Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Sklu_2248.31771779451e-132
CAGL0K08800g1751756778e-92
KLLA0D14487g1761776708e-91
Kwal_55.208131751756265e-84
Scas_717.251781776135e-82
ADR021W1761775927e-79
YMR009W1791785623e-74
Sklu_2423.529176690.39
CAGL0C05247g357114690.39
Sklu_2346.635452690.42
CAGL0M01496g951114661.1
CAGL0H02937g61078651.5
ADR385W54027642.0
KLLA0F24728g36351642.0
Kwal_56.2282236144632.6
Scas_469.160966632.7
CAGL0G08360g889131632.9
CAGL0F07139g76866623.1
CAGL0C03003g20671595.8
CAGL0H06721g108170597.4
ADL379C53242597.7
Kwal_26.687730660597.8
YOL064C (MET22)35776598.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Sklu_2248.3
         (177 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Sklu_2248.3 YMR009W, Contig c2248 7331-7864                           368   e-132
CAGL0K08800g 883045..883572 similar to sp|Q03677 Saccharomyces c...   265   8e-92
KLLA0D14487g 1229115..1229645 similar to sp|Q03677 Saccharomyces...   262   8e-91
Kwal_55.20813                                                         245   5e-84
Scas_717.25                                                           240   5e-82
ADR021W [1762] [Homologous to ScYMR009W - SH] complement(743305....   232   7e-79
YMR009W (YMR009W) [3973] chr13 (284101..284640) Member of the ac...   221   3e-74
Sklu_2423.5 YDL076C, Contig c2423 8459-9334 reverse complement         31   0.39 
CAGL0C05247g 501476..502549 highly similar to sp|P32179 Saccharo...    31   0.39 
Sklu_2346.6 YOL064C, Contig c2346 12123-13187 reverse complement       31   0.42 
CAGL0M01496g complement(171045..173900) similar to tr|Q04175 Sac...    30   1.1  
CAGL0H02937g complement(269645..271477) similar to sp|P40362 Sac...    30   1.5  
ADR385W [2126] [Homologous to NOHBY] complement(1399447..1401069...    29   2.0  
KLLA0F24728g 2299815..2300906 similar to sp|P32179 Saccharomyces...    29   2.0  
Kwal_56.22822                                                          29   2.6  
Scas_469.1                                                             29   2.7  
CAGL0G08360g complement(789119..791788) similar to sp|P22543 Sac...    29   2.9  
CAGL0F07139g complement(698363..700669) highly similar to sp|P53...    28   3.1  
CAGL0C03003g 297244..297864 similar to sp|P25631 Saccharomyces c...    27   5.8  
CAGL0H06721g complement(667816..671061) similar to sp|P40453 Sac...    27   7.4  
ADL379C [1362] [Homologous to ScYPR083W - SH] (43304..44902) [15...    27   7.7  
Kwal_26.6877                                                           27   7.8  
YOL064C (MET22) [4755] chr15 complement(206102..207175) 3'- (2'-...    27   8.3  

>Sklu_2248.3 YMR009W, Contig c2248 7331-7864
          Length = 177

 Score =  368 bits (945), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 177/177 (100%), Positives = 177/177 (100%)

Query: 1   MVQVYYHDNNDAVDFRQPHNTGREISLQRLEKIGVFYRHFKTQQEVDELARERNYKNRDI 60
           MVQVYYHDNNDAVDFRQPHNTGREISLQRLEKIGVFYRHFKTQQEVDELARERNYKNRDI
Sbjct: 1   MVQVYYHDNNDAVDFRQPHNTGREISLQRLEKIGVFYRHFKTQQEVDELARERNYKNRDI 60

Query: 61  VSISKESFGNDENAMIEKLKVFYSEHLHEDEEIRYCLDGTGYFDVRDAESDEWIRCKVEP 120
           VSISKESFGNDENAMIEKLKVFYSEHLHEDEEIRYCLDGTGYFDVRDAESDEWIRCKVEP
Sbjct: 61  VSISKESFGNDENAMIEKLKVFYSEHLHEDEEIRYCLDGTGYFDVRDAESDEWIRCKVEP 120

Query: 121 GDLLILPAGIYHRFTLTDDNYIKALRLFKEEPKWLAYNRPDADSNPTREEYLSSLSI 177
           GDLLILPAGIYHRFTLTDDNYIKALRLFKEEPKWLAYNRPDADSNPTREEYLSSLSI
Sbjct: 121 GDLLILPAGIYHRFTLTDDNYIKALRLFKEEPKWLAYNRPDADSNPTREEYLSSLSI 177

>CAGL0K08800g 883045..883572 similar to sp|Q03677 Saccharomyces
           cerevisiae YMR009w, start by similarity
          Length = 175

 Score =  265 bits (677), Expect = 8e-92,   Method: Compositional matrix adjust.
 Identities = 118/175 (67%), Positives = 148/175 (84%)

Query: 1   MVQVYYHDNNDAVDFRQPHNTGREISLQRLEKIGVFYRHFKTQQEVDELARERNYKNRDI 60
           MV++Y HD ND+VDFRQPHN+G+ ++L+ L KIGV Y+H   Q +VD LA+ERNYKNRDI
Sbjct: 1   MVEIYVHDENDSVDFRQPHNSGKTVALEDLGKIGVIYKHIADQADVDILAKERNYKNRDI 60

Query: 61  VSISKESFGNDENAMIEKLKVFYSEHLHEDEEIRYCLDGTGYFDVRDAESDEWIRCKVEP 120
           V+I+ ++F  D+NA+ ++L +FY EHLHEDEEIRYC++G+GYFDVR+ + D W+RCKV P
Sbjct: 61  VTINVDTFKGDKNALEKQLGIFYKEHLHEDEEIRYCIEGSGYFDVRNGKDDVWVRCKVGP 120

Query: 121 GDLLILPAGIYHRFTLTDDNYIKALRLFKEEPKWLAYNRPDADSNPTREEYLSSL 175
           GDLLILPAGIYHRFTLT+ N+IKALRLFK+EPKW AYNRPDADS P R EYL S+
Sbjct: 121 GDLLILPAGIYHRFTLTETNHIKALRLFKDEPKWQAYNRPDADSLPVRHEYLQSI 175

>KLLA0D14487g 1229115..1229645 similar to sp|Q03677 Saccharomyces
           cerevisiae YMR009w singleton, start by similarity
          Length = 176

 Score =  262 bits (670), Expect = 8e-91,   Method: Compositional matrix adjust.
 Identities = 121/177 (68%), Positives = 150/177 (84%), Gaps = 1/177 (0%)

Query: 1   MVQVYYHDNNDAVDFRQPHNTGREISLQRLEKIGVFYRHFKTQQEVDELARERNYKNRDI 60
           MV+ Y HDN+ +VDFR+ H+TG+ +SL++LE+IG+ YR F TQ+EVD+ A++R+YKNRDI
Sbjct: 1   MVKAYIHDNDSSVDFREDHDTGKPVSLEKLEQIGLIYRKFDTQEEVDQFAQDRDYKNRDI 60

Query: 61  VSISKESFGNDENAMIEKLKVFYSEHLHEDEEIRYCLDGTGYFDVRDAESDEWIRCKVEP 120
           V+I+  SF  DE  MI KL VFY+EHLHEDEEIRYCLDG G+FDVRD  ++EWIRC+V+ 
Sbjct: 61  VNITVNSFP-DEETMISKLNVFYAEHLHEDEEIRYCLDGEGFFDVRDPFTEEWIRCRVQK 119

Query: 121 GDLLILPAGIYHRFTLTDDNYIKALRLFKEEPKWLAYNRPDADSNPTREEYLSSLSI 177
           GDLL+LPAGIYHRFTLT DNYIKALRLFKEEPKWLAYNRPDAD N  R+EYL+ + +
Sbjct: 120 GDLLVLPAGIYHRFTLTSDNYIKALRLFKEEPKWLAYNRPDADDNRYRQEYLTQVGL 176

>Kwal_55.20813
          Length = 175

 Score =  245 bits (626), Expect = 5e-84,   Method: Compositional matrix adjust.
 Identities = 111/175 (63%), Positives = 143/175 (81%), Gaps = 3/175 (1%)

Query: 1   MVQVYYHDNNDAVDFRQPHNTGREISLQRLEKIGVFYRHFKTQQEVDELARERNYKNRDI 60
           MV+ YYHDN+D VDFR+PH++G  +SL +L KIGVFY++  +Q +VDE+A ER+YKNRD 
Sbjct: 1   MVEAYYHDNDDTVDFREPHHSGETLSLDQLAKIGVFYKYCPSQAQVDEVATERDYKNRDT 60

Query: 61  VSISKESFGNDENAMIEKLKVFYSEHLHEDEEIRYCLDGTGYFDVRDAESDEWIRCKVEP 120
           V IS+E+ G+   A++ KL+ FY+EHLHEDEEIRY +DG G+FDVR+  +D W+RCK+ P
Sbjct: 61  VQISQETLGD---ALLPKLQTFYAEHLHEDEEIRYIIDGEGFFDVRNEPNDRWVRCKLVP 117

Query: 121 GDLLILPAGIYHRFTLTDDNYIKALRLFKEEPKWLAYNRPDADSNPTREEYLSSL 175
           GDLLILPAGIYHRFTLT  NY+KALRLFK+EPKW+A+ RP AD  P R EYL+S+
Sbjct: 118 GDLLILPAGIYHRFTLTSKNYVKALRLFKDEPKWVAHGRPIADDLPIRREYLASV 172

>Scas_717.25
          Length = 178

 Score =  240 bits (613), Expect = 5e-82,   Method: Compositional matrix adjust.
 Identities = 104/177 (58%), Positives = 142/177 (80%), Gaps = 1/177 (0%)

Query: 1   MVQVYYHDNNDAVDFRQPHNTGREISLQRLEKIGVFYRHFKTQQEVDELARERNYKNRDI 60
           MV+ Y HDN++ +DFR+PHN+G  +SL+RL K+G+  ++ +   +V+ LA+ERNYKNRD 
Sbjct: 1   MVEAYVHDNDNKIDFREPHNSGVAVSLERLAKLGIVAKYLEKIDDVELLAKERNYKNRDT 60

Query: 61  VSISKESFGNDENAMIEKLKVFYSEHLHEDEEIRYCLDGTGYFDVRDAESDEWIRCKVEP 120
           V +SK++F NDE  ++ +L +FY EHLHEDEEIRYC++G+GYFD++D  ++EWIRCKV P
Sbjct: 61  VKLSKKTFNNDETLLLNQLNIFYQEHLHEDEEIRYCIEGSGYFDIKDTFTNEWIRCKVSP 120

Query: 121 GDLLILPAGIYHRFTLTDDNYIKALRLFKEEPKWLAYNRP-DADSNPTREEYLSSLS 176
           GDLLI+PAGIYHRFTLT DN+IKALRLFK+EPKW A+N+  D D    R++YL S+ 
Sbjct: 121 GDLLIVPAGIYHRFTLTTDNFIKALRLFKDEPKWQAHNKSGDTDQTSVRKQYLQSIG 177

>ADR021W [1762] [Homologous to ScYMR009W - SH]
           complement(743305..743835) [531 bp, 176 aa]
          Length = 176

 Score =  232 bits (592), Expect = 7e-79,   Method: Compositional matrix adjust.
 Identities = 107/177 (60%), Positives = 139/177 (78%), Gaps = 1/177 (0%)

Query: 1   MVQVYYHDNNDAVDFRQPHNTGREISLQRLEKIGVFYRHFKTQQEVDELARERNYKNRDI 60
           MV+ Y HDNN  VD R PH++G+ +SL+RL  +GVFYRH ++Q EVD +A  R+Y NRD 
Sbjct: 1   MVEAYVHDNNTHVDCRAPHHSGKSVSLERLASLGVFYRHCRSQDEVDAVACARHYSNRDE 60

Query: 61  VSISKESFGNDENAMIEKLKVFYSEHLHEDEEIRYCLDGTGYFDVRDAESDEWIRCKVEP 120
           V+IS  SF + E+A  +KL VFY+EHLHEDEEIRY L G GYFD+RDA + +WIR K+  
Sbjct: 61  VTISPASFPS-EDAFRDKLAVFYTEHLHEDEEIRYALAGEGYFDLRDATTGDWIRVKLTT 119

Query: 121 GDLLILPAGIYHRFTLTDDNYIKALRLFKEEPKWLAYNRPDADSNPTREEYLSSLSI 177
           GDLLI+PAGIYHRFT+T+ N+I+A RLFK+EPKW A+NRP+ D+ P  +EYL+SL+I
Sbjct: 120 GDLLIVPAGIYHRFTVTESNFIRAQRLFKDEPKWQAFNRPEGDARPVHKEYLASLAI 176

>YMR009W (YMR009W) [3973] chr13 (284101..284640) Member of the
           acireductone dioxygenase family, has high similarity to
           uncharacterized C. albicans Orf6.5544p [540 bp, 179 aa]
          Length = 179

 Score =  221 bits (562), Expect = 3e-74,   Method: Compositional matrix adjust.
 Identities = 109/178 (61%), Positives = 136/178 (76%), Gaps = 3/178 (1%)

Query: 1   MVQVYYHDNNDAVDFRQPHNTGREISLQRLEKIGVFYRHFKTQQEVDELARERNYKNRDI 60
           MV+VY HDN    D+R PHN+G E+SL  L K+GV Y++   ++EV+E+AR+R YKNRD+
Sbjct: 1   MVKVYIHDNKVDSDYRAPHNSGTELSLDELAKLGVIYKYCANEEEVNEIARQREYKNRDV 60

Query: 61  VSISKESFGNDENAMIEKLKVFYSEHLHEDEEIRYCLDGTGYFDVRDAESDE-WIRCKVE 119
           V+I + SF + E    EKL  FY EHLHEDEEIRYCL+G GYFDVRDA + E WIRC VE
Sbjct: 61  VNICEGSFKS-EAEFNEKLATFYQEHLHEDEEIRYCLEGAGYFDVRDASTPENWIRCLVE 119

Query: 120 PGDLLILPAGIYHRFTLTDDNYIKALRLFKEEPKWLAYNRPD-ADSNPTREEYLSSLS 176
            GDLLILP GIYHRFTLT  N+IKALRLFK+EPKW A NR + ADS P R++Y++ ++
Sbjct: 120 SGDLLILPPGIYHRFTLTTSNHIKALRLFKDEPKWQAINRSNQADSLPVRKDYIALIN 177

>Sklu_2423.5 YDL076C, Contig c2423 8459-9334 reverse complement
          Length = 291

 Score = 31.2 bits (69), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 19/76 (25%), Positives = 34/76 (44%), Gaps = 8/76 (10%)

Query: 37  YRHFKTQQEVDELARERNYKNRDIVSISKESFGNDENAMIEKLKVFYSEHLHEDEEIRYC 96
           Y H+KT++    + ++ ++ +R +          D N  +  + V YS        + Y 
Sbjct: 51  YSHYKTEENQPSVLKKHSFIDRPVTV--------DSNPALNYVDVNYSSQRRHLGTLYYH 102

Query: 97  LDGTGYFDVRDAESDE 112
           L GTG FD    E++E
Sbjct: 103 LQGTGSFDENPLETEE 118

>CAGL0C05247g 501476..502549 highly similar to sp|P32179
           Saccharomyces cerevisiae YOL064c MET22, start by
           similarity
          Length = 357

 Score = 31.2 bits (69), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 29/114 (25%), Positives = 51/114 (44%), Gaps = 23/114 (20%)

Query: 34  GVFYRHFKTQQEVDELARERNYKN-RDIVS---ISKESFGNDENAMIEKLKVFYSEHLHE 89
           G FY    T+    +  + R  K+  +++S   + K    +DE + I K K+  +  LH 
Sbjct: 205 GAFYATCSTKVPDWKPIKVRQLKDTSEMISLEGVEKSHSSHDEQSQI-KAKLGINNSLHL 263

Query: 90  DEEIRYCLDGTGYFDVRDAESDEWIRCKVE-----------PGDLLILPAGIYH 132
           D +++YCL   G  DV       ++R  ++            G+ ++L AG YH
Sbjct: 264 DSQVKYCLLALGLADV-------YLRLPIKLSYREKIWDHAAGNTIVLEAGGYH 310

>Sklu_2346.6 YOL064C, Contig c2346 12123-13187 reverse complement
          Length = 354

 Score = 31.2 bits (69), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 29/52 (55%), Gaps = 4/52 (7%)

Query: 57  NRDIVS---ISKESFGNDENAMIEKLKVFYSEHLHEDEEIRYCLDGTGYFDV 105
            R +VS   + K    +DE ++I K ++  S+ LH D +++YCL   G  DV
Sbjct: 227 TRGMVSLEGVEKAHSAHDEQSVI-KTQLGISDSLHLDSQVKYCLLALGLGDV 277

>CAGL0M01496g complement(171045..173900) similar to tr|Q04175
           Saccharomyces cerevisiae YDR395w SXM1, start by
           similarity
          Length = 951

 Score = 30.0 bits (66), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 31/114 (27%), Positives = 49/114 (42%), Gaps = 11/114 (9%)

Query: 63  ISKESFGNDENAMIEKLKVFY-SEHL--HEDEEIRYCLDGTGYFDVRDAESDEWIRCKVE 119
           ++KE   + +  +++ L  F  S HL  H  E IR  L+    +D+     +     K E
Sbjct: 80  LTKEEQASVKEQLVQTLIKFSESSHLRPHLTESIRGILNADNSWDLTATVKELLTSGKQE 139

Query: 120 ---PGDLLILPAGIYHRFTLTD-----DNYIKALRLFKEEPKWLAYNRPDADSN 165
              PG LL+    I HR+ ++D     DN+I  +    E       N+ D  SN
Sbjct: 140 YLYPGLLLVFEVAIVHRWDMSDNREVIDNFIIEIFPIVENITSQLVNQTDYRSN 193

>CAGL0H02937g complement(269645..271477) similar to sp|P40362
           Saccharomyces cerevisiae YJL069c, start by similarity
          Length = 610

 Score = 29.6 bits (65), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 40/78 (51%), Gaps = 7/78 (8%)

Query: 53  RNYKNRDIVSISKES--FGNDENA-MIEKLKV--FYSEHLHEDEEIRYCLDGTGYFDVRD 107
           R+ K   +  I K S  +G++E     EK KV   Y+   +  + I     G+G+ ++ D
Sbjct: 338 RSEKAASVAKIDKFSRMYGHEETQRSFEKFKVGYLYNFTTNSSQGIVVLQGGSGWINIID 397

Query: 108 AESDEWIR-CKVEPGDLL 124
           A S  WI  CK+E G+L+
Sbjct: 398 ANSGVWITGCKIE-GNLV 414

>ADR385W [2126] [Homologous to NOHBY] complement(1399447..1401069)
           [1623 bp, 540 aa]
          Length = 540

 Score = 29.3 bits (64), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 13/27 (48%), Positives = 15/27 (55%)

Query: 114 IRCKVEPGDLLILPAGIYHRFTLTDDN 140
           I   VEPG+LL LP G +H  T   D 
Sbjct: 466 IVVDVEPGELLWLPTGWFHEVTSLGDK 492

>KLLA0F24728g 2299815..2300906 similar to sp|P32179 Saccharomyces
           cerevisiae YOL064c MET22 protein ser/thr phosphatase
           singleton, start by similarity
          Length = 363

 Score = 29.3 bits (64), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 30/51 (58%), Gaps = 6/51 (11%)

Query: 59  DIVS---ISKESFGNDENAMIEK-LKVFYSEHLHEDEEIRYCLDGTGYFDV 105
           D+VS   + K    +DE A+I+K L +  S+HL  D +++YCL   G  D+
Sbjct: 236 DLVSLEGVEKGHSSHDEQAIIKKDLGITKSQHL--DSQVKYCLLALGLGDL 284

>Kwal_56.22822
          Length = 361

 Score = 28.9 bits (63), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 15/44 (34%), Positives = 23/44 (52%), Gaps = 1/44 (2%)

Query: 62  SISKESFGNDENAMIEKLKVFYSEHLHEDEEIRYCLDGTGYFDV 105
            + K    + E A + K K+  S+ LH D +++YCL   G  DV
Sbjct: 242 GVEKGHSAHSEQATV-KSKLGISKSLHLDSQVKYCLLALGLGDV 284

>Scas_469.1
          Length = 609

 Score = 28.9 bits (63), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 29/66 (43%), Gaps = 23/66 (34%)

Query: 99  GTGYFDVRDAESDEWIRCKVEPGDLLILPAG---------IYHRFTLTDDNYIKALRLFK 149
           G GY  V+D +            D+LI P+          IY+ F LT  NYI+ +   +
Sbjct: 507 GKGYITVKDNQ------------DVLIHPSTVLGHDAEWVIYNEFVLTSKNYIRTVTSVR 554

Query: 150 EEPKWL 155
             P+WL
Sbjct: 555 --PEWL 558

>CAGL0G08360g complement(789119..791788) similar to sp|P22543
           Saccharomyces cerevisiae YLR240w VPS34
           phosphatidylinositol 3-kinase, start by similarity
          Length = 889

 Score = 28.9 bits (63), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 30/131 (22%), Positives = 57/131 (43%), Gaps = 8/131 (6%)

Query: 11  DAVDFRQPHNTGREISLQRLEKIG-VFYRHFKTQQEVDELARERNYKNRDIVSISKESFG 69
           +A+ F +      E +++ LE I   FY  +  ++ +DEL  ++ YK  + + +  ++F 
Sbjct: 142 EAIKFTKQGKPSIE-TVKTLETINKYFYGDYAKKEWIDELVLKKLYKEYEKIDLPLDTFM 200

Query: 70  NDENAMIEKLKVFYSEHLHEDEE----IRYCLDGTGYFDVRDAESDEWIRCKVEPGDLLI 125
                 + +L + Y+E   ED +         D    F V  + S+      V+P   L 
Sbjct: 201 LTIQFPVIELPIIYTEKPREDIQKNIPTLSNFDAASAFSVDHSTSNNTAVTSVDPK--LK 258

Query: 126 LPAGIYHRFTL 136
           +P G  +  TL
Sbjct: 259 IPMGNKYNSTL 269

>CAGL0F07139g complement(698363..700669) highly similar to sp|P53131
           Saccharomyces cerevisiae YGL120c PRP43, start by
           similarity
          Length = 768

 Score = 28.5 bits (62), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 29/66 (43%), Gaps = 23/66 (34%)

Query: 99  GTGYFDVRDAESDEWIRCKVEPGDLLILPAG---------IYHRFTLTDDNYIKALRLFK 149
           G GY  V+D +            D+LI P+          IY+ F LT  NYI+ +   +
Sbjct: 670 GKGYITVKDNQ------------DVLIHPSTVLGHDAEWVIYNEFVLTSKNYIRTVTSVR 717

Query: 150 EEPKWL 155
             P+WL
Sbjct: 718 --PEWL 721

>CAGL0C03003g 297244..297864 similar to sp|P25631 Saccharomyces
           cerevisiae YCR051w, hypothetical start
          Length = 206

 Score = 27.3 bits (59), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 21/71 (29%), Positives = 38/71 (53%), Gaps = 7/71 (9%)

Query: 94  RYCLDGTGYFDVRDAESDEWIR-CK-VEPGDLLILPAGIYHRFTLTDDNYIKALRLFKEE 151
           + C +  G  +VRD++ D  +  C+ V    L++   G    +TLT+D    AL++F+E+
Sbjct: 50  KLCQEHGGDINVRDSDGDTPLHHCEDVRVAQLIVEELG--GDYTLTNDEGKTALQVFEED 107

Query: 152 ---PKWLAYNR 159
              P+ + Y R
Sbjct: 108 AEFPELIQYMR 118

>CAGL0H06721g complement(667816..671061) similar to sp|P40453
           Saccharomyces cerevisiae YIL156w UBP7, hypothetical
           start
          Length = 1081

 Score = 27.3 bits (59), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 18/70 (25%), Positives = 36/70 (51%), Gaps = 7/70 (10%)

Query: 21  TGREISLQR--LEKIGVFYRHFKTQQEVDELARE-----RNYKNRDIVSISKESFGNDEN 73
           TG+ IS  +    K+G+  +H   Q+++D++ R+        K++ +V+I   +F +   
Sbjct: 909 TGKAISRSKSPFRKLGLLEKHEGKQEKLDKMERDEIEEWHKMKSKKLVTIKTINFISLPK 968

Query: 74  AMIEKLKVFY 83
            +I  L  FY
Sbjct: 969 VLIIHLSRFY 978

>ADL379C [1362] [Homologous to ScYPR083W - SH] (43304..44902) [1599
           bp, 532 aa]
          Length = 532

 Score = 27.3 bits (59), Expect = 7.7,   Method: Composition-based stats.
 Identities = 13/42 (30%), Positives = 20/42 (47%)

Query: 49  LARERNYKNRDIVSISKESFGNDENAMIEKLKVFYSEHLHED 90
           L RE      DI +I +E F  +E    E++     E +H+D
Sbjct: 259 LLRENRLLQADITAIEREQFDREEQRNAERIGQLVDEAVHKD 300

>Kwal_26.6877
          Length = 306

 Score = 27.3 bits (59), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 15/60 (25%), Positives = 31/60 (51%), Gaps = 8/60 (13%)

Query: 118 VEPGDLLILPAGIYHRFTLTDDNYIKAL--RLFKEEPKWLAYNRPDADSN----PTREEY 171
           ++PG++L LP G +H  T    +Y  ++  R+      W  +  PD ++     P++++Y
Sbjct: 218 LKPGEMLYLPTGWFHEVTSFGSDYAASIADRIHIAANYW--FTPPDGETQDNLYPSKDQY 275

>YOL064C (MET22) [4755] chr15 complement(206102..207175) 3'- (2'-),
           5'- Bisphosphate nucleotidase required for sulfate
           assimilation, involved in salt tolerance, methionine
           biogenesis, and RNA processing [1074 bp, 357 aa]
          Length = 357

 Score = 27.3 bits (59), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 20/76 (26%), Positives = 34/76 (44%), Gaps = 4/76 (5%)

Query: 33  IGVFYRHFKTQQEVDELARERNYKNRDIVS---ISKESFGNDENAMIEKLKVFYSEHLHE 89
           +G FY      +   ++        +D+++   + K    +DE   I K K+  S+ LH 
Sbjct: 204 LGAFYSPSSDAESWTKIHVRHLKDTKDMITLEGVEKGHSSHDEQTAI-KNKLNISKSLHL 262

Query: 90  DEEIRYCLDGTGYFDV 105
           D + +YCL   G  DV
Sbjct: 263 DSQAKYCLLALGLADV 278

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.318    0.137    0.409 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 6,803,333
Number of extensions: 305404
Number of successful extensions: 930
Number of sequences better than 10.0: 36
Number of HSP's gapped: 925
Number of HSP's successfully gapped: 36
Length of query: 177
Length of database: 16,596,109
Length adjustment: 95
Effective length of query: 82
Effective length of database: 13,307,399
Effective search space: 1091206718
Effective search space used: 1091206718
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 58 (26.9 bits)