Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Sklu_2260.147745823390.0
Kwal_47.1815546546114590.0
KLLA0F27643g47845813280.0
YER051W49248212461e-168
ADL088W48646211801e-158
CAGL0J02860g40337810181e-135
AAR003W580194930.003
Kwal_0.289578196850.023
CAGL0H07161g424119760.29
KLLA0F12804g580207750.36
AFL051W535147720.92
KLLA0C16203g145427711.3
KLLA0F02882g79645692.0
AFL127C152127702.0
YMR176W (ECM5)141132692.4
Scas_720.39145527683.0
Sklu_1853.340038673.2
Kwal_27.1110738828673.4
Kwal_56.24206150227683.5
Kwal_26.791454739664.5
CAGL0L03091g78241664.7
ABR022C100071665.6
CAGL0M10285g607296310.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Sklu_2260.1
         (477 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Sklu_2260.1 YER051W, Contig c2260 321-1754                            905   0.0  
Kwal_47.18155                                                         566   0.0  
KLLA0F27643g complement(2561213..2562649) similar to sp|P40034 S...   516   0.0  
YER051W (YER051W) [1479] chr5 (254655..256133) Protein containin...   484   e-168
ADL088W [1653] [Homologous to ScYER051W - SH] complement(530548....   459   e-158
CAGL0J02860g 276002..277213 similar to sp|P40034 Saccharomyces c...   396   e-135
AAR003W [189] [Homologous to NOHBY] complement(342591..344333) [...    40   0.003
Kwal_0.289                                                             37   0.023
CAGL0H07161g complement(704823..706097) similar to tr|Q06674 Sac...    34   0.29 
KLLA0F12804g complement(1180909..1182651) similar to ca|CA0795|I...    33   0.36 
AFL051W [3142] [Homologous to ScYPL179W (PPQ1) - SH] complement(...    32   0.92 
KLLA0C16203g complement(1414169..1418533) weakly similar to sp|Q...    32   1.3  
KLLA0F02882g 269162..271552 weakly similar to sp|P36124 Saccharo...    31   2.0  
AFL127C [3068] [Homologous to ScYMR176W (ECM5) - SH] (193474..19...    32   2.0  
YMR176W (ECM5) [4131] chr13 (611739..615974) Protein involved in...    31   2.4  
Scas_720.39                                                            31   3.0  
Sklu_1853.3 YEL037C, Contig c1853 2128-3330 reverse complement         30   3.2  
Kwal_27.11107                                                          30   3.4  
Kwal_56.24206                                                          31   3.5  
Kwal_26.7914                                                           30   4.5  
CAGL0L03091g complement(354241..356589) similar to sp|P36124 Sac...    30   4.7  
ABR022C [613] [Homologous to ScYMR080C (NAM7) - SH] (434644..437...    30   5.6  
CAGL0M10285g complement(1029427..1031250) similar to sp|P36106 S...    29   10.0 

>Sklu_2260.1 YER051W, Contig c2260 321-1754
          Length = 477

 Score =  905 bits (2339), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 446/458 (97%), Positives = 446/458 (97%)

Query: 1   MTTEICSYCSNDDPSKSLWVQCELCPQWVHVECVPLKHLRNDSDDSVTTHPTSASQIVKF 60
           MTTEICSYCSNDDPSKSLWVQCELCPQWVHVECVPLKHLRNDSDDSVTTHPTSASQIVKF
Sbjct: 1   MTTEICSYCSNDDPSKSLWVQCELCPQWVHVECVPLKHLRNDSDDSVTTHPTSASQIVKF 60

Query: 61  SCENHGEVLLXXXXXXXXXXXXDPPPTGNDKKYGLRKKKKIDYIALNEGEDRRLKDEHPH 120
           SCENHGEVLL            DPPPTGNDKKYGLRKKKKIDYIALNEGEDRRLKDEHPH
Sbjct: 61  SCENHGEVLLQVKQQARKRKQKDPPPTGNDKKYGLRKKKKIDYIALNEGEDRRLKDEHPH 120

Query: 121 IPAFLKCFDKWSNTTNIISSESLEATFDSITVPLKVKDPENSGMKIPTVQELGRENMENE 180
           IPAFLKCFDKWSNTTNIISSESLEATFDSITVPLKVKDPENSGMKIPTVQELGRENMENE
Sbjct: 121 IPAFLKCFDKWSNTTNIISSESLEATFDSITVPLKVKDPENSGMKIPTVQELGRENMENE 180

Query: 181 SSKITVNDIARVLGDDYPLDVMDVQTQQNSDWTISQWNDYFSKTPTEQRDRIRNVISLEV 240
           SSKITVNDIARVLGDDYPLDVMDVQTQQNSDWTISQWNDYFSKTPTEQRDRIRNVISLEV
Sbjct: 181 SSKITVNDIARVLGDDYPLDVMDVQTQQNSDWTISQWNDYFSKTPTEQRDRIRNVISLEV 240

Query: 241 SHVQQFRDGIRRPTAVEVNDLADLVWEDVVDKKSDVPRPKVTKYILMSVGNAYTDFHLDF 300
           SHVQQFRDGIRRPTAVEVNDLADLVWEDVVDKKSDVPRPKVTKYILMSVGNAYTDFHLDF
Sbjct: 241 SHVQQFRDGIRRPTAVEVNDLADLVWEDVVDKKSDVPRPKVTKYILMSVGNAYTDFHLDF 300

Query: 301 AGTSVYYNVISGKKKFILFPPTIHNLGQYKRWCDSDHQNLVFLGDMLEDGVAMELNSGDL 360
           AGTSVYYNVISGKKKFILFPPTIHNLGQYKRWCDSDHQNLVFLGDMLEDGVAMELNSGDL
Sbjct: 301 AGTSVYYNVISGKKKFILFPPTIHNLGQYKRWCDSDHQNLVFLGDMLEDGVAMELNSGDL 360

Query: 361 FMIPCGYIHAVYTPIDSLVVGGNFLTLRDITTQLKIVEIERLTKVPKRFTFPHFDIVMGK 420
           FMIPCGYIHAVYTPIDSLVVGGNFLTLRDITTQLKIVEIERLTKVPKRFTFPHFDIVMGK
Sbjct: 361 FMIPCGYIHAVYTPIDSLVVGGNFLTLRDITTQLKIVEIERLTKVPKRFTFPHFDIVMGK 420

Query: 421 TCEWVLKHRKAIPDEHIKTLISHMSDPKVKYKPVNYRN 458
           TCEWVLKHRKAIPDEHIKTLISHMSDPKVKYKPVNYRN
Sbjct: 421 TCEWVLKHRKAIPDEHIKTLISHMSDPKVKYKPVNYRN 458

>Kwal_47.18155
          Length = 465

 Score =  566 bits (1459), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 266/461 (57%), Positives = 336/461 (72%), Gaps = 17/461 (3%)

Query: 1   MTTEICSYCSNDDPSKSLWVQCELCPQWVHVECVPLKHLRNDSDDSVTTHPTSASQIVKF 60
           M ++ C+YCS+ DP K LWVQCE+C  WVHV CVP+K + N+  ++  T+P  A QI +F
Sbjct: 1   MVSDNCAYCSSSDPDKLLWVQCEVCDSWVHVTCVPIKDIVNEMGEASKTYPQDADQIKRF 60

Query: 61  SCENHGEVLLXXXXXXXXXXXXDPPPTGNDKKYGLRKKKKIDYIALNEGEDRRLKDEHPH 120
           SC  H    L                  + K+ GLRKKK++DYI+LNEG DRRLK+EHPH
Sbjct: 61  SCAEHPYPALEINMGLKKRKLNSTMADLSAKRQGLRKKKQVDYISLNEGADRRLKNEHPH 120

Query: 121 IPAFLKCFDKWSNTTNIISSESLEATFDSITVPLKVKDPENSGMKIPTVQELGRENMENE 180
           + AFL CF +W N TN++    LE  F+SI VPLK+KDPENSGM+IP          + +
Sbjct: 121 MHAFLACFSRWENKTNVMDCLELEDKFNSIKVPLKIKDPENSGMQIPK---------DVD 171

Query: 181 SSKITVNDIARVLGDDYPLDVMDVQTQQNSDWTISQWNDYFSKTPTEQRDRIRNVISLEV 240
               TV+ + R LG+DY +DVMDVQ+QQNS WT+++WN YF +TP E RDRIRNVISLEV
Sbjct: 172 GGNFTVDTVTRFLGEDYRVDVMDVQSQQNSTWTMAEWNKYFMQTPIESRDRIRNVISLEV 231

Query: 241 SHVQQFRDGIRRPTAVEVNDLADLVWEDVVDKKSDVPRPKVTKYILMSVGNAYTDFHLDF 300
           SHV+QF+ G+RRP  VE ND+ DL+W  + D   +  RPKVTKYILMSV NAYTDFHLDF
Sbjct: 232 SHVEQFKSGLRRPRVVESNDVVDLLWNAIPD---NTVRPKVTKYILMSVQNAYTDFHLDF 288

Query: 301 AGTSVYYNVISGKKKFILFPPTIHNLGQYKRWCDSDHQNLVFLGDMLEDGVAMELNSGDL 360
           AGTSVYY VISG KKFILFPPT  NL  Y +WC +D QNL+FLGD LE+G+AM+L++GDL
Sbjct: 289 AGTSVYYKVISGSKKFILFPPTPRNLAAYTQWCGNDDQNLIFLGDQLEEGIAMDLSAGDL 348

Query: 361 FMIPCGYIHAVYTPIDSLVVGGNFLTLRDITTQLKIVEIERLTKVPKRFTFPHFDIVMGK 420
           FMIPCGYIHAVYTP+D+LV+GGNFLTLRD+ TQL IV+IE++TKVPK+FTFP F+ VMGK
Sbjct: 349 FMIPCGYIHAVYTPVDTLVIGGNFLTLRDLKTQLMIVDIEKVTKVPKKFTFPQFESVMGK 408

Query: 421 TCEWVLKHRK-----AIPDEHIKTLISHMSDPKVKYKPVNY 456
           TCE+++K         I +E  + L+ ++ DPK KY+PVN+
Sbjct: 409 TCEYIVKKEANGIDLGIKNEQKEALLHYIQDPKFKYRPVNF 449

>KLLA0F27643g complement(2561213..2562649) similar to sp|P40034
           Saccharomyces cerevisiae YER051w singleton, start by
           similarity
          Length = 478

 Score =  516 bits (1328), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 255/458 (55%), Positives = 317/458 (69%), Gaps = 10/458 (2%)

Query: 6   CSYCSNDDP---SKSLWVQCELCPQWVHVECVPLKHLRNDSDDSVTTHPTSASQIVKFSC 62
           C +C  DD     + +WV CE C  W H+ CVP++ +    ++           +  F C
Sbjct: 8   CHFCKKDDSEDKGQPIWVGCEFCDGWCHLTCVPIQFVVPKLENPSQLLAFKEKHVESFKC 67

Query: 63  ENHGEVLLXXXXXXXXXXXXDPPPTGNDKKYGLRKKKKIDYIALNEGEDRRLKDEHPHIP 122
             H E               +       K+  LR K+ IDYIALNEG D+RLK EHPH  
Sbjct: 68  TLHDESKCALLKLNGVSVGTED--IAFTKRNRLRNKRPIDYIALNEGNDKRLKHEHPHTQ 125

Query: 123 AFLKCFDKWSNTTNIISSESLEATFDSITVPLKVKDPENSGMKIPTVQELGRENMENESS 182
           AFL CF+KW +   I SSE LE+ F  I VPL+V DP +SGM + +  ELG  + ++   
Sbjct: 126 AFLACFEKWKDPKAISSSE-LESDFQIIKVPLRVSDPADSGMYVISANELGLVDSKDHV- 183

Query: 183 KITVNDIARVLGDDYPLDVMDVQTQQNSDWTISQWNDYFSKTPTEQRDRIRNVISLEVSH 242
           K+ V  + +++GDDYPLDVMDVQTQ N  WT+SQWN+Y+S T    RDRIRNVISLEVSH
Sbjct: 184 KLNVEYLTKIMGDDYPLDVMDVQTQMNEKWTLSQWNEYYSHTSPSDRDRIRNVISLEVSH 243

Query: 243 VQQFRDGIRRPTAVEVNDLADLVWEDVVDKKSDVPRPKVTKYILMSVGNAYTDFHLDFAG 302
           V+ F+DGIRRP AV  NDL D+VW +    ++D+ RPKVTKYILMSVGNAYTDFHLDFAG
Sbjct: 244 VESFKDGIRRPNAVNNNDLVDIVW-NFGRTETDIERPKVTKYILMSVGNAYTDFHLDFAG 302

Query: 303 TSVYYNVISGKKKFILFPPTIHNLGQYKRWCDSDHQNLVFLGDMLEDGVAMELNSGDLFM 362
           TSVYYNVISG KKFILFPPT +NL +Y+ WCD+D+QN +FLGD LE G+AMEL  G+LFM
Sbjct: 303 TSVYYNVISGSKKFILFPPTDYNLKKYREWCDNDNQNDIFLGDQLEAGIAMELTEGNLFM 362

Query: 363 IPCGYIHAVYTPIDSLVVGGNFLTLRDITTQLKIVEIERLTKVPKRFTFPHFDIVMGKTC 422
           IPCGYIHAVYTP DS +VGGNFLTLRDITTQL +VEIE  TKVPK+FTFP F+ VMGKTC
Sbjct: 363 IPCGYIHAVYTPEDSFIVGGNFLTLRDITTQLNVVEIEHQTKVPKKFTFPQFESVMGKTC 422

Query: 423 EWVLK--HRKAIPDEHIKTLISHMSDPKVKYKPVNYRN 458
           EW+L   H ++I  E I+ L+ ++S   +KYKP+NY++
Sbjct: 423 EWLLNSDHIQSISSEDIENLVKYLSSSNIKYKPINYQS 460

>YER051W (YER051W) [1479] chr5 (254655..256133) Protein containing a
           PHD-finger, which may be involved in chromatin-mediated
           transcriptional regulation, and a Jumonji (jmjC) domain,
           has low similarity to uncharacterized C. albicans
           Orf6.8281p [1479 bp, 492 aa]
          Length = 492

 Score =  484 bits (1246), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 248/482 (51%), Positives = 325/482 (67%), Gaps = 40/482 (8%)

Query: 5   ICSYCS-NDDPSKSLWVQCELCPQWVHVECVPLK--HLRNDSDDSVTTHPTSASQIVKFS 61
           IC +C   D+P   +WV+C+ CPQWVHV+CVPLK  H  N +   V ++P SA QI  + 
Sbjct: 6   ICQHCQLKDNPGALIWVKCDSCPQWVHVKCVPLKRIHYSNLTSSEVLSYPNSAKQIKSYR 65

Query: 62  CENH--GEVL----LXXXXXXXXXXXXDPPPTGNDKKYGLRKKKKIDYIALNEGEDRRLK 115
           C NH  GE L    L            +P  +  +K+Y  RKKK +DYIALNEGE +R K
Sbjct: 66  CPNHKEGEYLTAYALITQKGKRQRNKENPEDSHINKRYNFRKKKLLDYIALNEGESKRDK 125

Query: 116 DEHPHIPAFLKCFDKWSNTTNIISSESLEATFDSITVPLKVKDPENSGMKIPTVQELGRE 175
             HPH  +F+K F+KW N +NII++      FD+I VP K+ DP NSG+ +P        
Sbjct: 126 MNHPHKESFMKSFEKWKNGSNIINAADFAEKFDNIDVPYKIIDPLNSGVYVP-------- 177

Query: 176 NMENESSKITVNDIARVLGDDYPLDVMDVQTQQNSDWTISQWNDYFSKTPTEQRDRIRNV 235
           N+  ++  +TVN I  ++G+DY +DVMDVQ+Q N +W +  WN+YF+ T  ++RDRIRNV
Sbjct: 178 NVGTDNGCLTVNYITEMIGEDYHVDVMDVQSQMNENWNLGSWNEYFTNTEPDRRDRIRNV 237

Query: 236 ISLEVSHVQQFRDGIRRPTAVEVNDLADLVW------EDVVDKKSDV--PRPKVTKYILM 287
           ISLEVS+++     + RPTAV  NDL D +W      E V  +K++   P+PKVTKYILM
Sbjct: 238 ISLEVSNIEGLE--LERPTAVRQNDLVDKIWSFNGHLEKVNGEKAEENDPKPKVTKYILM 295

Query: 288 SVGNAYTDFHLDFAGTSVYYNVISGKKKFILFPPTIHNLGQYKRWCDSDHQNLVFLGDML 347
           SV +AYTDFHLDFAGTSVYYNVISG+KKF+LFPPT  N+ +Y  W   + QN VFLGD+L
Sbjct: 296 SVKDAYTDFHLDFAGTSVYYNVISGQKKFLLFPPTQSNIDKYIEWSLKEDQNSVFLGDIL 355

Query: 348 EDGVAMELNSGDLFMIPCGYIHAVYTPIDSLVVGGNFLTLRDITTQLKIVEIERLTKVPK 407
           EDG+AMEL++GDLFMIP GYIHAVYTP+DSLV GGNFLT+RD+ T LKIVEIE+LTKVP+
Sbjct: 356 EDGIAMELDAGDLFMIPAGYIHAVYTPVDSLVFGGNFLTIRDLETHLKIVEIEKLTKVPR 415

Query: 408 RFTFPHFDIVMGKTCEWVLKHRKAIPDE-------------HIKTLISHMSDPKVKYKPV 454
           RFTFP FD VMGK CE++   +  I  +              I++L +++  P+VKYKP+
Sbjct: 416 RFTFPKFDQVMGKLCEYLALDKNKITSDVSDGDLLSRTTNCAIQSLHAYVIKPEVKYKPL 475

Query: 455 NY 456
           N+
Sbjct: 476 NF 477

>ADL088W [1653] [Homologous to ScYER051W - SH]
           complement(530548..532008) [1461 bp, 486 aa]
          Length = 486

 Score =  459 bits (1180), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 231/462 (50%), Positives = 290/462 (62%), Gaps = 30/462 (6%)

Query: 1   MTTEICSYCSNDDPSKSLWVQCELCPQWVHVECVPLKHLRNDSDDSVTTHPTSASQIVKF 60
           MT + C YC      + +WVQCE CPQWVHV+C+P + L      S   +P+ +S I  F
Sbjct: 26  MTDDQCVYCKGKMEHR-MWVQCEACPQWVHVQCIPEECL------SGGEYPSRSSDIAAF 78

Query: 61  SCENHG--EVLLXXXXXXXXXXXXDPPPTGNDKKYGLRKKKKIDYIALNEGEDRRLKDEH 118
            C  HG     L            + P     ++Y LRK+  +DYIALNEG+D RL+ EH
Sbjct: 79  ECSAHGTARARLALKGKRRRVEAKEEPERAGTRRYRLRKRGPLDYIALNEGQDVRLRHEH 138

Query: 119 PHIPAFLKCFDKWSNTTNIISSESLEATFDSITVPLKVKDPENSGMKIPTVQELGRENME 178
           PH  AF  CF KWS     ++S  L+ +F  +  P+ V DPE+SGM+ P + E       
Sbjct: 139 PHRAAFQGCFTKWSGLGRTVTSAELQQSFAELREPVLVADPEHSGMQTPAMDE------- 191

Query: 179 NESSKITVNDIARVLGDDYPLDVMDVQTQQNSDWTISQWNDYFSKTPTEQRDRIRNVISL 238
                     +A VLG DY LDVMDVQ+QQN  WT+ QW +Y   T    RDRIRNVISL
Sbjct: 192 --------QVLADVLGADYSLDVMDVQSQQNERWTMGQWKEYM-HTARGVRDRIRNVISL 242

Query: 239 EVSHVQQFRDGIRRPTAVEVNDLADLVWEDVVDKKSDVPRPKVTKYILMSVGNAYTDFHL 298
           EVSHV +F   IRRP AVE NDL DLVW  V        +PKV KY+LMS  NAYTDFHL
Sbjct: 243 EVSHVPEFGQRIRRPRAVEDNDLVDLVW-PVQPAPEIGAKPKVQKYVLMSAANAYTDFHL 301

Query: 299 DFAGTSVYYNVISGKKKFILFPPTIHNLGQYKRWCDSDHQNLVFLGDMLEDGVAMELNSG 358
           DFAGTSVYY+++ G K+F+LFPPT  NLG YK WC  D+Q L+FLGD L+DGV   L  G
Sbjct: 302 DFAGTSVYYSLLRGAKQFLLFPPTPANLGAYKAWCADDNQGLIFLGDRLQDGVLFSLRPG 361

Query: 359 DLFMIPCGYIHAVYTPIDSLVVGGNFLTLRDITTQLKIVEIERLTKVPKRFTFPHFDIVM 418
           DLFMIP G+IHAVYTP DS VVGGN+L LRD++T ++IV IE+ T+VPK+FTFP F+ VM
Sbjct: 362 DLFMIPSGFIHAVYTPEDSFVVGGNYLCLRDLSTHIRIVRIEQETQVPKKFTFPKFERVM 421

Query: 419 GKTCEWVL----KHRKAIPDEHIKTLISHMSDPKVKYKPVNY 456
           G T EW+L    +  + I  EH   L+ ++ D ++KYKP +Y
Sbjct: 422 GLTAEWLLEGLPERLQLITHEHAVALLDYLRDTRLKYKPAHY 463

>CAGL0J02860g 276002..277213 similar to sp|P40034 Saccharomyces
           cerevisiae YER051w, hypothetical start
          Length = 403

 Score =  396 bits (1018), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 206/378 (54%), Positives = 265/378 (70%), Gaps = 22/378 (5%)

Query: 91  KKYGLRKKKKIDYIALNEGEDRRLKDEHPHIPAFLKCFDK-WSNTTNIISSESLE--ATF 147
           K+Y  RKK ++DY ALNEGED++ K  HPHI  F K F+K  SN T  +S    E    F
Sbjct: 25  KRYNFRKKVELDYSALNEGEDKKSKFFHPHIALFEKEFEKCLSNVTEDMSMTCSEYCKRF 84

Query: 148 DSITVPLKVKDPENSGMKIPTVQELGRENMENESSKITVNDIARVLGDDYPLDVMDVQTQ 207
           D I  PLK+ DPENSGM + T  +  R+        +TV+DI + +GDDY ++VMDVQ+Q
Sbjct: 85  DDIDFPLKISDPENSGMVVSTNNKTTRD--------LTVDDITQAVGDDYFVNVMDVQSQ 136

Query: 208 QNSDWTISQWNDYFSKTPTEQRDRIRNVISLEVSHVQQFRDGIRRPTAVEVNDLADLVWE 267
           +N  W++ +W +YF+K P E++DRIRNVISLEVSHV+  +    RP  V+  DL D+VW 
Sbjct: 137 ENERWSLREWCNYFNK-PAEEKDRIRNVISLEVSHVEDLQ--YDRPDIVDDKDLVDIVWN 193

Query: 268 DV--VDKKSDVPRPKVTKYILMSVGNAYTDFHLDFAGTSVYYNVISGKKKFILFPPTIHN 325
           +V  +D ++D PRPKVTKY LMSV NA+TD+HLDFAGTSVYYN+  GKKKFIL+PPT  N
Sbjct: 194 NVENLDTEND-PRPKVTKYCLMSVKNAFTDYHLDFAGTSVYYNLAFGKKKFILYPPTPEN 252

Query: 326 LGQYKRWCDSDHQNLVFLGDMLEDGVAMELNSGDLFMIPCGYIHAVYTPIDSLVVGGNFL 385
           +  Y  W  S +QN++FLG+ L  GVAMELN GDLFMIP GYIH VYTP DSL+ GGN+L
Sbjct: 253 IENYIEWSTSTYQNMLFLGEKLTGGVAMELNGGDLFMIPSGYIHVVYTPEDSLIFGGNYL 312

Query: 386 TLRDITTQLKIVEIERLTKVPKRFTFPHFDIVMGKTCEWVLKHRK-----AIPDEHIKTL 440
           T RDI+ QLKIV++E+ T V KR+TFP FD VMG+TCEW+ +++K      +  E +  L
Sbjct: 313 TFRDISQQLKIVDVEKQTGVTKRYTFPMFDEVMGRTCEWLCQNQKKGKQMQVKKETVNDL 372

Query: 441 ISHMSDPKVKYKPVNYRN 458
           IS+M   K KYKP N+ N
Sbjct: 373 ISYMKSGKTKYKPTNFIN 390

>AAR003W [189] [Homologous to NOHBY] complement(342591..344333)
           [1743 bp, 580 aa]
          Length = 580

 Score = 40.4 bits (93), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 42/194 (21%), Positives = 77/194 (39%), Gaps = 26/194 (13%)

Query: 207 QQNSDWTISQWNDYFSKTPTEQRDRIRNVISLEVSHVQQFRDGIRRPTAVEVNDLADLVW 266
           Q++  W +S + DYF K   E    + +  S  +  ++        P  V   D   L  
Sbjct: 249 QESVTWPLSHYADYFKKNRDESPLYLFDCASEAMEKIK----NQYAPPDVFQKDFFTLFQ 304

Query: 267 EDVVDKKSDVPRPKVTKYILMSVGNAYTDFHLDFAGTSVYYNVISGKKKFILFPPTIHNL 326
           +D V  + D       ++++     + + FH D   TS +  V+SG K +++ PP +   
Sbjct: 305 QDGVQCRPD------HRWLIAGPARSGSTFHKDPNQTSAWNAVLSGMKLWVMLPPDVAPP 358

Query: 327 G--------------QYKRWCDSDHQN-LVFLGDMLEDGVAMELNSGDLFMIPCGYIHAV 371
           G                  W  S + N  V L    +  + ++  S  ++ +P G+ H V
Sbjct: 359 GVSTDKEEEEVTSPVGITEWVLSGYYNDAVNLAQQGKCRIGVQFASECIY-VPAGWWHTV 417

Query: 372 YTPIDSLVVGGNFL 385
               DS+ +  NF+
Sbjct: 418 INITDSVALTENFV 431

>Kwal_0.289
          Length = 578

 Score = 37.4 bits (85), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 42/196 (21%), Positives = 75/196 (38%), Gaps = 30/196 (15%)

Query: 207 QQNSDWTISQWNDYFSKTPTEQRDRIRNVISLEVSHVQQFRDGIRRPTAVEVNDLADLVW 266
           Q+   W +S + +Y+     E    + +  S     ++  R+    P   + NDL  L  
Sbjct: 245 QEAVKWNLSFYAEYYKNNSDESPLYLFDCNS---QAIKTLRNEYATPEIFK-NDLFKLFQ 300

Query: 267 EDVVDKKSDVPRPKVTKYILMSVGNAYTDFHLDFAGTSVYYNVISGKKKFILFPPTIHNL 326
           E  V  + D       +++++    + + FH D   TS +   ++GKK +I+ PP +   
Sbjct: 301 EKDVHCRPD------HRWLIVGPAGSGSTFHKDPNQTSAWNAGLTGKKLWIMLPPGVKPP 354

Query: 327 GQYKRWCDSDHQNLV--------FLGDMLEDGVAMELNS---------GDLFMIPCGYIH 369
           G      D D + +          L     D V M             G+   +P G+ H
Sbjct: 355 GVS---TDKDEEEVTSPVGVAEWILSGYYNDAVKMAQEGKCFITVTFPGECIYVPSGWWH 411

Query: 370 AVYTPIDSLVVGGNFL 385
            V    DS+ +  NF+
Sbjct: 412 TVINLTDSVALTENFV 427

>CAGL0H07161g complement(704823..706097) similar to tr|Q06674
           Saccharomyces cerevisiae YDR317w, hypothetical start
          Length = 424

 Score = 33.9 bits (76), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 35/119 (29%), Positives = 52/119 (43%), Gaps = 8/119 (6%)

Query: 93  YGLRKKKKIDYIALNEGEDRRLKDEHPHIPAFLKCFDKWSNTTNIISSESLEATFDSITV 152
           YG      ++Y++  EG   +L     HI   +K    W +   II S+ +EA      +
Sbjct: 155 YGKEYMYYLEYMSA-EGNLLKLNFIFNHIQLIIKNSFSWPSVIPIIFSDEVEAISFREKM 213

Query: 153 PLKVKDPENSGMKIPTVQELGRENMENESSKITVNDIARVLGDDYPLDVMDVQTQQNSD 211
           PLK   P  S +K   +  +G     N+ S  T NDI      DY L+V  V+   N+D
Sbjct: 214 PLKRYFPLLSDIKT-MISTIGTTTNRNKISNTTYNDI------DYQLNVDLVKAFSNTD 265

>KLLA0F12804g complement(1180909..1182651) similar to
           ca|CA0795|IPF15641 Candida albicans unknown function,
           start by similarity
          Length = 580

 Score = 33.5 bits (75), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 42/207 (20%), Positives = 82/207 (39%), Gaps = 27/207 (13%)

Query: 193 LGDDYPLDVMDVQTQQNSDWTISQWNDYFSKTPTEQRDRIRNVISLEVSHVQQFRDGIRR 252
           L + YP ++     Q+   W +S ++ YF     E RD     +    S   +       
Sbjct: 240 LVERYPHEIF---RQEAVKWDLSLYSYYFR----ENRDESPLYLFDCNSTALKLMSKEYA 292

Query: 253 PTAVEVNDLADLVWEDVVDKKSDVPRPKVTKYILMSVGNAYTDFHLDFAGTSVYYNVISG 312
           P ++  ND   L  E  +  + D       ++++     + + FH D   TS +   +SG
Sbjct: 293 PPSIYHNDFFKLFQEKGIKCRPD------HRWLIAGPARSGSTFHKDPNHTSAWNTGLSG 346

Query: 313 KKKFILFPPTIHNLGQYKRWCDSDHQNLVFLGDMLEDGV---AMELNS-----------G 358
            K +++ PP  +  G      + +  + V + + +  G    A++L             G
Sbjct: 347 MKLWVMLPPGENPPGVMTDKEEEEVTSPVGIAEWIISGYYNDAVKLAQEGRCQICVTFPG 406

Query: 359 DLFMIPCGYIHAVYTPIDSLVVGGNFL 385
           +   +P G+ H+V    DS+ +  NF+
Sbjct: 407 ECIYVPSGWWHSVINLTDSVALTENFV 433

>AFL051W [3142] [Homologous to ScYPL179W (PPQ1) - SH]
           complement(342569..344176) [1608 bp, 535 aa]
          Length = 535

 Score = 32.3 bits (72), Expect = 0.92,   Method: Compositional matrix adjust.
 Identities = 41/147 (27%), Positives = 64/147 (43%), Gaps = 30/147 (20%)

Query: 207 QQNSDWTISQWNDYFSKTPTEQ--RDRIRNV---ISLEVSHVQQFRDGIRRPTAV-EVND 260
           ++ S  T  Q+ D F+  P     +D+I  V   IS ++S+++Q  + I RPT + E   
Sbjct: 370 RRMSTKTWKQFVDVFNTLPFAAIVQDKIFCVHGGISPQLSNMRQI-EKIARPTDIPEEGL 428

Query: 261 LADLVWEDVVDKKSDVPRPKVTKYILMSVGNAYTDFH---LDFAGTSVYYNVISG----- 312
           L DL+W D        P P V+ + L   G +YT       DF     +  +I G     
Sbjct: 429 LTDLLWSD--------PDPAVSDWSLNDRGVSYTFGKRNVYDFCANFKFDLIIRGHMVVE 480

Query: 313 -------KKKFILFPPTIHNLGQYKRW 332
                  KKKF+      +  GQ++ W
Sbjct: 481 DGYEFFAKKKFVTIFSAPNYCGQFQNW 507

>KLLA0C16203g complement(1414169..1418533) weakly similar to sp|Q03214
            Saccharomyces cerevisiae YMR176w ECM5 involved in cell
            wall biogenesis and architecture singleton, start by
            similarity
          Length = 1454

 Score = 32.0 bits (71), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 10/27 (37%), Positives = 17/27 (62%), Gaps = 1/27 (3%)

Query: 8    YCSNDDPSKSLWVQCELCPQWVHVECV 34
            +C   D + ++ VQCE+C +W H  C+
Sbjct: 1280 FCRRGD-NGNVMVQCEICSEWYHTSCI 1305

>KLLA0F02882g 269162..271552 weakly similar to sp|P36124
           Saccharomyces cerevisiae YKR029c, start by similarity
          Length = 796

 Score = 31.2 bits (69), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 14/45 (31%), Positives = 23/45 (51%), Gaps = 4/45 (8%)

Query: 1   MTTEICSYCSNDDPSKSLWVQCELCPQWVHVECVPLKHLRNDSDD 45
           + T IC Y  +D       +QC+ C +W H  C  ++H ++  DD
Sbjct: 225 IITCICGYEDDD----GFTIQCDHCFRWQHAICYGIEHEKDAPDD 265

>AFL127C [3068] [Homologous to ScYMR176W (ECM5) - SH] (193474..198039)
            [4566 bp, 1521 aa]
          Length = 1521

 Score = 31.6 bits (70), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 10/27 (37%), Positives = 17/27 (62%), Gaps = 1/27 (3%)

Query: 8    YCSNDDPSKSLWVQCELCPQWVHVECV 34
            +C   D   ++ V+CE+C +W HV C+
Sbjct: 1299 FCRQGDVGSTM-VECEICREWYHVACI 1324

>YMR176W (ECM5) [4131] chr13 (611739..615974) Protein involved in cell
            wall structure or biosynthesis [4236 bp, 1411 aa]
          Length = 1411

 Score = 31.2 bits (69), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 11/32 (34%), Positives = 21/32 (65%), Gaps = 2/32 (6%)

Query: 3    TEICSYCSNDDPSKSLWVQCELCPQWVHVECV 34
            T+ C +C   +   ++ V+CE+C +W HV+C+
Sbjct: 1238 TKYC-FCRRVEEGTAM-VECEICKEWYHVDCI 1267

>Scas_720.39
          Length = 1455

 Score = 30.8 bits (68), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 10/27 (37%), Positives = 13/27 (48%)

Query: 8    YCSNDDPSKSLWVQCELCPQWVHVECV 34
            YC          +QCELC +W H  C+
Sbjct: 1262 YCFCRGGDIGTMIQCELCQEWYHTACI 1288

>Sklu_1853.3 YEL037C, Contig c1853 2128-3330 reverse complement
          Length = 400

 Score = 30.4 bits (67), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 22/38 (57%), Gaps = 5/38 (13%)

Query: 331 RWCDSDHQNLVFLGDMLEDGVAME---LNSGD--LFMI 363
           + CD D   L+F G +L+DG  +E   L  GD  +FMI
Sbjct: 35  KSCDEDQIKLIFSGKVLQDGKTLEECKLKDGDQVIFMI 72

>Kwal_27.11107
          Length = 388

 Score = 30.4 bits (67), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 13/28 (46%), Positives = 15/28 (53%), Gaps = 2/28 (7%)

Query: 9  CSNDDP--SKSLWVQCELCPQWVHVECV 34
          CS  DP     L++QCE C  W H  CV
Sbjct: 39 CSETDPPDDSGLYIQCEQCSVWQHGFCV 66

>Kwal_56.24206
          Length = 1502

 Score = 30.8 bits (68), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 11/27 (40%), Positives = 16/27 (59%), Gaps = 1/27 (3%)

Query: 8    YCSNDDPSKSLWVQCELCPQWVHVECV 34
            +C   D S S  V CE+C +W H+ C+
Sbjct: 1274 FCRGGD-SGSRMVACEVCGEWYHMNCI 1299

>Kwal_26.7914
          Length = 547

 Score = 30.0 bits (66), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 14/39 (35%), Positives = 22/39 (56%), Gaps = 1/39 (2%)

Query: 7  SYCSNDDPSKSLWVQCELCPQWVHVECVPLKHLRNDSDD 45
          +Y   DDP   + +QC+ C  W H++C+  K   ND D+
Sbjct: 62 NYDEADDPHGDM-IQCDKCNTWQHIKCMFGKDEVNDLDE 99

>CAGL0L03091g complement(354241..356589) similar to sp|P36124
           Saccharomyces cerevisiae YKR029c, hypothetical start
          Length = 782

 Score = 30.0 bits (66), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 13/41 (31%), Positives = 19/41 (46%), Gaps = 1/41 (2%)

Query: 5   ICSYCSNDDPSKSLWVQCELCPQWVHVECVPLKHLRNDSDD 45
           I   C  DD      +QC+ C +W H  C  + ++ N  DD
Sbjct: 137 ITCVCDFDD-DDGFTIQCDHCNRWQHASCFGIDNIENAPDD 176

>ABR022C [613] [Homologous to ScYMR080C (NAM7) - SH]
           (434644..437646) [3003 bp, 1000 aa]
          Length = 1000

 Score = 30.0 bits (66), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 28/71 (39%), Gaps = 16/71 (22%)

Query: 6   CSYCSNDDPSKSLWVQCELCPQWV----------HVECVPLKHLRNDSDDSVTTHPTSAS 55
           CSYCS D P  S  V+C  C +W           H+    + HL     + V+ HP S  
Sbjct: 70  CSYCSIDSP--SCVVKCNACNKWFCNSKNGTSSSHI----INHLVFSHHNVVSLHPESDL 123

Query: 56  QIVKFSCENHG 66
                 C N G
Sbjct: 124 GDTVLECYNCG 134

>CAGL0M10285g complement(1029427..1031250) similar to sp|P36106
          Saccharomyces cerevisiae YKL005c, hypothetical start
          Length = 607

 Score = 28.9 bits (63), Expect = 10.0,   Method: Compositional matrix adjust.
 Identities = 9/29 (31%), Positives = 17/29 (58%), Gaps = 1/29 (3%)

Query: 6  CSYCSNDDPSKSLWVQCELCPQWVHVECV 34
           +Y  ++DP   + +QC+ C  W H+ C+
Sbjct: 55 ANYVEDEDPYGEM-IQCDQCDTWQHINCM 82

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.318    0.135    0.416 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 16,327,668
Number of extensions: 724555
Number of successful extensions: 2038
Number of sequences better than 10.0: 37
Number of HSP's gapped: 2037
Number of HSP's successfully gapped: 37
Length of query: 477
Length of database: 16,596,109
Length adjustment: 105
Effective length of query: 372
Effective length of database: 12,961,219
Effective search space: 4821573468
Effective search space used: 4821573468
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 63 (28.9 bits)