Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Sklu_2248.436236216650.0
Kwal_55.2080734330311621e-160
KLLA0D14509g36031110671e-145
YMR010W40531210581e-143
CAGL0K08822g45131210281e-138
Scas_717.243792959521e-127
ADR022W3573239411e-126
Scas_658.1531169860.009
Sklu_1971.229065860.009
YDR352W31767860.010
Kwal_55.21538294102840.016
CAGL0A02508g31666810.041
KLLA0E21736g31992780.100
KLLA0C18381g86154654.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Sklu_2248.4
         (362 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Sklu_2248.4 YMR010W, Contig c2248 8114-9202                           645   0.0  
Kwal_55.20807                                                         452   e-160
KLLA0D14509g 1230053..1231135 similar to sp|Q03687 Saccharomyces...   415   e-145
YMR010W (YMR010W) [3974] chr13 (285099..286316) Protein possibly...   412   e-143
CAGL0K08822g 884170..885525 similar to sp|Q03687 Saccharomyces c...   400   e-138
Scas_717.24                                                           371   e-127
ADR022W [1763] [Homologous to ScYMR010W - SH] complement(744266....   367   e-126
Scas_658.15                                                            38   0.009
Sklu_1971.2 YDR352W, Contig c1971 2812-3684                            38   0.009
YDR352W (YDR352W) [1179] chr4 (1181790..1182743) Protein contain...    38   0.010
Kwal_55.21538                                                          37   0.016
CAGL0A02508g 264398..265348 similar to tr|Q06328 Saccharomyces c...    36   0.041
KLLA0E21736g complement(1931058..1932017) similar to sgd|S000276...    35   0.100
KLLA0C18381g complement(1624865..1627450) similar to sp|Q06163 S...    30   4.4  

>Sklu_2248.4 YMR010W, Contig c2248 8114-9202
          Length = 362

 Score =  645 bits (1665), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 325/362 (89%), Positives = 325/362 (89%)

Query: 1   MSNMXXXXXXXXXXXXXXXXTPSFRDSYLPRVDQFYIPEWLTMQFIANNLISFTPLFSYG 60
           MSNM                TPSFRDSYLPRVDQFYIPEWLTMQFIANNLISFTPLFSYG
Sbjct: 1   MSNMQAEPAALAAQAVENVNTPSFRDSYLPRVDQFYIPEWLTMQFIANNLISFTPLFSYG 60

Query: 61  TTVLSIERSKTALGFSIDICATMLLASILRVSYYIITPYELTLLRQSLVMIVIQLLLLRT 120
           TTVLSIERSKTALGFSIDICATMLLASILRVSYYIITPYELTLLRQSLVMIVIQLLLLRT
Sbjct: 61  TTVLSIERSKTALGFSIDICATMLLASILRVSYYIITPYELTLLRQSLVMIVIQLLLLRT 120

Query: 121 SLYYRPEEYKYDNLTTVEPFTQLLQDVWLEYFPLNPFGTQWRETLKSLSYKNMLRFVCKV 180
           SLYYRPEEYKYDNLTTVEPFTQLLQDVWLEYFPLNPFGTQWRETLKSLSYKNMLRFVCKV
Sbjct: 121 SLYYRPEEYKYDNLTTVEPFTQLLQDVWLEYFPLNPFGTQWRETLKSLSYKNMLRFVCKV 180

Query: 181 LLIFVYKFLKFFDPSFKRFKSFWQWNDESKYWKFLVVFSTGQLCFTVLISKIIHWNELAQ 240
           LLIFVYKFLKFFDPSFKRFKSFWQWNDESKYWKFLVVFSTGQLCFTVLISKIIHWNELAQ
Sbjct: 181 LLIFVYKFLKFFDPSFKRFKSFWQWNDESKYWKFLVVFSTGQLCFTVLISKIIHWNELAQ 240

Query: 241 WIGSMXXXXXXXXXXXXXXXQISILYKLKTVQGFKLVLLVSWLCGDVLKISYLVFGAKNI 300
           WIGSM               QISILYKLKTVQGFKLVLLVSWLCGDVLKISYLVFGAKNI
Sbjct: 241 WIGSMIGALGLLIEALLPLPQISILYKLKTVQGFKLVLLVSWLCGDVLKISYLVFGAKNI 300

Query: 301 SVLFLFFALFQMSLDIYIGGQYIYYKFYYPSLRNXXXXXXIEMAEMRTNEADVRKEPGSV 360
           SVLFLFFALFQMSLDIYIGGQYIYYKFYYPSLRN      IEMAEMRTNEADVRKEPGSV
Sbjct: 301 SVLFLFFALFQMSLDIYIGGQYIYYKFYYPSLRNESSEESIEMAEMRTNEADVRKEPGSV 360

Query: 361 ST 362
           ST
Sbjct: 361 ST 362

>Kwal_55.20807
          Length = 343

 Score =  452 bits (1162), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 213/303 (70%), Positives = 253/303 (83%)

Query: 27  SYLPRVDQFYIPEWLTMQFIANNLISFTPLFSYGTTVLSIERSKTALGFSIDICATMLLA 86
           SY PR+DQFYIPEWLTMQF+ NN+ISFTPL SYGTTVLSI +SKTALGFS+DICATMLLA
Sbjct: 17  SYFPRIDQFYIPEWLTMQFVLNNMISFTPLLSYGTTVLSIRKSKTALGFSLDICATMLLA 76

Query: 87  SILRVSYYIITPYELTLLRQSLVMIVIQLLLLRTSLYYRPEEYKYDNLTTVEPFTQLLQD 146
           SILR+SYY+ITPY++TLLRQSLVMI IQL+LLRTSL+YRPE+YKY+NL  VEP TQLL D
Sbjct: 77  SILRISYYLITPYDITLLRQSLVMIFIQLILLRTSLHYRPEQYKYENLEPVEPLTQLLHD 136

Query: 147 VWLEYFPLNPFGTQWRETLKSLSYKNMLRFVCKVLLIFVYKFLKFFDPSFKRFKSFWQWN 206
           VWLEYFPLNPFG+ WR  +KSLSYK  L F  K++L+ +YKFLKFFDPS++RF+SFWQW+
Sbjct: 137 VWLEYFPLNPFGSDWRHLIKSLSYKGFLDFTYKIVLVLIYKFLKFFDPSYRRFRSFWQWD 196

Query: 207 DESKYWKFLVVFSTGQLCFTVLISKIIHWNELAQWIGSMXXXXXXXXXXXXXXXQISILY 266
            +SK+W FL  F+T Q+  T+ +SKI++W   +QWIGS+               QISIL 
Sbjct: 197 QDSKFWIFLAYFATAQITITLFVSKIMNWESFSQWIGSVIGSLGLLIESLLPLPQISILN 256

Query: 267 KLKTVQGFKLVLLVSWLCGDVLKISYLVFGAKNISVLFLFFALFQMSLDIYIGGQYIYYK 326
           KLK+ QGFKL+LLVSWLCGDV+KISYL+FGA NIS LFLFFA+FQMSLDIYI  QY+YY+
Sbjct: 257 KLKSTQGFKLILLVSWLCGDVVKISYLIFGANNISALFLFFAMFQMSLDIYIACQYVYYR 316

Query: 327 FYY 329
           FYY
Sbjct: 317 FYY 319

>KLLA0D14509g 1230053..1231135 similar to sp|Q03687 Saccharomyces
           cerevisiae YMR010w singleton, start by similarity
          Length = 360

 Score =  415 bits (1067), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 211/311 (67%), Positives = 254/311 (81%), Gaps = 3/311 (0%)

Query: 27  SYLPRVDQFYIPEWLTMQFIANNLISFTPLFSYGTTVLSIERSKTALGFSIDICATMLLA 86
            Y  ++DQFYIPEWLTMQF+ANNLISFTPLFSYGTTVL+I +S+T+LGFS+DICATML+A
Sbjct: 22  GYFSKIDQFYIPEWLTMQFVANNLISFTPLFSYGTTVLAIHKSQTSLGFSLDICATMLIA 81

Query: 87  SILRVSYYIITPYELTLLRQSLVMIVIQLLLLRTSLYYRPEEYKYDNLTTVEPFTQLLQD 146
           SILRVSYY+ITPYE+TLLRQS+VMI+IQL+LL+ +L YRPE+ KY+NL  VE  ++LLQD
Sbjct: 82  SILRVSYYLITPYEITLLRQSIVMILIQLILLKVALNYRPEDAKYENLEPVETLSELLQD 141

Query: 147 VWLEYFPLNPF---GTQWRETLKSLSYKNMLRFVCKVLLIFVYKFLKFFDPSFKRFKSFW 203
           VW +YFP NPF    T W+  LKSLS+KN+L F  K++L+ VYKFLKFFDPSFKRFK FW
Sbjct: 142 VWEQYFPANPFDVYSTDWKPLLKSLSWKNLLGFGYKIVLVCVYKFLKFFDPSFKRFKGFW 201

Query: 204 QWNDESKYWKFLVVFSTGQLCFTVLISKIIHWNELAQWIGSMXXXXXXXXXXXXXXXQIS 263
           QWND+  YWKFL+VF + Q   T++ISK+ +W   +QWIGS+               QIS
Sbjct: 202 QWNDDLMYWKFLLVFGSLQFFITLIISKVFNWESFSQWIGSLIGSLGLFIESLLPLPQIS 261

Query: 264 ILYKLKTVQGFKLVLLVSWLCGDVLKISYLVFGAKNISVLFLFFALFQMSLDIYIGGQYI 323
           I YKLK+VQGFKL++LVSWLCGD+LKISYLVFGA NISV+FL F LFQMSLDIYI  QYI
Sbjct: 262 IFYKLKSVQGFKLIILVSWLCGDILKISYLVFGASNISVIFLCFGLFQMSLDIYIACQYI 321

Query: 324 YYKFYYPSLRN 334
           YYK+YYPSLR+
Sbjct: 322 YYKYYYPSLRH 332

>YMR010W (YMR010W) [3974] chr13 (285099..286316) Protein possibly
           required for full induction of IME1 during early meiosis
           [1218 bp, 405 aa]
          Length = 405

 Score =  412 bits (1058), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 206/312 (66%), Positives = 249/312 (79%), Gaps = 4/312 (1%)

Query: 27  SYLPRVDQFYIPEWLTMQFIANNLISFTPLFSYGTTVLSIERSKTALGFSIDICATMLLA 86
           SYLP+VDQFYIPEWLTMQFIANNLISFTPLFSYGTT++SIE+ KTALGFSIDICATML+A
Sbjct: 33  SYLPKVDQFYIPEWLTMQFIANNLISFTPLFSYGTTIISIEKCKTALGFSIDICATMLIA 92

Query: 87  SILRVSYYIITPYELTLLRQSLVMIVIQLLLLRTSLYYRPEEYKYDNLTTVEPFTQLLQD 146
           SILR+SYY+ITPYE+TLLRQSLVMI IQL+LLRTSL YRP+EYKY NLT VE  + L+ D
Sbjct: 93  SILRISYYLITPYEITLLRQSLVMIFIQLILLRTSLKYRPDEYKYQNLTDVESLSHLIHD 152

Query: 147 VWLEYFPL--NP--FGTQWRETLKSLSYKNMLRFVCKVLLIFVYKFLKFFDPSFKRFKSF 202
           +W E+F     P      W+  +KSLS+ N+L+F  K+ L F YK LKFFDP+FKR  +F
Sbjct: 153 IWFEFFSCINRPKFLSEDWKNLIKSLSFTNLLKFSFKIFLAFFYKILKFFDPNFKRIGAF 212

Query: 203 WQWNDESKYWKFLVVFSTGQLCFTVLISKIIHWNELAQWIGSMXXXXXXXXXXXXXXXQI 262
           WQW+D+  +W+FL +F+T Q+  T  IS I++W+ LAQ +GS+               QI
Sbjct: 213 WQWDDDKNFWRFLALFATVQILVTFFISNILNWDSLAQGLGSIIGSLGLLVESLLPLPQI 272

Query: 263 SILYKLKTVQGFKLVLLVSWLCGDVLKISYLVFGAKNISVLFLFFALFQMSLDIYIGGQY 322
           +ILYKLK+VQGFKL+LLVSWLCGD LKI+YL+FGAKNIS LF+ FALFQMSLD YIGGQY
Sbjct: 273 AILYKLKSVQGFKLILLVSWLCGDTLKITYLIFGAKNISALFVIFALFQMSLDFYIGGQY 332

Query: 323 IYYKFYYPSLRN 334
           IYY++YYP LR+
Sbjct: 333 IYYRYYYPKLRH 344

>CAGL0K08822g 884170..885525 similar to sp|Q03687 Saccharomyces
           cerevisiae YMR010w, hypothetical start
          Length = 451

 Score =  400 bits (1028), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 192/312 (61%), Positives = 241/312 (77%), Gaps = 9/312 (2%)

Query: 27  SYLPRVDQFYIPEWLTMQFIANNLISFTPLFSYGTTVLSIERSKTALGFSIDICATMLLA 86
           SYLP++DQFYIPEWLTM+ +   + S TPLFSYG  +LSIER +TA GFSIDICATML+A
Sbjct: 38  SYLPKLDQFYIPEWLTMRVLTGYIYSCTPLFSYGAAILSIERCQTAFGFSIDICATMLIA 97

Query: 87  SILRVSYYIITPYELTLLRQSLVMIVIQLLLLRTSLYYRPEEYKYDNLTTVEPFTQLLQD 146
           SILR+SY+   PYE+TLLRQS++M+++QLLLLRT+L YRPEEYKYDNL +VEPFTQL+ D
Sbjct: 98  SILRISYFFFVPYEVTLLRQSIIMVLVQLLLLRTTLKYRPEEYKYDNLQSVEPFTQLIHD 157

Query: 147 VWLEYFPLNP----FGTQWRETLKSLSYKNMLRFVCKVLLIFVYKFLKFFDPSFKRFKSF 202
           VW EYF +      F  +W+  L+SLS++ ++ F+ K+ L+FVYKFLKFFDPSFKR  SF
Sbjct: 158 VWFEYFAIRNKPRMFSDEWKNLLRSLSFERLMGFIFKIFLVFVYKFLKFFDPSFKRVGSF 217

Query: 203 WQWNDESKYWKFLVVFSTGQLCFTVLISKIIHWNELAQWIGSMXXXXXXXXXXXXXXXQI 262
           WQWND+ KYWKFL++F+T Q  FT+LI+K+I W   A  +GS+               QI
Sbjct: 218 WQWNDDRKYWKFLIIFATFQFSFTLLITKVIAWENFAHNVGSLIGGISLLVESLLPLPQI 277

Query: 263 SILYKLKTVQGFKLVLLVSWLCGDVLKISYLV---FGAKNI--SVLFLFFALFQMSLDIY 317
           SIL+KLK+VQGFK++LL+SWLCGD +K+S+L+    G KN+  S LF FFALFQM LD Y
Sbjct: 278 SILHKLKSVQGFKIILLISWLCGDTVKLSFLLSLNSGEKNVDTSSLFEFFALFQMGLDFY 337

Query: 318 IGGQYIYYKFYY 329
           IGGQYIYYKFYY
Sbjct: 338 IGGQYIYYKFYY 349

>Scas_717.24
          Length = 379

 Score =  371 bits (952), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 192/295 (65%), Positives = 235/295 (79%), Gaps = 3/295 (1%)

Query: 27  SYLPRVDQFYIPEWLTMQFIANNLISFTPLFSYGTTVLSIERSKTALGFSIDICATMLLA 86
           SYLPRVDQFYIPEWLTMQFIANNLISFTPLFSYGTT++SIE+SKTALGFSIDICATML+A
Sbjct: 27  SYLPRVDQFYIPEWLTMQFIANNLISFTPLFSYGTTIISIEKSKTALGFSIDICATMLIA 86

Query: 87  SILRVSYYIITPYELTLLRQSLVMIVIQLLLLRTSLYYRPEEYKYDNLTTVEPFTQLLQD 146
           SILRVSYY+I+PYE+TLLRQ+LVMI IQL+LL+TSL YRP+EYKY NL +VE F+QL ++
Sbjct: 87  SILRVSYYLISPYEITLLRQALVMIFIQLILLKTSLKYRPDEYKYHNLKSVETFSQLFKE 146

Query: 147 VWLEYFPLNPFGTQWRETLKSLSYKNMLRFVCKVLLIFVYKFLKFFDPSFKRFKSFWQWN 206
           +W E F       +  +   +L+   + +F+ K LLIF+YKFLKFFDPS+KRF SFWQW+
Sbjct: 147 IWYESFQSVSLSHE-EDNFSALT--RICKFLYKFLLIFLYKFLKFFDPSYKRFGSFWQWD 203

Query: 207 DESKYWKFLVVFSTGQLCFTVLISKIIHWNELAQWIGSMXXXXXXXXXXXXXXXQISILY 266
               +WKFL++F+  Q+  T  IS I++W+ L  ++GS+               QISIL 
Sbjct: 204 KNRTFWKFLLIFTFLQMIVTFSISNILNWSSLESFLGSVIGSLGLFIEALLPLPQISILN 263

Query: 267 KLKTVQGFKLVLLVSWLCGDVLKISYLVFGAKNISVLFLFFALFQMSLDIYIGGQ 321
           KLK++QGFKL+LLVSWLCGD LKI+YL+FGAKNIS+LF FFA FQMSLDIYIGGQ
Sbjct: 264 KLKSIQGFKLILLVSWLCGDTLKITYLMFGAKNISMLFFFFAFFQMSLDIYIGGQ 318

>ADR022W [1763] [Homologous to ScYMR010W - SH]
           complement(744266..745339) [1074 bp, 357 aa]
          Length = 357

 Score =  367 bits (941), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 182/323 (56%), Positives = 232/323 (71%)

Query: 27  SYLPRVDQFYIPEWLTMQFIANNLISFTPLFSYGTTVLSIERSKTALGFSIDICATMLLA 86
           SY PR+DQFYIP WL +QF+ANN+ISFTPLFSYGTTV  I+RSKT LG  IDICATML+A
Sbjct: 27  SYWPRIDQFYIPPWLDVQFLANNIISFTPLFSYGTTVCIIKRSKTVLGIFIDICATMLIA 86

Query: 87  SILRVSYYIITPYELTLLRQSLVMIVIQLLLLRTSLYYRPEEYKYDNLTTVEPFTQLLQD 146
            ILRVSY +ITPYE+ L R SL MI +QL+LL TS+ YRP EYKY++L  V+ F QL QD
Sbjct: 87  CILRVSYNLITPYEVALFRYSLAMIFMQLILLYTSMCYRPVEYKYESLKPVDRFGQLSQD 146

Query: 147 VWLEYFPLNPFGTQWRETLKSLSYKNMLRFVCKVLLIFVYKFLKFFDPSFKRFKSFWQWN 206
           VW E+FPL   G  W+   +++S+ +   ++ K+LL+ +YKFLKFFDP ++R  +FWQWN
Sbjct: 147 VWQEFFPLCSMGAGWKGIWQAMSWNSFAGYMEKMLLVALYKFLKFFDPGYQRIGAFWQWN 206

Query: 207 DESKYWKFLVVFSTGQLCFTVLISKIIHWNELAQWIGSMXXXXXXXXXXXXXXXQISILY 266
           +   +W FL+ F+ GQ   T  I+++++   L QW+GS                QISIL+
Sbjct: 207 NPRYFWLFLLWFTCGQFLMTFFIARVMNLEWLGQWLGSFIGSLGLLIEALLPLPQISILH 266

Query: 267 KLKTVQGFKLVLLVSWLCGDVLKISYLVFGAKNISVLFLFFALFQMSLDIYIGGQYIYYK 326
            LK+VQGFKL+LLVSWLCGD+LKISYLVFGAKNIS++F  FALFQM LDIYI   Y+YYK
Sbjct: 267 TLKSVQGFKLILLVSWLCGDILKISYLVFGAKNISMIFFLFALFQMGLDIYIAFIYVYYK 326

Query: 327 FYYPSLRNXXXXXXIEMAEMRTN 349
           +Y+P  R       IEM  + +N
Sbjct: 327 YYFPKYRRKSEPPRIEMQMLLSN 349

>Scas_658.15
          Length = 311

 Score = 37.7 bits (86), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 22/69 (31%), Positives = 36/69 (52%), Gaps = 2/69 (2%)

Query: 261 QISILYKLKTVQGFKLVLLVSWLCGDVLKISYLVFGAKNISVLFLFFALFQMSLDIYIGG 320
           QI   Y  KTV G     L++WLCGD+  ++  +    N  +  +  A++ +  D+++ G
Sbjct: 30  QILETYHDKTVVGLSPWFLLAWLCGDITSLTGAIL--TNQLMFQIVLAIYFLLNDMFVCG 87

Query: 321 QYIYYKFYY 329
           QY YY   Y
Sbjct: 88  QYYYYGILY 96

>Sklu_1971.2 YDR352W, Contig c1971 2812-3684
          Length = 290

 Score = 37.7 bits (86), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 24/65 (36%), Positives = 37/65 (56%), Gaps = 4/65 (6%)

Query: 266 YKLKTVQGFKLVLLVSWLCGDVLKISYLVFGAKNISVLF-LFFALFQMSLDIYIGGQYIY 324
           YK KTV+G   + L++WL GD   I+ L+       + F +  AL+ M+ D++I GQY Y
Sbjct: 35  YKDKTVEGLSPIFLLAWLFGD---ITSLIGALLTHQLPFQIILALYFMANDMFICGQYYY 91

Query: 325 YKFYY 329
           Y   +
Sbjct: 92  YGILH 96

>YDR352W (YDR352W) [1179] chr4 (1181790..1182743) Protein containing
           two PQ loop repeat domains, has low similarity to S.
           pombe Stm1p, which is a G protein-coupled receptor that
           acts as a nutrient sensor for sexual diffentiation and
           stress response pathways [954 bp, 317 aa]
          Length = 317

 Score = 37.7 bits (86), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 23/67 (34%), Positives = 35/67 (52%), Gaps = 6/67 (8%)

Query: 261 QISILYKLKTVQGFKLVLLVSWLCGDVLKISYLVFGAKNISVLF--LFFALFQMSLDIYI 318
           QI   Y+ K+V G     L++WLCGD+  +     GAK    L   +  A++ +  D ++
Sbjct: 30  QIIETYRDKSVDGLSPYFLLAWLCGDITSL----IGAKLTGQLLFQILLAIYFLLNDSFV 85

Query: 319 GGQYIYY 325
            GQY YY
Sbjct: 86  CGQYYYY 92

>Kwal_55.21538
          Length = 294

 Score = 37.0 bits (84), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 29/102 (28%), Positives = 46/102 (45%), Gaps = 10/102 (9%)

Query: 261 QISILYKLKTVQGFKLVLLVSWLCGDVLKISYLVFGAKNISVLF-LFFALFQMSLDIYIG 319
           Q+   Y  KTV+G   + L++WL GD   I+ LV       + F +  AL+ ++ D++I 
Sbjct: 30  QVLETYVDKTVEGLSPLFLLAWLMGD---ITTLVGAVLTQQLSFQIILALYFLANDLFIC 86

Query: 320 GQYIYY------KFYYPSLRNXXXXXXIEMAEMRTNEADVRK 355
           GQY YY      K   P          + +   R +EA +  
Sbjct: 87  GQYYYYGIVHGNKLATPGHEKKSSDERMAIVRSRGSEASINA 128

>CAGL0A02508g 264398..265348 similar to tr|Q06328 Saccharomyces
           cerevisiae YDR352w, start by similarity
          Length = 316

 Score = 35.8 bits (81), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 23/66 (34%), Positives = 33/66 (50%), Gaps = 4/66 (6%)

Query: 261 QISILYKLKTVQGFKLVLLVSWLCGDVLK-ISYLVFGAKNISVLFLFFALFQMSLDIYIG 319
           QI   YK KTV+G   + L+ WL GD+   I  L+ G     +    + LF    D+++ 
Sbjct: 30  QIIETYKDKTVEGLSPLFLMCWLSGDITSLIGALMTGQLKFQIALAIYFLFN---DLFVC 86

Query: 320 GQYIYY 325
            QY YY
Sbjct: 87  CQYYYY 92

>KLLA0E21736g complement(1931058..1932017) similar to sgd|S0002760
           Saccharomyces cerevisiae YDR352w, start by similarity
          Length = 319

 Score = 34.7 bits (78), Expect = 0.100,   Method: Compositional matrix adjust.
 Identities = 27/92 (29%), Positives = 41/92 (44%), Gaps = 7/92 (7%)

Query: 266 YKLKTVQGFKLVLLVSWLCGDVLKISYLVFGAKNISVLF-LFFALFQMSLDIYIGGQYIY 324
           Y+ K+V+G     L+ WL GD   I+ L+       + F +  A++ +S D+ I GQY Y
Sbjct: 39  YRDKSVEGLSPGFLLCWLFGD---ITSLIGAVLTHQLPFQILLAVYYLSNDMLICGQYYY 95

Query: 325 YKFYYPSLRNXXXXXXIEMAEMRTNEADVRKE 356
           Y   +   RN       E A +      VR  
Sbjct: 96  YGILH---RNQLATPGHESATLEERTRLVRSR 124

>KLLA0C18381g complement(1624865..1627450) similar to sp|Q06163
           Saccharomyces cerevisiae YLR318w EST2 catalytic subunit
           of the telomerase singleton, start by similarity
          Length = 861

 Score = 29.6 bits (65), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 16/54 (29%), Positives = 32/54 (59%), Gaps = 1/54 (1%)

Query: 95  IITPYELTLLRQSLVMIVIQLLLLRTSLYYRPEEY-KYDNLTTVEPFTQLLQDV 147
           +I   + T+L +  V+ V+++ L +TS++YR + Y + D L    P + +L D+
Sbjct: 579 VIDSVKTTVLSKEDVLTVVKMELFKTSIFYRGKCYLRKDGLFQGTPLSSVLVDI 632

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.328    0.141    0.439 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 10,233,321
Number of extensions: 404196
Number of successful extensions: 1276
Number of sequences better than 10.0: 25
Number of HSP's gapped: 1262
Number of HSP's successfully gapped: 25
Length of query: 362
Length of database: 16,596,109
Length adjustment: 103
Effective length of query: 259
Effective length of database: 13,030,455
Effective search space: 3374887845
Effective search space used: 3374887845
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.8 bits)
S2: 62 (28.5 bits)