPTSLDSDATG+FELL+KSYEKGNISKM+ EL
Sbjct: 68  ADAVLGLPIGQHISISGVIDGKEMLRSYTPTSLDSDATGYFELLVKSYEKGNISKMLAEL 127

Query: 128 KIGDRIKVRGPKGFYTYTANMNSSLAMVAGGTGIAPMYQIIKAISVNLQDKTKVALVYGN 187
            IGDRIKVRGPKGFY Y  NM   + M+AGGTGI+PMYQII+AI  N +DKT+V LVYGN
Sbjct: 128 AIGDRIKVRGPKGFYHYEPNMYKEIGMIAGGTGISPMYQIIRAIFSNPRDKTRVCLVYGN 187

Query: 188 VSEEDILLKKELDAIVESNPDQFKIHYMLDK-PTSETWNGGIGYVTADVMKEYLPAAGEG 246
            +++DILLK ELDA+V + PDQFKI YMLDK    E W G +GY+T  +M+E+LPA    
Sbjct: 188 QTKDDILLKPELDAMVAAKPDQFKILYMLDKVAEGEQWEGKLGYITEAIMREHLPAPSSS 247

Query: 247 VQLLVCGPPPMVSSIKRNAVALGFERAKPISKMGDQIFVF 286
            QLL+CGPPPMVSS KR AV+LGFE+AKPISK GDQ+F F
Sbjct: 248 AQLLLCGPPPMVSSAKRIAVSLGFEKAKPISKKGDQVFAF 287

>YIL043C (CBR1) [2624] chr9 complement(274071..275039) Cytochrome b5
           reductase, converts 2 ferricytochrome B5 + NADH to 2
           ferrocytochrome B5 + NAD(+), uses FAD cofactor [969 bp,
           322 aa]
          Length = 322

 Score =  348 bits (893), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 163/256 (63%), Positives = 204/256 (79%), Gaps = 3/256 (1%)

Query: 34  ARPVL--IKDQFQDFPLISKTVLTHNTAVYRFGLPKPTDVLGLPIGQHISIQGIIDGKEI 91
            +PVL   ++ FQ FPL+ KT+LTHNT++Y+FGLP   DVLGLPIGQHI I+  I+GK+I
Sbjct: 67  TKPVLDPKRNDFQSFPLVEKTILTHNTSMYKFGLPHADDVLGLPIGQHIVIKANINGKDI 126

Query: 92  VRSYTPTSLDSDATGHFELLIKSYEKGNISKMIGELKIGDRIKVRGPKGFYTYTANMNSS 151
            RSYTPTSLD D  G+FELL+KSY  GN+SKMIGELKIGD I+++GP+G Y Y  N  S 
Sbjct: 127 TRSYTPTSLDGDTKGNFELLVKSYPTGNVSKMIGELKIGDSIQIKGPRGNYHYERNCRSH 186

Query: 152 LAMVAGGTGIAPMYQIIKAISVNLQDKTKVALVYGNVSEEDILLKKELDAIVESNPDQFK 211
           L M+AGGTGIAPMYQI+KAI+++  D TKV+LV+GNV EEDILLKKEL+A+V   P QFK
Sbjct: 187 LGMIAGGTGIAPMYQIMKAIAMDPHDTTKVSLVFGNVHEEDILLKKELEALVAMKPSQFK 246

Query: 212 IHYMLDKPTSETWNGGIGYVTADVMKEYLPAAG-EGVQLLVCGPPPMVSSIKRNAVALGF 270
           I Y LD P  E W GG+GY+T DV+KE+LPAA  + VQ+L+CGPP MV+S++R+ V LGF
Sbjct: 247 IVYYLDSPDREDWTGGVGYITKDVIKEHLPAATMDNVQILICGPPAMVASVRRSTVDLGF 306

Query: 271 ERAKPISKMGDQIFVF 286
            R+KP+SKM DQ+FVF
Sbjct: 307 RRSKPLSKMEDQVFVF 322

>CAGL0L00847g complement(104034..104891) similar to sp|P38626
           Saccharomyces cerevisiae YIL043c CBR1 cytochrome-b5
           reductase, hypothetical start
          Length = 285

 Score =  346 bits (887), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 162/258 (62%), Positives = 203/258 (78%)

Query: 29  LSSKSARPVLIKDQFQDFPLISKTVLTHNTAVYRFGLPKPTDVLGLPIGQHISIQGIIDG 88
           +S K A   L+K +F++F L+ K  LTHNTA Y+F L   + VLGLPIGQHI+++ II G
Sbjct: 28  VSQKEAVKALLKTEFREFELVEKEQLTHNTAKYKFKLADESHVLGLPIGQHITVKTIIGG 87

Query: 89  KEIVRSYTPTSLDSDATGHFELLIKSYEKGNISKMIGELKIGDRIKVRGPKGFYTYTANM 148
           K + RSYTPTSLD +  G FELL+KSY +GNISK IG++KIG++I + GP+GFY Y  N+
Sbjct: 88  KPVSRSYTPTSLDEECVGFFELLVKSYPEGNISKHIGDMKIGEKINISGPRGFYEYVPNV 147

Query: 149 NSSLAMVAGGTGIAPMYQIIKAISVNLQDKTKVALVYGNVSEEDILLKKELDAIVESNPD 208
           +  LAMVAGGTGI PM+QI+KAI+ +  DKT+V L+YGNV EEDILLK+ELD +V+  PD
Sbjct: 148 HKHLAMVAGGTGITPMFQIMKAIARDPSDKTRVTLLYGNVLEEDILLKQELDDLVKQRPD 207

Query: 209 QFKIHYMLDKPTSETWNGGIGYVTADVMKEYLPAAGEGVQLLVCGPPPMVSSIKRNAVAL 268
           QFKI Y+LDKP  + W GG+GYVT D+MKE  P+A E VQLLVCGPP MVSS+KRNAVAL
Sbjct: 208 QFKITYLLDKPERDDWEGGVGYVTLDLMKESFPSAEEDVQLLVCGPPGMVSSVKRNAVAL 267

Query: 269 GFERAKPISKMGDQIFVF 286
           GF RAKP+SKM D++FVF
Sbjct: 268 GFPRAKPVSKMEDRVFVF 285

>Scas_704.43
          Length = 316

 Score =  332 bits (852), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 166/292 (56%), Positives = 206/292 (70%), Gaps = 7/292 (2%)

Query: 2   DISSMNSATIFLATVLVIAVFAI------INKTLSSKSARPVLIKDQFQDFPLISKTVLT 55
           +I     A  F  + L+  VF +      I+      + + VL K  F  F L+SKTVLT
Sbjct: 25  NIRPTGEANAFNRSTLIPVVFILALAIRYISMRRRIHANKAVLKKGTFHKFCLVSKTVLT 84

Query: 56  HNTAVYRFGLPKPTDVLGLPIGQHISIQGIIDGKEIVRSYTPTSLDSDATGHFELLIKSY 115
           HNTA+Y FGLP   DVLGLPIGQHISI+  IDGK+I+RSYTPTSLDS+  G FELL+KSY
Sbjct: 85  HNTAIYNFGLPNADDVLGLPIGQHISIKENIDGKDIMRSYTPTSLDSETKGSFELLVKSY 144

Query: 116 EKGNISKMIGELKIGDRIKVRGPKGFYTYTANMNSSLAMVAGGTGIAPMYQIIKAISVNL 175
             GNISK IG L IGD I V GP G Y Y  N  + L M+AGGTGIAPM+QI+KAI +N 
Sbjct: 145 PNGNISKFIGNLNIGDEINVCGPAGNYHYEPNCRNKLGMIAGGTGIAPMFQIMKAIYLNP 204

Query: 176 QDKTKVALVYGNVSEEDILLKKELDAIVESNPDQFKIHYMLDKPTSETWNGGIGYVTADV 235
           +D T+V L+YGNV E DILL+KELD +V+  PDQFK+ Y+LDK   + W G IGYVT D+
Sbjct: 205 KDTTEVTLLYGNVQEADILLRKELDEMVKMRPDQFKVIYLLDKTDRDDWEGEIGYVTLDL 264

Query: 236 MKEYLPAAG-EGVQLLVCGPPPMVSSIKRNAVALGFERAKPISKMGDQIFVF 286
           M++Y+P+   EGVQ+L+CGPP MV S KRNAV +G+ R KP+SKM DQ+F+F
Sbjct: 265 MEKYMPSPKEEGVQMLLCGPPRMVGSAKRNAVTMGYARGKPLSKMEDQVFIF 316

>Sklu_2184.2 YML125C, Contig c2184 1732-2664 reverse complement
          Length = 310

 Score =  201 bits (512), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 101/257 (39%), Positives = 158/257 (61%), Gaps = 3/257 (1%)

Query: 30  SSKSARPVLIKDQFQDFPLISKTVLTHNTAVYRFGLPKPTDVLGLPIGQHISIQGIIDGK 89
           S+ S R  +  + +    L  + +++ N+A+YRF L    + L +P+G H++++  I+GK
Sbjct: 57  SAYSRRKSVYPNAWTALELEDQILISKNSAIYRFKLKTSLETLKIPVGHHLAVKIPIEGK 116

Query: 90  EIVRSYTPTSLDSDATGHFELLIKSYEKGNISKMIGELKIGDRIKVRGPKGFYTYTANMN 149
             +R YTP +   D TGHF++++KSY  G +SK    LK G  ++ +GP G + Y  N +
Sbjct: 117 NEIRYYTPITQRYD-TGHFDIIVKSYTDGKVSKYFASLKPGQLVEFQGPVGRFNYATNSS 175

Query: 150 SSLAMVAGGTGIAPMYQIIKAISVNLQDKTKVALVYGNVSEEDILLKKELDAIVESNPDQ 209
            ++ M+AGG+GI PM Q++  I    +D TKV+L+Y N +E DILLK ELD + +  P+ 
Sbjct: 176 KAIGMIAGGSGITPMLQVLSQIVTTPEDTTKVSLIYANETENDILLKDELDEMADKYPN- 234

Query: 210 FKIHYMLDKPTSETWNGGIGYVTADVMKEYLPAAGEGVQLLVCGPPPMVSSIKRNAVALG 269
           F++HY+L KP S  W G  GYVT D M++YLP   +  +LL+CGP  M++ +   +  LG
Sbjct: 235 FEVHYVLHKP-SPGWTGDTGYVTKDQMQKYLPGPSDENRLLICGPLAMINMLLNYSEELG 293

Query: 270 FERAKPISKMGDQIFVF 286
           + R    SK  DQ+FVF
Sbjct: 294 WPRGIVKSKPDDQVFVF 310

>Scas_692.6
          Length = 314

 Score =  198 bits (503), Expect = 6e-61,   Method: Compositional matrix adjust.
 Identities = 104/249 (41%), Positives = 155/249 (62%), Gaps = 3/249 (1%)

Query: 38  LIKDQFQDFPLISKTVLTHNTAVYRFGLPKPTDVLGLPIGQHISIQGIIDGKEIVRSYTP 97
           L  D++    L  +TV++ NTA+YRF L    + L +P G HI+++  ID KE +R Y P
Sbjct: 69  LFPDRWTSLELDDQTVVSKNTALYRFKLKTNLESLDIPAGYHIAVRVFIDDKEEIRYYNP 128

Query: 98  TSLDSDATGHFELLIKSYEKGNISKMIGELKIGDRIKVRGPKGFYTYTANMNSSLAMVAG 157
            S   D TGHF+LLIKSY  G +SK    LK GD ++ +GP G   Y  N + +L +VAG
Sbjct: 129 ISSKLD-TGHFDLLIKSYADGKVSKYFAGLKPGDTVEFKGPIGELHYAPNSSKALGIVAG 187

Query: 158 GTGIAPMYQIIKAISVNLQDKTKVALVYGNVSEEDILLKKELDAIVESNPDQFKIHYMLD 217
           G+GI P+ Q++  I    +D TK++L+Y N +E DILLK ELD + E  P  F++HY++ 
Sbjct: 188 GSGITPVLQMLNEIITVPEDLTKLSLIYANDTENDILLKDELDEMSEKYP-HFEVHYVVR 246

Query: 218 KPTSETWNGGIGYVTADVMKEYLPAAGEGVQLLVCGPPPMVSSIKRNAVALGFERAKPIS 277
            P SE+W G +G V+ + M++YLP   +  +LL+CGP  M   + + A  LG++++   +
Sbjct: 247 NP-SESWEGDVGLVSKEQMEKYLPKYSDDHRLLICGPEAMEKMVVKYAEELGWKQSVSKN 305

Query: 278 KMGDQIFVF 286
           K  DQ+FVF
Sbjct: 306 KGDDQVFVF 314

>KLLA0C16918g 1478540..1479472 similar to sp|Q12746 Saccharomyces
           cerevisiae YML125c, start by similarity
          Length = 310

 Score =  197 bits (501), Expect = 9e-61,   Method: Compositional matrix adjust.
 Identities = 100/280 (35%), Positives = 165/280 (58%), Gaps = 5/280 (1%)

Query: 7   NSATIFLATVLVIAVFAIINKTLSSKSARPVLIKDQFQDFPLISKTVLTHNTAVYRFGLP 66
           N     L  V++ A+ A   + + ++S    +  D++    L  +T+++ NTA+YRF L 
Sbjct: 36  NDLKFLLGFVILGAILAY--RMVVARSRLKSIYSDRWTALELEDQTIVSKNTAIYRFKLK 93

Query: 67  KPTDVLGLPIGQHISIQGIIDGKEIVRSYTPTSLDSDATGHFELLIKSYEKGNISKMIGE 126
              + L +P G H++++  ++ K+ +R YTP S +   TGHF++++KSY  G +SK    
Sbjct: 94  TSLECLDIPTGHHLAVRIPLEDKDEIRYYTPIS-NKFETGHFDIMVKSYADGQVSKYFAS 152

Query: 127 LKIGDRIKVRGPKGFYTYTANMNSSLAMVAGGTGIAPMYQIIKAISVNLQDKTKVALVYG 186
           L+ G  +  +GP G + Y AN +  + M+AGG+G+ PM Q++  I     D T+V L+Y 
Sbjct: 153 LRPGQTVDFKGPVGRFAYEANSSKHIGMIAGGSGLTPMLQVLNTIITTPTDLTRVTLLYA 212

Query: 187 NVSEEDILLKKELDAIVESNPDQFKIHYMLDKPTSETWNGGIGYVTADVMKEYLPAAGEG 246
           N +E DILLK ELD I E  P+ F +HY+++ P+S +W G +G+VT ++M +YLP     
Sbjct: 213 NETENDILLKDELDEISEKYPN-FLVHYLVNHPSS-SWQGEVGWVTKEIMSKYLPDPSAE 270

Query: 247 VQLLVCGPPPMVSSIKRNAVALGFERAKPISKMGDQIFVF 286
            +LL+CG P M  ++ + A  LG+ +    S   DQ+FVF
Sbjct: 271 NRLLICGKPEMKKTLLKYAEELGWPKGILKSNPDDQVFVF 310

>AFR439C [3631] [Homologous to ScYML125C - SH; ScYML087C - SH]
           (1228716..1229648) [933 bp, 310 aa]
          Length = 310

 Score =  195 bits (496), Expect = 6e-60,   Method: Compositional matrix adjust.
 Identities = 102/275 (37%), Positives = 160/275 (58%), Gaps = 4/275 (1%)

Query: 12  FLATVLVIAVFAIINKTLSSKSARPVLIKDQFQDFPLISKTVLTHNTAVYRFGLPKPTDV 71
           +L  +L +A+F      L+ +S R  ++ +++    L  + VL+ N A+YRF L    + 
Sbjct: 40  YLLGILALAMFVGARLLLAYRS-RTSILPNEWTPLELEERIVLSKNAAIYRFKLRSSVET 98

Query: 72  LGLPIGQHISIQGIIDGKEIVRSYTPTSLDSDATGHFELLIKSYEKGNISKMIGELKIGD 131
           L +P G H++ + ++DG E VR YTP S +  A GHF++++KSY  G +SK    L+ G 
Sbjct: 99  LDIPTGFHLAAKVMLDGVEEVRYYTPIS-NKFAEGHFDIIVKSYVDGKVSKWFAGLQPGQ 157

Query: 132 RIKVRGPKGFYTYTANMNSSLAMVAGGTGIAPMYQIIKAISVNLQDKTKVALVYGNVSEE 191
            ++ +GP G ++Y  N    + MV GG+ I PM  ++  I    +D T+V L+Y N +E 
Sbjct: 158 TVEFKGPVGRFSYVTNAYKKIGMVTGGSAITPMLSVLNKIVTTPEDTTQVCLIYANETEN 217

Query: 192 DILLKKELDAIVESNPDQFKIHYMLDKPTSETWNGGIGYVTADVMKEYLPAAGEGVQLLV 251
           DILLK ELD +    P+ F++HY++ KP S +W G +GYVT   +++YLP      +LL+
Sbjct: 218 DILLKDELDDLASKYPN-FEVHYVVRKP-SASWTGEVGYVTKQHLEKYLPPCNPAHRLLI 275

Query: 252 CGPPPMVSSIKRNAVALGFERAKPISKMGDQIFVF 286
           CGPP M   +   A  LG+ +    SK  DQ+FVF
Sbjct: 276 CGPPKMKQMVLEYAEQLGWPKGAMKSKPEDQVFVF 310

>Kwal_33.14260
          Length = 308

 Score =  194 bits (494), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 100/271 (36%), Positives = 160/271 (59%), Gaps = 3/271 (1%)

Query: 16  VLVIAVFAIINKTLSSKSARPVLIKDQFQDFPLISKTVLTHNTAVYRFGLPKPTDVLGLP 75
           +L  A   +  + L++   R  +  D++    L  +T+L+ NTA+YRF +    + L  P
Sbjct: 41  ILPFAAVIVGFRFLTAYKRRKSVFPDKWSALELEDQTLLSKNTAMYRFKMKTSFETLNFP 100

Query: 76  IGQHISIQGIIDGKEIVRSYTPTSLDSDATGHFELLIKSYEKGNISKMIGELKIGDRIKV 135
           +G H++++  IDGK+ +R YTP S      G+F++++KSY  G +SK    LK G  +  
Sbjct: 101 VGHHLAVRVPIDGKDQIRYYTPVSPQYQP-GYFDIIVKSYADGQVSKYFAGLKAGSAVDF 159

Query: 136 RGPKGFYTYTANMNSSLAMVAGGTGIAPMYQIIKAISVNLQDKTKVALVYGNVSEEDILL 195
           +GP G + Y  N    + M+AGG+GI PM QI+  I    +D TKV+L+Y N +E DILL
Sbjct: 160 KGPVGRFNYVVNSYKQIGMIAGGSGITPMLQILNKIITTPEDLTKVSLIYANETENDILL 219

Query: 196 KKELDAIVESNPDQFKIHYMLDKPTSETWNGGIGYVTADVMKEYLPAAGEGVQLLVCGPP 255
           K+E+D I E  P+ F++HY+L  P+S TW G +G VT ++M++YLP +    +L++ G P
Sbjct: 220 KEEIDEIAEKYPN-FEVHYVLRTPSS-TWKGDVGLVTNELMQKYLPISSSDNRLVMSGKP 277

Query: 256 PMVSSIKRNAVALGFERAKPISKMGDQIFVF 286
            M+  +   A  LG+ +    SK  D++F F
Sbjct: 278 EMIRMLLEYAEELGWPKGIEKSKGDDRVFAF 308

>YML087C (YML087C) [3882] chr13 complement(94431..95369) Protein
           containing an oxidoreductase FAD-binding domain and an
           oxidoreductase FAD or NAD-binding domain, has moderate
           similarity to cytochrome b5 reductase (S. cerevisiae
           Cbr1p), which converts 2 ferricytochrome B5 + NADH to 2
           ferrocytochrome B5 + NAD(+) [939 bp, 312 aa]
          Length = 312

 Score =  192 bits (487), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 93/249 (37%), Positives = 155/249 (62%), Gaps = 3/249 (1%)

Query: 38  LIKDQFQDFPLISKTVLTHNTAVYRFGLPKPTDVLGLPIGQHISIQGIIDGKEIVRSYTP 97
           L ++++   PL  KT ++ NT++Y F L  P + L +P+G H++++  I+G+ +VR YTP
Sbjct: 67  LYRNKWVALPLSKKTRISRNTSLYCFKLKYPFERLHIPMGYHLAVRVTINGERLVRYYTP 126

Query: 98  TSLDSDATGHFELLIKSYEKGNISKMIGELKIGDRIKVRGPKGFYTYTANMNSSLAMVAG 157
            ++  +  GH EL++K+Y+ G +SK   +LKI   ++ +GP G   Y  +  + L ++AG
Sbjct: 127 VNV-PNTEGHLELVVKTYKHGVVSKYFDKLKIRQYVEFKGPLGELEYDQDTATELGIIAG 185

Query: 158 GTGIAPMYQIIKAISVNLQDKTKVALVYGNVSEEDILLKKELDAIVESNPDQFKIHYMLD 217
           G+GI P+ Q+++ I  + +D T ++L+Y N +E+DIL+K +LD + +  P  FK+HY++ 
Sbjct: 186 GSGITPVLQVLQEIIPSPEDLTHISLIYANETEDDILMKSQLDHMAKEYP-HFKVHYVIH 244

Query: 218 KPTSETWNGGIGYVTADVMKEYLPAAGEGVQLLVCGPPPMVSSIKRNAVALGFERAKPIS 277
           KP  + WNG +GYVT + MK YLP   E  +LL+CGPP M   +   A  LG+       
Sbjct: 245 KPNGK-WNGDVGYVTLEEMKRYLPKQAEDHRLLICGPPKMNEMVLNYAKELGWSNGFHKG 303

Query: 278 KMGDQIFVF 286
              D++FVF
Sbjct: 304 NGTDKVFVF 312

>YML125C (YML125C) [3847] chr13 complement(20762..21700) Protein
           with similarity to NADH-cytochrome b5 reductase [939 bp,
           312 aa]
          Length = 312

 Score =  190 bits (482), Expect = 6e-58,   Method: Compositional matrix adjust.
 Identities = 106/284 (37%), Positives = 160/284 (56%), Gaps = 3/284 (1%)

Query: 3   ISSMNSATIFLATVLVIAVFAIINKTLSSKSARPVLIKDQFQDFPLISKTVLTHNTAVYR 62
           I++  S  + +   L I    I  +  S+   R  L  D++    L  +T+++ NTA+YR
Sbjct: 32  ITTYMSGELKILWSLPILFMIIFVRAYSAYKRRRSLYPDRWTSLELEDQTIISKNTALYR 91

Query: 63  FGLPKPTDVLGLPIGQHISIQGIIDGKEIVRSYTPTSLDSDATGHFELLIKSYEKGNISK 122
           F L    + L +P G H++++  IDGK+ VR Y P S   + +G+ +L++K+Y  G +SK
Sbjct: 92  FKLKTRLESLDIPAGHHVAVRVPIDGKQEVRYYNPISSKLE-SGYLDLVVKAYVDGKVSK 150

Query: 123 MIGELKIGDRIKVRGPKGFYTYTANMNSSLAMVAGGTGIAPMYQIIKAISVNLQDKTKVA 182
               L  GD +  +GP G   Y  N +  L +VAGG+GI P+ QI+  I    +D TKV+
Sbjct: 151 YFAGLNSGDTVDFKGPIGTLNYEPNSSKHLGIVAGGSGITPVLQILNEIITVPEDLTKVS 210

Query: 183 LVYGNVSEEDILLKKELDAIVESNPDQFKIHYMLDKPTSETWNGGIGYVTADVMKEYLPA 242
           L+Y N +E DILLK ELD + E  P  F++HY++  P S+ W G +GY+T D M  YLP 
Sbjct: 211 LLYANETENDILLKDELDEMAEKYP-HFQVHYVVHYP-SDRWTGDVGYITKDQMNRYLPE 268

Query: 243 AGEGVQLLVCGPPPMVSSIKRNAVALGFERAKPISKMGDQIFVF 286
             E  +LL+CGP  M +   + A  LG++     S   DQ+FVF
Sbjct: 269 YSEDNRLLICGPDGMNNLALQYAKELGWKVNSTRSSGDDQVFVF 312

>CAGL0B02519g 240486..241424 highly similar to sp|Q12746
           Saccharomyces cerevisiae YML125c, start by similarity
          Length = 312

 Score =  189 bits (480), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 93/252 (36%), Positives = 150/252 (59%), Gaps = 3/252 (1%)

Query: 35  RPVLIKDQFQDFPLISKTVLTHNTAVYRFGLPKPTDVLGLPIGQHISIQGIIDGKEIVRS 94
           R  L  D++    L  +T+++ NTA+YRF L  P + + +P G H+ ++  IDGKE VR+
Sbjct: 64  RRSLYPDKWTSLELEDQTLISRNTAIYRFKLKTPLETIDIPSGHHVQVRVFIDGKEEVRN 123

Query: 95  YTPTSLDSDATGHFELLIKSYEKGNISKMIGELKIGDRIKVRGPKGFYTYTANMNSSLAM 154
           Y P S   +  GH +LL+KSY+ G +SK    +K G+ +  RGP G   Y  N   ++ M
Sbjct: 124 YNPISTRFEK-GHIDLLVKSYKDGKVSKYFASMKPGETVDFRGPVGSLVYKPNTYKNIGM 182

Query: 155 VAGGTGIAPMYQIIKAISVNLQDKTKVALVYGNVSEEDILLKKELDAIVESNPDQFKIHY 214
           V GG+GI P  Q++  I    +D TK++L+Y N +E+DILLK+ELD + E  P  F +HY
Sbjct: 183 VCGGSGITPALQMLNDIITVPEDLTKLSLIYCNETEKDILLKEELDEMAEKYP-HFNVHY 241

Query: 215 MLDKPTSETWNGGIGYVTADVMKEYLPAAGEGVQLLVCGPPPMVSSIKRNAVALGFERAK 274
           ++ +PT + W G +G+++ + M ++LP   +  +LL+CGP      +   A  +G++   
Sbjct: 242 IVSQPTGQ-WEGEVGHISKETMVKHLPHPADDSRLLICGPEGFTQKVFDQAKEIGWKMDY 300

Query: 275 PISKMGDQIFVF 286
             +K  +Q+FVF
Sbjct: 301 TKTKGDEQVFVF 312

>KLLA0D04488g complement(381861..382751) similar to sp|P36060
           Saccharomyces cerevisiae YKL150w MCR1 cytochrome-b5
           reductase, start by similarity
          Length = 296

 Score =  157 bits (396), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 85/248 (34%), Positives = 133/248 (53%), Gaps = 3/248 (1%)

Query: 14  ATVLVIAVFAIINKTLSSKSARPVLIKDQFQDFPLISKTVLTHNTAVYRFGLPKPTDVLG 73
           A  +  A+    N ++ + +++  L  +++ D P+I    L+H+T  + F LPK   V G
Sbjct: 20  AASIATAIILQRNYSIMNDTSKAFLGDNEWIDLPIIKIEKLSHDTKRFTFALPKKDQVSG 79

Query: 74  LPIGQHISIQGII-DGKEIVRSYTPTSLDSDATGHFELLIKSYEKGNISKMIGELKIGDR 132
           L     I  + +   G  ++R YTP S D+   G  EL++K YE G  +  +  LK  D 
Sbjct: 80  LITASCILAKFVTPKGSNVIRPYTPVS-DNGTKGKMELVVKHYENGKFTSHLFGLKENDT 138

Query: 133 IKVRGPKGFYTYTANMNSSLAMVAGGTGIAPMYQIIKAISVNLQDKTKVALVYGNVSEED 192
           +  +GP   + +  N   S+ ++  GTGI P+YQ++  I+ N +D TK+ L YGN + ED
Sbjct: 139 VSFKGPITKWEWKPNSYDSITLLGAGTGINPLYQLVHHIAENPEDNTKIHLYYGNKTPED 198

Query: 193 ILLKKELDAIVESNPDQFKIHYMLDKPTSETWNGGIGYVTADVMKEYLPAAGEGVQLLVC 252
           ILLK ELD + +  PDQ KI Y +DK     + G  G++T D +    P   E  Q+ VC
Sbjct: 199 ILLKSELDNLQKKYPDQVKITYFVDK-AEGNFEGETGFITKDYLSHQAPKPSEKNQVFVC 257

Query: 253 GPPPMVSS 260
           GPPP + +
Sbjct: 258 GPPPFMKA 265

>ACR054C [1102] [Homologous to ScYKL150W (MCR1) - SH]
           (454023..454943) [921 bp, 306 aa]
          Length = 306

 Score =  154 bits (389), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 78/215 (36%), Positives = 124/215 (57%), Gaps = 3/215 (1%)

Query: 54  LTHNTAVYRFGLPKPTDVLGLPIGQHISIQGII-DGKEIVRSYTPTSLDSDATGHFELLI 112
           ++H+T  + F LP    V GL     +  + +   G  ++R YTP S D+ A G F+L+I
Sbjct: 70  VSHDTRRFTFALPSQDHVTGLTTASALLAKYVTPKGSNVIRPYTPVS-DNMARGMFQLVI 128

Query: 113 KSYEKGNISKMIGELKIGDRIKVRGPKGFYTYTANMNSSLAMVAGGTGIAPMYQIIKAIS 172
           K Y+ G  +  +  LK  D ++ +GP   + +  NM  S+ ++  GTGI P++Q++  I+
Sbjct: 129 KHYDGGKFTTHLFGLKENDTVEFKGPIQKWRWDPNMFDSIVLMGAGTGITPLFQMMHHIA 188

Query: 173 VNLQDKTKVALVYGNVSEEDILLKKELDAIVESNPDQFKIHYMLDKPTSETWNGGIGYVT 232
            N  D TKV L+YGN + +DILL+KEL+ +    PDQ K+ Y +DKP  + + G  G++T
Sbjct: 189 ENPTDNTKVHLLYGNKTPQDILLRKELEELASKYPDQVKVTYFVDKPEGD-YKGEKGFIT 247

Query: 233 ADVMKEYLPAAGEGVQLLVCGPPPMVSSIKRNAVA 267
            D +K+ LP  G    + VCGPPP + +   N V+
Sbjct: 248 KDFLKQNLPTPGSNSHIFVCGPPPFMDAFSGNKVS 282

>YKL150W (MCR1) [3118] chr11 (166549..167457) NADH-cytochrome b5
           reductase, mitochondrial protein that may be involved in
           the response to oxidative damage [909 bp, 302 aa]
          Length = 302

 Score =  150 bits (378), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 88/258 (34%), Positives = 138/258 (53%), Gaps = 9/258 (3%)

Query: 11  IFLATVLVIAV--FAIINKTLSS----KSARPVLIKDQFQDFPLISKTVLTHNTAVYRFG 64
           I L TV + A   F   N+   S    +S +     D++ D P+      +H+T  + F 
Sbjct: 15  IALGTVAIAAATAFYFANRNQHSFVFNESNKVFKGDDKWIDLPISKIEEESHDTRRFTFK 74

Query: 65  LPKPTDVLGLPIGQHISIQGII-DGKEIVRSYTPTSLDSDATGHFELLIKSYEKGNISKM 123
           LP     +GL +   +  + +   G  +VR YTP S D    GHF+L++K YE G ++  
Sbjct: 75  LPTEDSEMGLVLASALFAKFVTPKGSNVVRPYTPVS-DLSQKGHFQLVVKHYEGGKMTSH 133

Query: 124 IGELKIGDRIKVRGPKGFYTYTANMNSSLAMVAGGTGIAPMYQIIKAISVNLQDKTKVAL 183
           +  LK  D +  +GP   + +  N   S+ ++  GTGI P+YQ+   I  N  DKTKV L
Sbjct: 134 LFGLKPNDTVSFKGPIMKWKWQPNQFKSITLLGAGTGINPLYQLAHHIVENPNDKTKVNL 193

Query: 184 VYGNVSEEDILLKKELDAIVESNPDQFKIHYMLDKPTSETWNGG-IGYVTADVMKEYLPA 242
           +YGN + +DILL+KELDA+ E  PD+F + Y +D    +    G I +++ D ++E++P 
Sbjct: 194 LYGNKTPQDILLRKELDALKEKYPDKFNVTYFVDDKQDDQDFDGEISFISKDFIQEHVPG 253

Query: 243 AGEGVQLLVCGPPPMVSS 260
             E   L VCGPPP +++
Sbjct: 254 PKESTHLFVCGPPPFMNA 271

>Kwal_23.5471
          Length = 312

 Score =  149 bits (377), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 78/226 (34%), Positives = 129/226 (57%), Gaps = 13/226 (5%)

Query: 41  DQFQDFPLISKTVLTHNTAVYRFGLPKPTDVLGLPIGQHISIQGII------DGKEIVRS 94
           D + + P+     ++H+T  + F LP+   V GL     I+   ++       G  ++R 
Sbjct: 63  DSWVELPIAKIEDVSHDTRRFVFSLPQEDQVSGL-----ITASALLAKLQTPKGSNVIRP 117

Query: 95  YTPTSLDSDATGHFELLIKSYEKGNISKMIGELKIGDRIKVRGPKGFYTYTANMNSSLAM 154
           YTP S D    GH E +IK Y+ G +++M+ + K  D +  +GP   + +  N   S+ +
Sbjct: 118 YTPVS-DVSTKGHIEFVIKHYKGGKMTEMLFDKKPSDTVAFKGPIIKWEWKPNSFDSITL 176

Query: 155 VAGGTGIAPMYQIIKAISVNLQDKTKVALVYGNVSEEDILLKKELDAIVESNPDQFKIHY 214
           +  G+GI P+YQ++  IS N +DKTK+ L+YGN +  DILLKKEL+ +     DQ KIH+
Sbjct: 177 IGAGSGITPLYQLLHHISQNPEDKTKIHLLYGNKTPNDILLKKELEEVQAKYADQVKIHF 236

Query: 215 MLDKPTSETWNGGIGYVTADVMKEYLPAAGEGVQLLVCGPPPMVSS 260
            +DK     ++G IG++T + +++ +P A E  Q+ VCGPPP + +
Sbjct: 237 FVDK-AEGPFDGEIGFITKEFLEKNVPKASEKNQVFVCGPPPFMQA 281

>CAGL0E06424g 644026..644922 similar to sp|P36060 Saccharomyces
           cerevisiae YKL150w MCR1 cytochrome-b5 reductase, start
           by similarity
          Length = 298

 Score =  148 bits (374), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 92/283 (32%), Positives = 150/283 (53%), Gaps = 11/283 (3%)

Query: 13  LATVLVIAVFAIINKTLSSKSARP-VLIKDQ-FQDFPLISKTVLTHNTAVYRFGLPKPTD 70
           +  V V A    +N   + K+  P V I D+ + D  L      +H+T  + F LP    
Sbjct: 18  IGAVAVTAGALYLNGWNTIKNENPKVFIGDRKWIDLELEKIIEESHDTKRFFFKLPTDDS 77

Query: 71  VLGLPIGQHISIQGII-DGKEIVRSYTPTSLDSDATGHFELLIKSYEKGNISKMIGELKI 129
           V GL +   +  + +   G  ++R YTP S D    G+ E +IK YE G ++  + +LK 
Sbjct: 78  VSGLTLASAVLTKFMTPKGNPVIRPYTPVS-DLSEKGYIEFVIKHYEGGKMTDHLFQLKP 136

Query: 130 GDRIKVRGPKGFYTYTANMNSSLAMVAGGTGIAPMYQIIKAISVNLQDKTKVALVYGNVS 189
            D +  +GP   + +  N   ++ ++ GGTGI P+YQ++  I+ N +DKTK+ L YG+ +
Sbjct: 137 KDTLAFQGPIPKWQWKPNSFDTITLLGGGTGITPLYQLVHHITQNKEDKTKINLFYGSKT 196

Query: 190 EEDILLKKELDAIVESNPDQFKIHYMLDKPTSETWNGGIGYVTADVMKEYLPAAGEGVQL 249
             DILLKKELD + +  P+Q  I Y +DK  +  ++G  G++T D + +  P   E  Q+
Sbjct: 197 PSDILLKKELDDLQKKYPEQLNIQYFVDKDDTGKFDGNKGFITKDFLAKNAPGPKEKTQV 256

Query: 250 LVCGPPPMVSSI---KRNAVALGFERAKPISKMG---DQIFVF 286
            VCGPPP + S+   K++ +  G +    +  +G   DQ+F F
Sbjct: 257 FVCGPPPFMDSLSGQKKSPMEQG-DLTGALKDLGYSQDQVFKF 298

>Scas_678.6
          Length = 299

 Score =  144 bits (362), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 90/282 (31%), Positives = 139/282 (49%), Gaps = 23/282 (8%)

Query: 20  AVFAIINKTLSSKSARPVLIKD-QFQDFPLISKTVLTHNTAVYRFGLPKPTDVLGLPIGQ 78
           A F    +    K  + V + D  + D P++     +H+T  + F LP    + GL +  
Sbjct: 26  AYFYTRPRVAVQKEKQRVFVGDGNWIDLPIVKIEDESHDTKRFTFKLPSEDAITGLTLAS 85

Query: 79  HISIQGII-DGKEIVRSYTPTSLDSDATGHFELLIKSYEKGNISKMIGELKIGDRIKVRG 137
            I  + +   G  +VR YTP S   D  G FEL+IK Y  G +S  +  LK  D +  +G
Sbjct: 86  AIFTKYVTAKGNNVVRPYTPVS-PLDQQGTFELVIKHYNDGKMSSHLFSLKPNDVVSFKG 144

Query: 138 PKGFYTYTANMNSSLAMVAGGTGIAPMYQIIKAISVNLQDKTKVALVYGNVSEEDILLKK 197
           P   + +  N   S+ ++  GTG  P+YQ+   I+ N +DKTK+ + YGN +  DILLKK
Sbjct: 145 PIKKWQWVPNSFKSITLLGAGTGTTPLYQLASHIARNPEDKTKINVFYGNKTSSDILLKK 204

Query: 198 ELDAIVESNPDQFKIHYMLDKPTSETWNG-GIGYVTADVMKEYLPAAGEGVQLLVCGPPP 256
           E + + E  PDQ K+ Y +DK      NG  +G+++ + + +  P   E   L +CGPPP
Sbjct: 205 EWNELQEKYPDQVKVTYFVDKLDDGKENGVELGFISKEFIAKNAPGPKEDTHLFICGPPP 264

Query: 257 MVSSIKRNAVALGFERAKP---------ISKMG---DQIFVF 286
            +        A   E+AKP         + ++G   DQ+F F
Sbjct: 265 FMK-------AYSGEKAKPTDQGELTGLLQELGYSKDQVFKF 299

>Scas_699.41
          Length = 318

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 24/97 (24%), Positives = 44/97 (45%), Gaps = 15/97 (15%)

Query: 91  IVRSYTPTSL-------------DSDATGHFELLIKSYEKGNISKMIGELKIGDRIKVRG 137
           +VR+YTP  L             D + TG     +K Y  G +++ +  L +   +++RG
Sbjct: 101 VVRNYTPVPLSFVQDHNDLIPMTDKNDTGKLVFYLKQYSNGEVARWLHRLPVNSTVEIRG 160

Query: 138 PKGFYTY--TANMNSSLAMVAGGTGIAPMYQIIKAIS 172
           P   Y +  T N    ++M   G G+   +Q++ + S
Sbjct: 161 PFIDYKFQETDNTKFDVSMFTAGAGVVTAFQLLLSPS 197

>KLLA0E21901g 1946190..1947263 similar to sp|P38909 Saccharomyces
           cerevisiae YOR037w CYC2 cytochrome-c mitochondrial
           import factor singleton, hypothetical start
          Length = 357

 Score = 38.9 bits (89), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 27/114 (23%), Positives = 45/114 (39%), Gaps = 37/114 (32%)

Query: 91  IVRSYTPTSL-------------DSDATGHFELLIKSYEKGNISKMIGELKIGDRIKVRG 137
           +VRSYTP  L             + +A+G     IK Y++G +++ I  L +G  +++RG
Sbjct: 116 VVRSYTPLPLTIEENGAVEVLRDEENASGALTFYIKQYKQGEVARWINHLPLGHVLELRG 175

Query: 138 PKGFYTYTANMNS------------------------SLAMVAGGTGIAPMYQI 167
           P   Y +    +                          +    GGTGI P+ Q+
Sbjct: 176 PFVEYEFPDTADEITRDRSFLWGNEDCVKDNYKYQPFDILFFTGGTGIVPLLQM 229

>CAGL0I00990g complement(81437..82468) similar to sp|P38909
           Saccharomyces cerevisiae YOR037w CYC2, hypothetical
           start
          Length = 343

 Score = 37.7 bits (86), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 29/109 (26%), Positives = 46/109 (42%), Gaps = 31/109 (28%)

Query: 91  IVRSYTPTSLDSDATGHFELL--------------IKSYEKGNISKMIGELKIGDRIKVR 136
           +VR+YTP  L   + G+   L              IKSY  G +++ I  L +G  +++R
Sbjct: 120 VVRNYTPLPLQLKSNGNIVPLDLNDPVESKKLLFYIKSYNNGEVARWIKSLPVGSTLELR 179

Query: 137 GPKGFYTYTANMN-----------------SSLAMVAGGTGIAPMYQII 168
           GP   Y +  +++                 S++   AGGTGI    Q I
Sbjct: 180 GPFIDYKFRNDLSKHHRDANGSTLINKTQLSNVPFFAGGTGIVTALQPI 228

>Kwal_55.21561
          Length = 349

 Score = 37.4 bits (85), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 26/114 (22%), Positives = 47/114 (41%), Gaps = 36/114 (31%)

Query: 91  IVRSYTPTSLDSDATGHFELL-------------IKSYEKGNISKMIGELKIGDRIKVRG 137
           +VR+YTP  L    +G F++L             +K Y+ G +++ +  L  G  +++RG
Sbjct: 109 VVRNYTPLPLQHVGSGEFKVLADGDNGQGKLSFYLKKYQYGEVARWLSRLPEGHILELRG 168

Query: 138 PKGFYTYTANMNSS-----------------------LAMVAGGTGIAPMYQII 168
           P   Y + +  N                         ++    GTGIAP+ Q++
Sbjct: 169 PYIDYEFPSMDNGEKLDRSFLWGAKPSSDKLMIQPFDISAFTAGTGIAPIMQLL 222

>Scas_595.11
          Length = 398

 Score = 37.4 bits (85), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 53/257 (20%), Positives = 111/257 (43%), Gaps = 50/257 (19%)

Query: 21  VFAIINKTLSSKSARPVLIKDQFQDFPLISKTVLTHNTAVYRFGLPKPTDVLGLPIGQHI 80
           VF  + K + ++ A P      ++ F ++ K ++ ++  VY F + KPT   G+    ++
Sbjct: 132 VFITVEKEMYAEQAWP-----GWKPFTVVDKELVAND--VYAFTV-KPTTESGI----NL 179

Query: 81  SIQGIIDGKEIVRSYTPTSLDS--DATGHFELLI----------------KSYEKGNISK 122
           S   I+ G+ I  +  P   D+  DA  H+ L                  K++  G +S+
Sbjct: 180 STLPIVAGQYITVNTHPVRQDNQYDALRHYSLCSISTKDGLKFAVKLETDKTHPAGLVSE 239

Query: 123 MIG-ELKIGDRIKVRGPKGFYTYTANM----NSSLAMVAGGTGIAPMYQIIKAISVNLQD 177
            +  ++K+GD +K+  P G +  T  +       L +++ G G+ P+  +++   V    
Sbjct: 240 FLHKDVKVGDELKLSAPAGDFALTDKLIHQNEIPLVLLSAGVGVTPILAMLEK-QVTENP 298

Query: 178 KTKVALVYGNVSEEDILLKKELDAIVESNPDQFK-IHYMLDKPTSETWNGGIGYVTADVM 236
              +  +  + +E     KK +D +++      K I Y   +P           + A+ +
Sbjct: 299 NRPIYWIQSSYNEGTQSFKKHVDELLDKATTTKKTILYTDTQPA----------IDAEFL 348

Query: 237 KEYLPAAGEGVQLLVCG 253
           +E +PA  +   + +CG
Sbjct: 349 QEQIPANAD---VYLCG 362

>Sklu_2216.5 YPR048W, Contig c2216 7954-9816 reverse complement
          Length = 620

 Score = 35.8 bits (81), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 24/100 (24%), Positives = 51/100 (51%), Gaps = 6/100 (6%)

Query: 108 FELLIKSYEKGNISKMIGELKIGDRIKVRGPKGFYTYTANMNSSLAMVAGGTGIAPMYQI 167
           +  +++   KG  +  I  L   D+I+ +  + F   ++     + M++ G G+APM  +
Sbjct: 432 YRTILRRIRKGLCTDYIISLSGNDKIRYKLQRNFLLNSSMKGKPIIMISPGVGLAPMMSL 491

Query: 168 IKAISVNLQDKTKVALVYGN-VSEEDILLKKELDAIVESN 206
           I+  S   +D   + L +GN +  +D L +++L+   +SN
Sbjct: 492 IR--SGFFED---MHLFFGNRIKSKDFLYREDLEKWNDSN 526

>YOR037W (CYC2) [4849] chr15 (401554..402654) Cytochrome c
           mitochondrial import factor, primarily involved in
           import of Cyc1p and also involved in import of Cyc7p
           [1101 bp, 366 aa]
          Length = 366

 Score = 35.4 bits (80), Expect = 0.058,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 29/62 (46%), Gaps = 14/62 (22%)

Query: 91  IVRSYTPTSL-------------DSD-ATGHFELLIKSYEKGNISKMIGELKIGDRIKVR 136
           +VR+YTP  L             D D A G     IK YE G +++ +  L  G  I++R
Sbjct: 116 VVRNYTPLPLKFNPASKEIEILKDGDNADGKLSFYIKKYENGEVARWLHHLPKGHIIEIR 175

Query: 137 GP 138
           GP
Sbjct: 176 GP 177

>Scas_690.29
          Length = 688

 Score = 34.7 bits (78), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 31/117 (26%), Positives = 54/117 (46%), Gaps = 13/117 (11%)

Query: 146 ANMNSSLAMVAGGTGIAP----MYQIIKAISVNLQDKT--KVALVYGNVSEEDILLKKEL 199
           +N  + + MV  GTG+AP    + + +K +  N  + T  K  L YG+ + +D L K+E 
Sbjct: 530 SNPQTPIIMVGPGTGVAPFRAFIRERVKFLETNNDNLTLGKHLLFYGSRNHDDFLYKEEW 589

Query: 200 DAIVESNPDQFKI---HYMLDKPTSETWNGGIGYVTADVMKEYLPAAGEGVQLLVCG 253
               E   D F++   H  LD P  + +   + +   +  +E      +G  + VCG
Sbjct: 590 PIYAEKLGDSFEMIVAHSRLD-PGKKVY---VQHNLKERSEEVFQLISQGAFIYVCG 642

>ACR090C [1137] [Homologous to ScYOR037W (CYC2) - SH]
           (519431..520531) [1101 bp, 366 aa]
          Length = 366

 Score = 32.3 bits (72), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 28/62 (45%), Gaps = 14/62 (22%)

Query: 91  IVRSYTPTSLDSDATGH--------------FELLIKSYEKGNISKMIGELKIGDRIKVR 136
           +VR YTP  L +D  G                 L IK Y  G +++ + +L  G  ++VR
Sbjct: 124 VVRQYTPLPLVADEDGEQLRALRDGDNGGGKLMLYIKEYGSGEVARWLRKLPKGHIVEVR 183

Query: 137 GP 138
           GP
Sbjct: 184 GP 185

>CAGL0H08580g complement(841038..842903) highly similar to tr|Q12181
           Saccharomyces cerevisiae YPR048w TAH18, hypothetical
           start
          Length = 621

 Score = 32.0 bits (71), Expect = 0.83,   Method: Compositional matrix adjust.
 Identities = 23/115 (20%), Positives = 54/115 (46%), Gaps = 6/115 (5%)

Query: 108 FELLIKSYEKGNISKMIGELKIGDRIKVRGPKGFYTYTANMNSSLAMVAGGTGIAPMYQI 167
           ++ +++    G  +  I +LK+GD+I+ +  +         ++   MV  G G+AP+   
Sbjct: 433 YKTILRKIRTGVCTDFISKLKVGDKIRYKIQQNDLIKEEYRSNPFVMVGPGVGLAPLLSA 492

Query: 168 IKAISVNLQDKTKVALVYG-NVSEEDILLKKELDAIVESNPDQFKIHYMLDKPTS 221
           +++     +   +++L +G    ++D L  KEL+ +      +F   +  D+  S
Sbjct: 493 VRS-----KVSPEMSLYFGCRFKDKDYLHGKELEDMANQGLIKFYPVFSRDRENS 542

>YPR048W (TAH18) [5480] chr16 (659177..661048) Protein of unknown
           function, has similarity to NAPDH-cytochrome P450
           reductases [1872 bp, 623 aa]
          Length = 623

 Score = 31.6 bits (70), Expect = 0.99,   Method: Compositional matrix adjust.
 Identities = 29/145 (20%), Positives = 62/145 (42%), Gaps = 15/145 (10%)

Query: 108 FELLIKSYEKGNISKMIGELKIGDRIKVRGPKGFYTYTANMNSSLAMVAGGTGIAPMYQI 167
           ++ +++   +G  +  I  L+ G++I+ +           +N  + +V  G G+AP+  +
Sbjct: 435 YKTILRKIRRGICTNYIARLQEGEQIRYKLQNNHIIKKEFLNKPMILVGPGVGLAPLLSV 494

Query: 168 IKAISVNLQDKTKVALVYG-NVSEEDILLKKELDAIVESNPDQFKIHYMLDKPTSETWNG 226
           +KA     +    + L++G    ++D + K  L+             +  D+  S     
Sbjct: 495 VKA-----EISKDIKLLFGCRYKDKDYIYKDMLEDWFRKGKIALHSSFSRDEENSP---- 545

Query: 227 GIGYVTADVMKEYLPAAGEGVQLLV 251
           G+ YV     ++YL   GE +  LV
Sbjct: 546 GVKYV-----QDYLWRLGEEITNLV 565

>Scas_718.19
          Length = 616

 Score = 31.6 bits (70), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 16/63 (25%), Positives = 29/63 (46%)

Query: 108 FELLIKSYEKGNISKMIGELKIGDRIKVRGPKGFYTYTANMNSSLAMVAGGTGIAPMYQI 167
           +  +++   KG  +  I  LK GD ++ +               + +V+ G GIAP+  I
Sbjct: 428 YRTILRKIRKGVCTDYIAHLKEGDHLRYKIQHNNLVRDNYHGRPMILVSPGVGIAPLMSI 487

Query: 168 IKA 170
           +KA
Sbjct: 488 VKA 490

>KLLA0C18931g 1680133..1681794 gi|29124348|gb|AAO47086.1
           Kluyveromyces lactis drug efflux permease KNQ1, start by
           similarity
          Length = 553

 Score = 31.2 bits (69), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 25/83 (30%), Positives = 39/83 (46%), Gaps = 5/83 (6%)

Query: 5   SMNSATIFLATVLVIAVFAIINKTLSSKSAR---PVLIKDQFQDFPLISKTVLTHNTAVY 61
           S N   + LAT  +   F ++   +++ SA      +I    +  P+IS  VL + T  Y
Sbjct: 306 SHNFIPVLLATFFLFCGFMVVMYVIANYSATVEGNSMIVASIKIIPMISGLVLANGTVAY 365

Query: 62  RFGLPKPTDVLGLPIGQHISIQG 84
           +  L KP +   L +G  ISI G
Sbjct: 366 KQDLFKPKN--ALVVGSFISILG 386

>YKL220C (FRE2) [3055] chr11 complement(9092..11227) Ferric and
           cupric reductase, paralog of Fre1p subject to regulation
           by iron [2136 bp, 711 aa]
          Length = 711

 Score = 30.8 bits (68), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 35/139 (25%), Positives = 65/139 (46%), Gaps = 12/139 (8%)

Query: 38  LIKDQFQDFPLISKTVLTHNTAVYRFGLPKPTDVLGLPIGQHISIQGIIDGKEIVRSYTP 97
           +IK  +  FP  S  ++  +  + R  + KP        GQ++ +   +      +S+  
Sbjct: 425 IIKASYFGFPKASLQLIGDD--LIRLTVKKPARPWRAKPGQYVFVS-FLHPLYFWQSHPF 481

Query: 98  TSLDSDATGHFELLIKSYEKGNISKMIGEL------KIGDRIKVRGPKGFYTYTANMNSS 151
           T LDS  + + EL+I   EK  +++++ +       K   R+ + GP G  +   N N+ 
Sbjct: 482 TVLDS-VSKNGELVIILKEKKGVTRLVKKYVCRNGGKTSMRLAIEGPYGSSSPVNNYNNV 540

Query: 152 LAMVAGGTGI-APMYQIIK 169
           L ++ GGTG+  P+   IK
Sbjct: 541 L-LLTGGTGLPGPIAHAIK 558

>YOR384W (FRE5) [5157] chr15 (1061560..1063644) Protein with
           similarity to Fre2p, subject to regulation by iron [2085
           bp, 694 aa]
          Length = 694

 Score = 30.4 bits (67), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 33/108 (30%), Positives = 52/108 (48%), Gaps = 7/108 (6%)

Query: 132 RIKVRGPKGFYTYTANMNSSLAMVAGGTGI-APMYQIIKA-ISVNLQDKTKVALVYGNVS 189
           R+   GP G  T T ++  SL  +AGG G+  P+   IKA   V   D  ++     +V 
Sbjct: 515 RVLAEGPYGQSTRT-HLFESLLFIAGGAGVPGPLSMAIKAGRQVKSNDSHQMIKFVWSVR 573

Query: 190 EEDIL--LKKELDAIVESNPDQFKIHYMLD-KPTSETWNGGIGYVTAD 234
             D+L   +KE+  + E N D  KI++  + K  S T  G I  ++ +
Sbjct: 574 NLDLLEVYRKEIMVLKELNIDT-KIYFTGERKDESNTEEGAIANMSTE 620

>YGR234W (YHB1) [2182] chr7 (959906..961105) Flavohemoglobin
           involved in protection from nitrosative stress,
           distantly related to animal hemoglobins [1200 bp, 399
           aa]
          Length = 399

 Score = 30.0 bits (66), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 19/92 (20%), Positives = 41/92 (44%), Gaps = 7/92 (7%)

Query: 128 KIGDRIKVRGPKGFYTYTANM----NSSLAMVAGGTGIAPMYQIIKAISVNLQDKTKVAL 183
           K+GD IK+  P G +     +       L +++ G G+ P+  +++   V       +  
Sbjct: 247 KVGDEIKLSAPAGDFAINKELIHQNEVPLVLLSSGVGVTPLLAMLEE-QVKCNPNRPIYW 305

Query: 184 VYGNVSEEDILLKKELDAIVE--SNPDQFKIH 213
           +  +  E+    KK +D ++   +N D+  +H
Sbjct: 306 IQSSYDEKTQAFKKHVDELLAECANVDKIIVH 337

>AER316C [2817] [Homologous to ScYML025C - SH]
           (1221231..1221986,1222051..1222104) [810 bp, 269 aa]
          Length = 269

 Score = 29.3 bits (64), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 34/166 (20%), Positives = 72/166 (43%), Gaps = 14/166 (8%)

Query: 65  LPKPTDVLGLPIGQHISIQGII--DGKEIVRSYTPTSLDSDATGHFELLI-KSYEKGNIS 121
           +P P  VLG+P+ + I  + ++  +  + V S  PTS   +     +LL  K  E+  + 
Sbjct: 57  MPVPMSVLGVPLRRDILWRAVVYENDNKRVGSSNPTSRSENGYSRRKLLPQKGTERARVG 116

Query: 122 KMIGELKIGDRIKVRGPKGFYTYTANMNSSLAMVAGGTGIAPMYQIIKAISVNLQDKTKV 181
                 + GD  +         YT  +   +   A    ++  Y+     ++ L++  K 
Sbjct: 117 DASSPTRHGDE-RAHARSAPNDYTTKLPRRIYSQAFSIALSHQYRQGNMYAIGLEESGK- 174

Query: 182 ALVYGNVSEEDILLKK---ELDAIVESNPDQF-----KIHYMLDKP 219
            L  G++   D+L  +     DA+ E+  ++F     ++ +++D+P
Sbjct: 175 -LSEGDLPVLDLLPSETNPHPDAVFETFLNEFGLQNKRLLFIIDEP 219

>Scas_678.18
          Length = 686

 Score = 28.9 bits (63), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 23/72 (31%), Positives = 37/72 (51%), Gaps = 9/72 (12%)

Query: 133 IKVRGPKGFYTYTANMNSSLAMVAGGTGIAPMYQIIKAISVNL--QDKT----KVALVYG 186
           I VR  K  +    N ++ + M+  GTG+AP    ++   VNL   D++    K  L YG
Sbjct: 512 IHVR--KSTFRLPTNPSAPVIMIGPGTGVAPFRGFVRD-RVNLLESDRSIKLGKHLLFYG 568

Query: 187 NVSEEDILLKKE 198
             +E+D L ++E
Sbjct: 569 CRNEDDYLYREE 580

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.322    0.139    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 10,605,324
Number of extensions: 443012
Number of successful extensions: 1211
Number of sequences better than 10.0: 42
Number of HSP's gapped: 1186
Number of HSP's successfully gapped: 42
Length of query: 350
Length of database: 16,596,109
Length adjustment: 103
Effective length of query: 247
Effective length of database: 13,030,455
Effective search space: 3218522385
Effective search space used: 3218522385
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 62 (28.5 bits)