Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Sklu_2238.220720710941e-154
Kwal_14.23942072078671e-120
AAL176C2052078371e-115
Scas_675.282162157791e-106
KLLA0D02376g2072077711e-105
CAGL0G07689g2152147721e-105
YKR014C (YPT52)2342347401e-100
YOR089C (VPS21)2102025335e-69
Kwal_23.29782112075144e-66
KLLA0C13728g2082085014e-64
CAGL0J08635g2082094962e-63
Scas_662.262121724875e-62
ACL084C2072034823e-61
YNL093W (YPT53)2201924816e-61
Sklu_2366.32181993833e-46
KLLA0F01232g2102133615e-43
Kwal_56.225552122083572e-42
Kwal_14.24842031783553e-42
AEL187C2082063554e-42
Sklu_2293.32141733521e-41
Scas_574.22221733512e-41
CAGL0K06017g2191733503e-41
YLR262C (YPT6)2151733494e-41
CAGL0I09306g2061693415e-40
CAGL0K09394g2211703382e-39
AGR257C2202153364e-39
Scas_203.22511783384e-39
AER434C2191703355e-39
YER031C (YPT31)2231723322e-38
KLLA0F20471g2121733294e-38
YGL210W (YPT32)2221653295e-38
Scas_712.412192153242e-37
CAGL0C02453g2181653233e-37
YBR264C (YPT10)1991593137e-36
Kwal_23.50582132033024e-34
KLLA0D05313g2042072981e-33
Scas_713.52112112824e-31
Kwal_14.11162042082814e-31
AGL021W2122032815e-31
KLLA0E12111g2142042816e-31
Scas_707.262102042807e-31
CAGL0K12672g2062072807e-31
Sklu_1815.22132032808e-31
YFL005W (SEC4)2151762801e-30
Scas_656.22182032791e-30
CAGL0E02607g2082072782e-30
Scas_674.52082072772e-30
ABR220W2042072753e-30
Sklu_2144.32042072754e-30
YFL038C (YPT1)2062072745e-30
Kwal_56.224402081832712e-29
YML001W (YPT7)2082072702e-29
CAGL0F02123g2151762703e-29
ACR003C2081782694e-29
Sklu_2373.32081832669e-29
Kwal_47.190551791412622e-28
KLLA0D01265g2071982632e-28
Sklu_1136.11821412613e-28
Kwal_33.140152711652166e-21
YOR185C (GSP2)2201702111e-20
YLR293C (GSP1)2191702102e-20
Scas_610.42111762092e-20
Kwal_56.233612141702075e-20
AGR294C2141702067e-20
Sklu_2285.42141702068e-20
KLLA0C05126g2141702058e-20
KLLA0A04499g2141702058e-20
Scas_586.62191692051e-19
CAGL0I00594g2141692051e-19
ABR182W2091722041e-19
YKR055W (RHO4)2911992071e-19
YPR165W (RHO1)2091762031e-19
KLLA0C13816g1871641994e-19
Kwal_55.219372081731952e-18
Sklu_1816.11881691942e-18
Sklu_2151.42071721952e-18
Scas_691.362121751952e-18
CAGL0I08459g2101761926e-18
ABR183W2071761911e-17
KLLA0B10626g2081751901e-17
Sklu_2345.52191691902e-17
Sklu_2151.32091761892e-17
YNL090W (RHO2)1921821882e-17
ACR257C2591861903e-17
ACL087C1871681854e-17
CAGL0K08316g3231651914e-17
Kwal_55.219412091761856e-17
Kwal_33.144522602121878e-17
Scas_444.4*2891671871e-16
Sklu_1655.12871651871e-16
Scas_547.32231521841e-16
Scas_578.71871641811e-16
KLLA0D08327g2541911842e-16
Sklu_2007.22611941832e-16
CAGL0J05632g1881701803e-16
KLLA0A05643g2181651796e-16
Sklu_1653.32561751791e-15
AER132W2321231744e-15
ABL139C2941901755e-15
Kwal_47.169832231731725e-15
Scas_417.32912001731e-14
KLLA0F03443g2231891673e-14
CAGL0L11242g2541471683e-14
Scas_703.412251191674e-14
YIL118W (RHO3)2311971631e-13
Scas_575.102711901642e-13
KLLA0B05038g2231241594e-13
ADL252W2241891586e-13
AFR464W2641821581e-12
KLLA0C12001g2591931571e-12
CAGL0G08558g2271811552e-12
Scas_671.352341991552e-12
YGR152C (RSR1)2722101543e-12
YOR101W (RAS1)3091661544e-12
KLLA0A11330g1901701505e-12
CAGL0E03113g3231661536e-12
AGL093W1911781462e-11
YNL180C (RHO5)3312481502e-11
Kwal_34.161421921571462e-11
Kwal_14.22442441691473e-11
YML064C (TEM1)2451291464e-11
Scas_628.212081891445e-11
YNL098C (RAS2)3221641449e-11
Kwal_26.83872921661431e-10
CAGL0J11242g3841331441e-10
Kwal_23.48752301241411e-10
YCR027C (RHB1)2091471401e-10
Scas_697.463241661422e-10
KLLA0A04213g1911781382e-10
Kwal_23.31351911781373e-10
YLR229C (CDC42)1911781364e-10
Scas_721.961911781356e-10
CAGL0F05269g1911781357e-10
Kwal_55.21971421941379e-10
CAGL0B04521g3391631352e-09
Scas_677.202832271342e-09
Kwal_23.29441841251294e-09
YOR094W (ARF3)1831251286e-09
Sklu_2320.21641241276e-09
YNL304W (YPT11)355991281e-08
ACL078W1811251251e-08
Scas_697.54*1811251242e-08
ADL262W2701631262e-08
ADL162W4041301272e-08
CAGL0G05764g2901871253e-08
Sklu_2365.21971671233e-08
KLLA0C13563g1821251214e-08
CAGL0I03916g1811631181e-07
KLLA0C12881g3731141202e-07
YDL137W (ARF2)1811591144e-07
Scas_624.4*1811591135e-07
Scas_701.42*1811591135e-07
CAGL0J09064g1811631136e-07
Sklu_2354.104221221149e-07
YDL192W (ARF1)1811591092e-06
ADR094W1811241083e-06
KLLA0F05225g1811241064e-06
Sklu_1681.21621231055e-06
Kwal_56.244531811241066e-06
Kwal_27.118721971241066e-06
CAGL0M03817g475971087e-06
Kwal_56.244621811281041e-05
CAGL0E05896g1891191012e-05
YPL218W (SAR1)190119986e-05
Scas_706.2*190119971e-04
Scas_503.2527117972e-04
Scas_567.9199189942e-04
Kwal_47.18241230122934e-04
YPL051W (ARL3)198186925e-04
KLLA0B02046g190119915e-04
Sklu_2202.6183124880.001
CAGL0L12826g199186870.002
AGL261W198117860.002
AGR221W183124850.004
KLLA0E24805g18392840.004
KLLA0F17072g190140840.004
Kwal_56.2414914969810.007
KLLA0C13387g21196820.009
YBR164C (ARL1)183124810.010
CAGL0I10835g183124810.010
KLLA0F02662g253137810.014
Scas_700.11183124800.015
ADR402W661206760.087
AFL114W190119740.094
KLLA0E12837g19978740.10
Sklu_2411.4496135750.10
CAGL0E06292g408161750.11
KLLA0E07634g501179720.22
Sklu_1358.1218130710.22
Sklu_1689.135798710.27
Scas_680.2118389700.28
Kwal_26.681066470700.47
YAL048C662170690.68
KLLA0E11638g40583680.70
Scas_698.27701102680.92
KLLA0A03465g65926652.0
Scas_721.9039745623.9
CAGL0G09977g152885633.9
Kwal_55.2115045436624.0
Kwal_34.1597972846624.3
Kwal_26.8439114669624.8
YLL013C (PUF3)87937615.9
CAGL0D05544g91154616.3
YMR023C (MSS1)52623606.8
Scas_525.525281598.9
Sklu_1993.282362609.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Sklu_2238.2
         (207 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Sklu_2238.2 YKR014C, Contig c2238 2956-3579 reverse complement        426   e-154
Kwal_14.2394                                                          338   e-120
AAL176C [11] [Homologous to ScYKR014C (YPT52) - SH] (31588..3220...   327   e-115
Scas_675.28                                                           304   e-106
KLLA0D02376g 201512..202135 similar to sp|P36018 Saccharomyces c...   301   e-105
CAGL0G07689g complement(729919..730566) highly similar to sp|P36...   301   e-105
YKR014C (YPT52) [3269] chr11 complement(465010..465714) GTP-bind...   289   e-100
YOR089C (VPS21) [4894] chr15 complement(490197..490829) GTP-bind...   209   5e-69
Kwal_23.2978                                                          202   4e-66
KLLA0C13728g 1173329..1173955 highly similar to sp|P36017 Saccha...   197   4e-64
CAGL0J08635g complement(853978..854604) highly similar to sp|P36...   195   2e-63
Scas_662.26                                                           192   5e-62
ACL084C [965] [Homologous to ScYOR089C (VPS21) - SH; ScYNL093W (...   190   3e-61
YNL093W (YPT53) [4498] chr14 (449868..450530) GTP-binding protei...   189   6e-61
Sklu_2366.3 , Contig c2366 5288-5944 reverse complement               152   3e-46
KLLA0F01232g complement(114430..115062) similar to sp|P36019 Sac...   143   5e-43
Kwal_56.22555                                                         142   2e-42
Kwal_14.2484                                                          141   3e-42
AEL187C [2319] [Homologous to ScYBR264C (YPT10) - SH] (284984..2...   141   4e-42
Sklu_2293.3 YLR262C, Contig c2293 4975-5619                           140   1e-41
Scas_574.2                                                            139   2e-41
CAGL0K06017g complement(586093..586752) highly similar to sp|Q99...   139   3e-41
YLR262C (YPT6) [3655] chr12 complement(668246..668893) GTP-bindi...   139   4e-41
CAGL0I09306g complement(897087..897707) similar to sp|P38146 Sac...   135   5e-40
CAGL0K09394g complement(929234..929899) highly similar to sp|P51...   134   2e-39
AGR257C [4568] [Homologous to ScYLR262C (YPT6) - SH] (1225886..1...   134   4e-39
Scas_203.2                                                            134   4e-39
AER434C [2934] [Homologous to ScYGL210W (YPT32) - SH; ScYER031C ...   133   5e-39
YER031C (YPT31) [1456] chr5 complement(214075..214746) GTP-bindi...   132   2e-38
KLLA0F20471g 1901749..1902387 highly similar to sp|Q99260 Saccha...   131   4e-38
YGL210W (YPT32) [1786] chr7 (93795..94463) GTP-binding protein r...   131   5e-38
Scas_712.41                                                           129   2e-37
CAGL0C02453g 247493..248149 highly similar to sp|P38555 Saccharo...   129   3e-37
YBR264C (YPT10) [444] chr2 complement(737727..738326) Member of ...   125   7e-36
Kwal_23.5058                                                          120   4e-34
KLLA0D05313g 459496..460110 gi|10129780|emb|CAC08198.1 Kluyverom...   119   1e-33
Scas_713.5                                                            113   4e-31
Kwal_14.1116                                                          112   4e-31
AGL021W [4290] [Homologous to ScYFL005W (SEC4) - SH] complement(...   112   5e-31
KLLA0E12111g 1075299..1075943 highly similar to sp|P07560 Saccha...   112   6e-31
Scas_707.26                                                           112   7e-31
CAGL0K12672g 1255541..1256161 highly similar to sp|P01123 Saccha...   112   7e-31
Sklu_1815.2 YFL005W, Contig c1815 3148-3789 reverse complement        112   8e-31
YFL005W (SEC4) [1676] chr6 (130329..130976) GTP-binding protein ...   112   1e-30
Scas_656.2                                                            112   1e-30
CAGL0E02607g complement(248761..249387) highly similar to sp|P32...   111   2e-30
Scas_674.5                                                            111   2e-30
ABR220W [814] [Homologous to ScYFL038C (YPT1) - SH] complement(8...   110   3e-30
Sklu_2144.3 YFL038C, Contig c2144 4079-4693                           110   4e-30
YFL038C (YPT1) [1645] chr6 complement(55365..55985) GTP-binding ...   110   5e-30
Kwal_56.22440                                                         108   2e-29
YML001W (YPT7) [3965] chr13 (267174..267800) GTP-binding protein...   108   2e-29
CAGL0F02123g 212117..212764 highly similar to sp|P07560 Saccharo...   108   3e-29
ACR003C [1051] [Homologous to ScYML001W (YPT7) - SH] (359762..36...   108   4e-29
Sklu_2373.3 YML001W, Contig c2373 10977-11603                         107   9e-29
Kwal_47.19055                                                         105   2e-28
KLLA0D01265g 110784..111407 highly similar to sp|P32939 Saccharo...   105   2e-28
Sklu_1136.1 YGL210W, Contig c1136 1284-1832                           105   3e-28
Kwal_33.14015                                                          88   6e-21
YOR185C (GSP2) [4981] chr15 complement(681444..682106) Ran, a GT...    86   1e-20
YLR293C (GSP1) [3684] chr12 complement(720773..721432) Ran, a GT...    86   2e-20
Scas_610.4                                                             85   2e-20
Kwal_56.23361                                                          84   5e-20
AGR294C [4605] [Homologous to ScYOR185C (GSP2) - SH; ScYLR293C (...    84   7e-20
Sklu_2285.4 YLR293C, Contig c2285 4349-4993 reverse complement         84   8e-20
KLLA0C05126g complement(463657..464301) highly similar to sp|P32...    84   8e-20
KLLA0A04499g complement(404732..405376) highly similar to sp|P32...    84   8e-20
Scas_586.6                                                             84   1e-19
CAGL0I00594g 44835..45479 highly similar to sp|P32835 Saccharomy...    84   1e-19
ABR182W [775] [Homologous to ScYPR165W (RHO1) - SH] complement(7...    83   1e-19
YKR055W (RHO4) [3306] chr11 (547858..548733) GTP-binding protein...    84   1e-19
YPR165W (RHO1) [5580] chr16 (875362..875991) GTP-binding protein...    83   1e-19
KLLA0C13816g 1183412..1183975 highly similar to sp|P06781 Saccha...    81   4e-19
Kwal_55.21937                                                          80   2e-18
Sklu_1816.1 YNL090W, Contig c1816 115-681                              79   2e-18
Sklu_2151.4 , Contig c2151 3640-4263 reverse complement                80   2e-18
Scas_691.36                                                            80   2e-18
CAGL0I08459g 829292..829924 highly similar to sp|P06780 Saccharo...    79   6e-18
ABR183W [776] [Homologous to ScYPR165W (RHO1) - SH] complement(7...    78   1e-17
KLLA0B10626g 936497..937123 gi|22858698|gb|AAN05733.1 Kluyveromy...    78   1e-17
Sklu_2345.5 YCR027C, Contig c2345 9936-10595                           78   2e-17
Sklu_2151.3 YPR165W, Contig c2151 2495-3124 reverse complement         77   2e-17
YNL090W (RHO2) [4501] chr14 (456565..457143) GTP-binding protein...    77   2e-17
ACR257C [1304] [Homologous to ScYKR055W (RHO4) - SH] (808667..80...    78   3e-17
ACL087C [962] [Homologous to ScYNL090W (RHO2) - SH] (191573..192...    76   4e-17
CAGL0K08316g 838393..839364 some similarities with sp|Q00246 Sac...    78   4e-17
Kwal_55.21941                                                          76   6e-17
Kwal_33.14452                                                          77   8e-17
Scas_444.4*                                                            77   1e-16
Sklu_1655.1 YKR055W, Contig c1655 395-1258 reverse complement          77   1e-16
Scas_547.3                                                             75   1e-16
Scas_578.7                                                             74   1e-16
KLLA0D08327g 708240..709004 similar to sp|P53879 Saccharomyces c...    75   2e-16
Sklu_2007.2 YNL180C, Contig c2007 789-1574 reverse complement          75   2e-16
CAGL0J05632g complement(537342..537908) highly similar to sp|P06...    74   3e-16
KLLA0A05643g 528976..529632 similar to sp|Q00246 Saccharomyces c...    74   6e-16
Sklu_1653.3 YML064C, Contig c1653 2277-3047                            74   1e-15
AER132W [2636] [Homologous to ScYML064C (TEM1) - SH] complement(...    72   4e-15
ABL139C [453] [Homologous to ScYNL180C (RHO5) - SH] (134875..135...    72   5e-15
Kwal_47.16983                                                          71   5e-15
Scas_417.3                                                             71   1e-14
KLLA0F03443g 324020..324691 highly similar to sp|Q9HF51 Ashbya g...    69   3e-14
CAGL0L11242g 1197075..1197839 highly similar to sp|P38987 Saccha...    69   3e-14
Scas_703.41                                                            69   4e-14
YIL118W (RHO3) [2558] chr9 (139749..140444) GTP-binding protein ...    67   1e-13
Scas_575.10                                                            68   2e-13
KLLA0B05038g complement(457608..458279) similar to sp|P38987 Sac...    66   4e-13
ADL252W [1489] [Homologous to ScYIL118W (RHO3) - SH] complement(...    65   6e-13
AFR464W [3656] [Homologous to ScYGR152C (RSR1) - SH] complement(...    65   1e-12
KLLA0C12001g complement(1029092..1029871) similar to sp|P13856 S...    65   1e-12
CAGL0G08558g complement(804969..805652) highly similar to sp|Q00...    64   2e-12
Scas_671.35                                                            64   2e-12
YGR152C (RSR1) [2106] chr7 complement(794677..795495) GTP-bindin...    64   3e-12
YOR101W (RAS1) [4906] chr15 (515244..516173) GTP-binding protein...    64   4e-12
KLLA0A11330g 982552..983124 similar to ca|CA6070|IPF4842 Candida...    62   5e-12
CAGL0E03113g complement(289164..290135) some similarities with s...    64   6e-12
AGL093W [4218] [Homologous to ScYLR229C (CDC42) - SH] complement...    61   2e-11
YNL180C (RHO5) [4420] chr14 complement(299654..300649) GTPase of...    62   2e-11
Kwal_34.16142                                                          61   2e-11
Kwal_14.2244                                                           61   3e-11
YML064C (TEM1) [3905] chr13 complement(145139..145876) GTP-bindi...    61   4e-11
Scas_628.21                                                            60   5e-11
YNL098C (RAS2) [4493] chr14 complement(439602..440570) GTP-bindi...    60   9e-11
Kwal_26.8387                                                           60   1e-10
CAGL0J11242g 1092630..1093784 similar to sp|P53879 Saccharomyces...    60   1e-10
Kwal_23.4875                                                           59   1e-10
YCR027C (RHB1) [561] chr3 complement(167365..167994) Protein inv...    59   1e-10
Scas_697.46                                                            59   2e-10
KLLA0A04213g complement(382243..382818) highly similar to sp|P19...    58   2e-10
Kwal_23.3135                                                           57   3e-10
YLR229C (CDC42) [3629] chr12 complement(604214..604789) Rho-type...    57   4e-10
Scas_721.96                                                            57   6e-10
CAGL0F05269g complement(533759..534334) highly similar to sp|P19...    57   7e-10
Kwal_55.21971                                                          57   9e-10
CAGL0B04521g complement(439732..440751) similar to sp|P01120 Sac...    57   2e-09
Scas_677.20                                                            56   2e-09
Kwal_23.2944                                                           54   4e-09
YOR094W (ARF3) [4899] chr15 (502795..503346) Protein with simila...    54   6e-09
Sklu_2320.2 YOR094W, Contig c2320 3571-4065                            54   6e-09
YNL304W (YPT11) [4309] chr14 (60482..61549) Predicted GTPase pos...    54   1e-08
ACL078W [971] [Homologous to ScYOR094W (ARF3) - SH] complement(2...    53   1e-08
Scas_697.54*                                                           52   2e-08
ADL262W [1479] [Homologous to ScYOR101W (RAS1) - SH; ScYNL098C (...    53   2e-08
ADL162W [1579] [Homologous to ScYNL304W (YPT11) - SH] complement...    54   2e-08
CAGL0G05764g complement(552809..553681) similar to sp|P53879 Sac...    53   3e-08
Sklu_2365.2 YPL051W, Contig c2365 827-1420 reverse complement          52   3e-08
KLLA0C13563g complement(1157278..1157826) highly similar to sp|P...    51   4e-08
CAGL0I03916g 343014..343559 highly similar to sp|P11076 Saccharo...    50   1e-07
KLLA0C12881g 1090895..1092016 weakly similar to sp|P48559 Saccha...    51   2e-07
YDL137W (ARF2) [731] chr4 (216529..217074) GTP-binding protein o...    49   4e-07
Scas_624.4*                                                            48   5e-07
Scas_701.42*                                                           48   5e-07
CAGL0J09064g 892556..893101 highly similar to sp|P11076 Saccharo...    48   6e-07
Sklu_2354.10 YNL304W, Contig c2354 13851-15119                         49   9e-07
YDL192W (ARF1) [681] chr4 (116322..116867) GTP-binding protein i...    47   2e-06
ADR094W [1835] [Homologous to ScYDL192W (ARF1) - SH; ScYDL137W (...    46   3e-06
KLLA0F05225g 515391..515936 highly similar to sp|P19146 Saccharo...    45   4e-06
Sklu_1681.2 YDL137W, Contig c1681 2279-2767                            45   5e-06
Kwal_56.24453                                                          45   6e-06
Kwal_27.11872                                                          45   6e-06
CAGL0M03817g complement(431237..432664) weakly similar to sp|P48...    46   7e-06
Kwal_56.24462                                                          45   1e-05
CAGL0E05896g join(complement(585178..585202),complement(584348.....    44   2e-05
YPL218W (SAR1) [5231] chr16 (138697..138724,138864..139408) Comp...    42   6e-05
Scas_706.2*                                                            42   1e-04
Scas_503.2                                                             42   2e-04
Scas_567.9                                                             41   2e-04
Kwal_47.18241                                                          40   4e-04
YPL051W (ARL3) [5389] chr16 (459958..460554) ADP-ribosylation fa...    40   5e-04
KLLA0B02046g 178646..179218 highly similar to sp|P20606 Saccharo...    40   5e-04
Sklu_2202.6 YBR164C, Contig c2202 5407-5958                            39   0.001
CAGL0L12826g complement(1370767..1371366) highly similar to tr|Q...    38   0.002
AGL261W [4051] [Homologous to ScYPL051W (ARL3) - SH] complement(...    38   0.002
AGR221W [4532] [Homologous to ScYBR164C (ARL1) - SH] complement(...    37   0.004
KLLA0E24805g 2194554..2195105 highly similar to sp|P38116 Saccha...    37   0.004
KLLA0F17072g complement(1566668..1567240) similar to sp|P39110 S...    37   0.004
Kwal_56.24149                                                          36   0.007
KLLA0C13387g complement(1142002..1142637) similar to sp|P01119 S...    36   0.009
YBR164C (ARL1) [350] chr2 complement(567832..568383) GTP-binding...    36   0.010
CAGL0I10835g 1060258..1060809 highly similar to sp|P38116 Saccha...    36   0.010
KLLA0F02662g 241804..242565 some similarities with sp|Q8VEH3 Mus...    36   0.014
Scas_700.11                                                            35   0.015
ADR402W [2142] [Homologous to ScYAL048C - SH] complement(1426900...    34   0.087
AFL114W [3081] [Homologous to ScYPL218W (SAR1) - SH] complement(...    33   0.094
KLLA0E12837g 1135181..1135780 similar to sgd|S0005972 Saccharomy...    33   0.10 
Sklu_2411.4 YMR023C, Contig c2411 8898-10388                           33   0.10 
CAGL0E06292g 633135..634361 some similarities with sp|P01119 Sac...    33   0.11 
KLLA0E07634g 688734..690239 similar to sp|P32559 Saccharomyces c...    32   0.22 
Sklu_1358.1 YMR138W, Contig c1358 536-1192                             32   0.22 
Sklu_1689.1 YHR022C, Contig c1689 285-1358 reverse complement          32   0.27 
Scas_680.21                                                            32   0.28 
Kwal_26.6810                                                           32   0.47 
YAL048C (YAL048C) [19] chr1 complement(52804..54792) Protein inv...    31   0.68 
KLLA0E11638g 1028781..1029998 some similarities with sp|P01120 S...    31   0.70 
Scas_698.27                                                            31   0.92 
KLLA0A03465g complement(314573..316552) similar to sp|P39722 Sac...    30   2.0  
Scas_721.90                                                            28   3.9  
CAGL0G09977g 951295..955881 similar to sp|Q06625 Saccharomyces c...    29   3.9  
Kwal_55.21150                                                          28   4.0  
Kwal_34.15979                                                          28   4.3  
Kwal_26.8439                                                           28   4.8  
YLL013C (PUF3) [3406] chr12 complement(122074..124713) Protein i...    28   5.9  
CAGL0D05544g complement(527482..530217) similar to tr|Q07807 Sac...    28   6.3  
YMR023C (MSS1) [3987] chr13 complement(319436..321016) Mitochond...    28   6.8  
Scas_525.5                                                             27   8.9  
Sklu_1993.2 YIL130W, Contig c1993 2139-4610 reverse complement         28   9.0  

>Sklu_2238.2 YKR014C, Contig c2238 2956-3579 reverse complement
          Length = 207

 Score =  426 bits (1094), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 207/207 (100%), Positives = 207/207 (100%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLKDYNDTVVKFEIW 60
           MLQFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLKDYNDTVVKFEIW
Sbjct: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLKDYNDTVVKFEIW 60

Query: 61  DTAGQERYKSLAPMYYRNANGALVVYDVTQPDSLVKAQNWVDELKSKVGDEDLVICLVGN 120
           DTAGQERYKSLAPMYYRNANGALVVYDVTQPDSLVKAQNWVDELKSKVGDEDLVICLVGN
Sbjct: 61  DTAGQERYKSLAPMYYRNANGALVVYDVTQPDSLVKAQNWVDELKSKVGDEDLVICLVGN 120

Query: 121 KLDLCEEEGQERGVDKDDAQSYASDKGLLFHEVSAKTGKGVSNIFQEIGEKLYLQKKDSL 180
           KLDLCEEEGQERGVDKDDAQSYASDKGLLFHEVSAKTGKGVSNIFQEIGEKLYLQKKDSL
Sbjct: 121 KLDLCEEEGQERGVDKDDAQSYASDKGLLFHEVSAKTGKGVSNIFQEIGEKLYLQKKDSL 180

Query: 181 EAASQTRHVVNVELQRPTTNDATSCCV 207
           EAASQTRHVVNVELQRPTTNDATSCCV
Sbjct: 181 EAASQTRHVVNVELQRPTTNDATSCCV 207

>Kwal_14.2394
          Length = 207

 Score =  338 bits (867), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 161/207 (77%), Positives = 181/207 (87%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLKDYNDTVVKFEIW 60
           MLQFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKL+ + D  +KFEIW
Sbjct: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLEKHEDVTIKFEIW 60

Query: 61  DTAGQERYKSLAPMYYRNANGALVVYDVTQPDSLVKAQNWVDELKSKVGDEDLVICLVGN 120
           DTAGQERYKSLAPMYYRNAN ALVVYDVTQ  SLVKAQ+WV+ELK+KVGD+DLVICLVGN
Sbjct: 61  DTAGQERYKSLAPMYYRNANAALVVYDVTQAGSLVKAQSWVEELKNKVGDQDLVICLVGN 120

Query: 121 KLDLCEEEGQERGVDKDDAQSYASDKGLLFHEVSAKTGKGVSNIFQEIGEKLYLQKKDSL 180
           KLDLC EE   RGV+K+DAQ YA ++GLLFHEVSAKTG GV+ IFQEIGE +Y +K  + 
Sbjct: 121 KLDLCTEEEGGRGVEKEDAQMYAQEQGLLFHEVSAKTGSGVAAIFQEIGENVYQKKGAAT 180

Query: 181 EAASQTRHVVNVELQRPTTNDATSCCV 207
            A+ Q R   NV+LQRP+TND+TSCC+
Sbjct: 181 AASPQARKTPNVKLQRPSTNDSTSCCI 207

>AAL176C [11] [Homologous to ScYKR014C (YPT52) - SH] (31588..32205)
           [618 bp, 205 aa]
          Length = 205

 Score =  327 bits (837), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 157/207 (75%), Positives = 183/207 (88%), Gaps = 2/207 (0%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLKDYNDTVVKFEIW 60
           MLQFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLS+TIKL D++D ++KFEIW
Sbjct: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSRTIKLADHDDAMIKFEIW 60

Query: 61  DTAGQERYKSLAPMYYRNANGALVVYDVTQPDSLVKAQNWVDELKSKVGDEDLVICLVGN 120
           DTAGQERYKSLAPMYYRNAN ALVVYDVTQ DSL KAQ+WV+ELKSKVGDEDLVI LVGN
Sbjct: 61  DTAGQERYKSLAPMYYRNANAALVVYDVTQEDSLAKAQSWVNELKSKVGDEDLVIFLVGN 120

Query: 121 KLDLCEEEGQERGVDKDDAQSYASDKGLLFHEVSAKTGKGVSNIFQEIGEKLYLQKKDSL 180
           KLDL +E+ + R +D ++AQ+YA   GL+FHEVSAKTG G+ ++FQ IG KLY Q+++SL
Sbjct: 121 KLDLVDEDCKPRVIDSEEAQAYAEAHGLMFHEVSAKTGTGILDVFQGIGGKLYEQRRESL 180

Query: 181 EAASQTRHVVNVELQRPTTNDATSCCV 207
             A+Q +H  +++LQRPTTNDATSCCV
Sbjct: 181 --AAQPQHSSSIQLQRPTTNDATSCCV 205

>Scas_675.28
          Length = 216

 Score =  304 bits (779), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 151/215 (70%), Positives = 174/215 (80%), Gaps = 9/215 (4%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLK---DYNDTVVKF 57
           MLQFKLVLLGDSSVGKSSIVHRFVKDSFDE RESTIGAAFLSQTIK+K      D V+KF
Sbjct: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDSFDELRESTIGAAFLSQTIKIKAEEQEEDVVIKF 60

Query: 58  EIWDTAGQERYKSLAPMYYRNANGALVVYDVTQPDSLVKAQNWVDELKSKVGDEDLVICL 117
           EIWDTAGQERYKSLAPMYYRNAN ALVVYD+TQ DSLVKA++WV+ELK+KVGDEDLVI L
Sbjct: 61  EIWDTAGQERYKSLAPMYYRNANAALVVYDLTQKDSLVKARSWVEELKNKVGDEDLVIFL 120

Query: 118 VGNKLDLCEEEGQERGVDKDDAQSYASDKGLLFHEVSAKTGKGVSNIFQEIGEKLYLQKK 177
           VGNKLDLCE E   R VD  +A++YA ++ LLF EVSAKTG+GV  +F+ IGEKLY  KK
Sbjct: 121 VGNKLDLCEGEEDLRAVDTSEAKAYAEEQNLLFTEVSAKTGQGVKEVFRSIGEKLYASKK 180

Query: 178 DSL------EAASQTRHVVNVELQRPTTNDATSCC 206
           D +      E  ++  + V++  QRP+TND T+CC
Sbjct: 181 DEILAKKNRELGNRVNNSVDINAQRPSTNDTTTCC 215

>KLLA0D02376g 201512..202135 similar to sp|P36018 Saccharomyces
           cerevisiae YKR014c YPT52 GTP-binding protein of the rab
           family, start by similarity
          Length = 207

 Score =  301 bits (771), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 146/207 (70%), Positives = 173/207 (83%), Gaps = 2/207 (0%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKL-KDYNDTVVKFEI 59
           MLQFKLVLLGDSSVGKSSIVHRFVKDSFDE+RESTIGAAFLSQTIKL ++Y++ V+KFEI
Sbjct: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDSFDEYRESTIGAAFLSQTIKLSEEYDEQVLKFEI 60

Query: 60  WDTAGQERYKSLAPMYYRNANGALVVYDVTQPDSLVKAQNWVDELKSKVGDEDLVICLVG 119
           WDTAGQERYKSLAPMYYRNAN ALVVYDVT+PDSL KA+ WVDELK KV D+ L+ICLVG
Sbjct: 61  WDTAGQERYKSLAPMYYRNANAALVVYDVTEPDSLPKAKLWVDELKEKVNDDKLIICLVG 120

Query: 120 NKLDLCEEEGQERGVDKDDAQSYASDKGLLFHEVSAKTGKGVSNIFQEIGEKLYLQKKDS 179
           NKLDL  E      VD+ DA+ +A +  LLFH+VSAKTG+ V  +FQ+IGE+LYLQ KD 
Sbjct: 121 NKLDLVSERESTSLVDEADAREFAQENNLLFHQVSAKTGENVIKVFQDIGERLYLQNKDK 180

Query: 180 LEAASQTRHVVNVELQRPTTNDATSCC 206
           ++ + +  +  N+ LQRP+TND+ SCC
Sbjct: 181 IQESKKPNN-NNISLQRPSTNDSQSCC 206

>CAGL0G07689g complement(729919..730566) highly similar to sp|P36018
           Saccharomyces cerevisiae YKR014c YPT52 GTP-binding
           protein, start by similarity
          Length = 215

 Score =  301 bits (772), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 148/214 (69%), Positives = 174/214 (81%), Gaps = 8/214 (3%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLKDYN-DTVVKFEI 59
           MLQFKLVLLGDSSVGKSSIVHRFVKD+FDE RESTIGAAFLSQT+K+KD N D V+KFEI
Sbjct: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQTVKIKDGNEDVVIKFEI 60

Query: 60  WDTAGQERYKSLAPMYYRNANGALVVYDVTQPDSLVKAQNWVDELKSKVGDEDLVICLVG 119
           WDTAGQERYKSLAPMYYRNAN ALVVYDVTQPDSL KAQ+WV EL++KVGDE+LVI LVG
Sbjct: 61  WDTAGQERYKSLAPMYYRNANAALVVYDVTQPDSLSKAQSWVQELQNKVGDEELVIYLVG 120

Query: 120 NKLDLCEEEGQERGVDKDDAQSYASDKGLLFHEVSAKTGKGVSNIFQEIGEKLYLQKKDS 179
           NK+D+ E +   R ++ ++   YA  + LLF EVSAKTG GV +IFQEIGE+LY  KK S
Sbjct: 121 NKVDIVEADESARKIETEEGAEYAQAQKLLFKEVSAKTGAGVKDIFQEIGEQLYSTKKAS 180

Query: 180 LEAASQTR-------HVVNVELQRPTTNDATSCC 206
           L+   Q+R       + V+++ QRP+TND +SCC
Sbjct: 181 LKNKDQSRRTDSVSSNTVDIQTQRPSTNDTSSCC 214

>YKR014C (YPT52) [3269] chr11 complement(465010..465714) GTP-binding
           protein of the rab family (ras superfamily) involved in
           endocytosis and transport of proteins to the vacuole
           [705 bp, 234 aa]
          Length = 234

 Score =  289 bits (740), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 149/234 (63%), Positives = 176/234 (75%), Gaps = 29/234 (12%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKL-----KDYNDTVV 55
           MLQFKLVLLGDSSVGKSSIVHRFVKD+FDE RESTIGAAFLSQ+I +      +  D V+
Sbjct: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQSITIHPNDGNETKDVVI 60

Query: 56  KFEIWDTAGQERYKSLAPMYYRNANGALVVYDVTQPDSLVKAQNWVDELKSKVGDEDLVI 115
           KFEIWDTAGQERYKSLAPMYYRNAN ALVVYD+TQ DSL KA+NWVDELK+KVGD+DLVI
Sbjct: 61  KFEIWDTAGQERYKSLAPMYYRNANAALVVYDITQEDSLQKARNWVDELKNKVGDDDLVI 120

Query: 116 CLVGNKLDLCE----------------EEGQERGVDKDDAQSYASDKGLLFHEVSAKTGK 159
            L+GNK+DLC+                EE + R +  ++A+ YA ++GLLF EVSAKTG+
Sbjct: 121 YLLGNKVDLCQETPSTETSPDSNEGGDEEQKVRAISTEEAKQYAQEQGLLFREVSAKTGE 180

Query: 160 GVSNIFQEIGEKLYLQKKDSLEAASQTRHV-------VNVELQRPTTNDATSCC 206
           GV  IFQ+IGEKLY  KKD +  + Q R +       V++ LQRP+TND TSCC
Sbjct: 181 GVKEIFQDIGEKLYDLKKDEI-LSKQNRQIGGGNNGQVDINLQRPSTNDPTSCC 233

>YOR089C (VPS21) [4894] chr15 complement(490197..490829) GTP-binding
           protein required for sorting of vacuolar proteins and
           involved in late stage of endocytosis, member of the rab
           family in the ras superfamily [633 bp, 210 aa]
          Length = 210

 Score =  209 bits (533), Expect = 5e-69,   Method: Compositional matrix adjust.
 Identities = 107/202 (52%), Positives = 142/202 (70%), Gaps = 5/202 (2%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLKDYNDTVVKFEIWDTA 63
            KLVLLG+++VGKSSIV RFV + F E +E TIGAAFL+Q + +   N+  VKFEIWDTA
Sbjct: 8   IKLVLLGEAAVGKSSIVLRFVSNDFAENKEPTIGAAFLTQRVTI---NEHTVKFEIWDTA 64

Query: 64  GQERYKSLAPMYYRNANGALVVYDVTQPDSLVKAQNWVDELKSKVGDEDLVICLVGNKLD 123
           GQER+ SLAPMYYRNA  ALVVYDVT+P S +KA++WV EL  +   +D++I LVGNK+D
Sbjct: 65  GQERFASLAPMYYRNAQAALVVYDVTKPQSFIKARHWVKELHEQ-ASKDIIIALVGNKID 123

Query: 124 LCEEEGQERGVDKDDAQSYASDKGLLFHEVSAKTGKGVSNIFQEIGEKLYLQKKDSLEAA 183
           +  +EG ER V +++ +  A +KGLLF E SAKTG+ V+++F  IGEK+ L+  +   +A
Sbjct: 124 ML-QEGGERKVAREEGEKLAEEKGLLFFETSAKTGENVNDVFLGIGEKIPLKTAEEQNSA 182

Query: 184 SQTRHVVNVELQRPTTNDATSC 205
           S  R   N  +     ND TS 
Sbjct: 183 SNERESNNQRVDLNAANDGTSA 204

>Kwal_23.2978
          Length = 211

 Score =  202 bits (514), Expect = 4e-66,   Method: Compositional matrix adjust.
 Identities = 106/207 (51%), Positives = 143/207 (69%), Gaps = 9/207 (4%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLKDYNDTVVKFEIWDTA 63
            KLVLLG+++VGKSSIV RFV + F E +E TIGAAFL+Q + + D+    +KFEIWDTA
Sbjct: 8   IKLVLLGEAAVGKSSIVLRFVSNDFAENKEPTIGAAFLTQRVNMGDH---TIKFEIWDTA 64

Query: 64  GQERYKSLAPMYYRNANGALVVYDVTQPDSLVKAQNWVDELKSKVGDEDLVICLVGNKLD 123
           GQER+ SLAPMYYRNA  ALVVYDVT+P S +KA++WV EL+ +   +D+VI LVGNKLD
Sbjct: 65  GQERFASLAPMYYRNAQAALVVYDVTKPQSFIKARHWVKELREQ-ASKDIVIALVGNKLD 123

Query: 124 LCEEEGQERGVDKDDAQSYASDKGLLFHEVSAKTGKGVSNIFQEIGEKLYLQKKDSLEAA 183
           +  E G ER V +++A++ A+ + LLF E SAKTG  V+ +F  IG+K+ L+     +A 
Sbjct: 124 IV-ESGGERKVAREEAENLAAQEQLLFFETSAKTGSNVNEVFLGIGQKIPLKSPQQQQAQ 182

Query: 184 SQTRHVVN----VELQRPTTNDATSCC 206
             +   +N    V+L+    N A S C
Sbjct: 183 GPSGLRINDDARVDLRAAQGNSAQSNC 209

>KLLA0C13728g 1173329..1173955 highly similar to sp|P36017
           Saccharomyces cerevisiae YOR089c VPS21 GTP-binding
           protein, start by similarity
          Length = 208

 Score =  197 bits (501), Expect = 4e-64,   Method: Compositional matrix adjust.
 Identities = 106/208 (50%), Positives = 142/208 (68%), Gaps = 15/208 (7%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLKDYNDTVVKFEIWDTA 63
            KLVLLG+++VGKSSIV RFV + F E +E TIGAAFL+Q + + D+    +KFEIWDTA
Sbjct: 8   IKLVLLGEAAVGKSSIVLRFVSNDFAENKEPTIGAAFLTQRVNMADH---TIKFEIWDTA 64

Query: 64  GQERYKSLAPMYYRNANGALVVYDVTQPDSLVKAQNWVDELKSKVGDEDLVICLVGNKLD 123
           GQER+ SLAPMYYRNA  ALVVYDVT+P S +KA++WV EL  +   + +VI LVGNK+D
Sbjct: 65  GQERFASLAPMYYRNAQAALVVYDVTKPQSFIKARHWVKELHEQ-ASKGIVIALVGNKMD 123

Query: 124 LCEEEGQERGVDKDDAQSYASDKGLLFHEVSAKTGKGVSNIFQEIGEKLYLQKK-----D 178
           L E E ++R V K++A+  + ++ LLF E SAKTG  V+ +F  IGEK+ L+K      D
Sbjct: 124 LLESE-EDRKVAKEEAEKLSQEENLLFFETSAKTGDNVNEVFLAIGEKIPLKKSDGSNTD 182

Query: 179 SLEAASQTRHVVNVELQRP-TTNDATSC 205
            L      R    ++L +P  T++  SC
Sbjct: 183 GLRGTEDGR----IDLNKPDDTSNPNSC 206

>CAGL0J08635g complement(853978..854604) highly similar to sp|P36017
           Saccharomyces cerevisiae YOR089c VPS21 GTP-binding
           protein, start by similarity
          Length = 208

 Score =  195 bits (496), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 102/209 (48%), Positives = 142/209 (67%), Gaps = 9/209 (4%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLKDYNDTVVKFEIW 60
           +   KLVLLG+++VGKSSIV RFV + F E +E TIGAAFL+Q + +   N+  VKFEIW
Sbjct: 5   ITSLKLVLLGEAAVGKSSIVLRFVSNDFSENKEPTIGAAFLTQRVTI---NEHTVKFEIW 61

Query: 61  DTAGQERYKSLAPMYYRNANGALVVYDVTQPDSLVKAQNWVDELKSKVGDEDLVICLVGN 120
           DTAGQER+ SLAPMYYRNA  ALVVYDVT+P S +KA++WV EL+ +   +D++I LVGN
Sbjct: 62  DTAGQERFASLAPMYYRNAQAALVVYDVTKPQSFIKARHWVKELQEQ-ASKDIIIALVGN 120

Query: 121 KLDLCEEEGQERGVDKDDAQSYASDKGLLFHEVSAKTGKGVSNIFQEIGEKLYLQKKDSL 180
           K+D+  E G ER V +++A+  A ++ LLF E SAK+G+ ++++F  IGEK+ L+  +  
Sbjct: 121 KIDVL-ENGTERSVSREEAEKLAEEENLLFFETSAKSGENITDVFLAIGEKVPLKTANQA 179

Query: 181 EAASQTRHVVNVEL----QRPTTNDATSC 205
              +       V+L      P  N + SC
Sbjct: 180 NVPNNANENQRVDLTSVVNNPAANSSCSC 208

>Scas_662.26
          Length = 212

 Score =  192 bits (487), Expect = 5e-62,   Method: Compositional matrix adjust.
 Identities = 96/172 (55%), Positives = 127/172 (73%), Gaps = 4/172 (2%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLKDYNDTVVKFEIWDTA 63
            KLVLLG+++VGKSSIV RFV + F E +E TIGAAFL+Q + +   ND  VKFEIWDTA
Sbjct: 8   IKLVLLGEAAVGKSSIVLRFVSNDFSENKEPTIGAAFLTQRVNI---NDNTVKFEIWDTA 64

Query: 64  GQERYKSLAPMYYRNANGALVVYDVTQPDSLVKAQNWVDELKSKVGDEDLVICLVGNKLD 123
           GQER+ SLAPMYYRNA  AL+VYDVT+P S +KA++W+ EL  +  ++D++I LVGNK+D
Sbjct: 65  GQERFASLAPMYYRNAQAALIVYDVTKPQSFIKARHWIKELHEQ-ANKDMIIALVGNKVD 123

Query: 124 LCEEEGQERGVDKDDAQSYASDKGLLFHEVSAKTGKGVSNIFQEIGEKLYLQ 175
           + E    ER V +++ +  A ++GLLF E SAKTG  V+  F  IGEK+ L+
Sbjct: 124 VLENNEDERKVAREEGEKLAEEEGLLFFETSAKTGLNVTETFVAIGEKIPLK 175

>ACL084C [965] [Homologous to ScYOR089C (VPS21) - SH; ScYNL093W
           (YPT53) - SH] (199020..199643) [624 bp, 207 aa]
          Length = 207

 Score =  190 bits (482), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 101/203 (49%), Positives = 138/203 (67%), Gaps = 5/203 (2%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLKDYNDTVVKFEIWDTA 63
            KLVLLG+++VGKSSIV RFV + F E +E TIGAAFL+Q + +   +   +KFEIWDTA
Sbjct: 8   IKLVLLGEAAVGKSSIVLRFVSNDFSENKEPTIGAAFLTQRVNM---DSKTIKFEIWDTA 64

Query: 64  GQERYKSLAPMYYRNANGALVVYDVTQPDSLVKAQNWVDELKSKVGDEDLVICLVGNKLD 123
           GQER+ SLAPMYYRNA  ALVVYD+T+P S +KA++WV EL  +   + +VI LVGNKLD
Sbjct: 65  GQERFASLAPMYYRNAQAALVVYDITKPQSFIKARHWVKELHEQ-ASKGIVIALVGNKLD 123

Query: 124 LCEEEGQERGVDKDDAQSYASDKGLLFHEVSAKTGKGVSNIFQEIGEKLYLQKKDSLEAA 183
           L  E G+ R V +++A+  A ++GLLF E SAKTG  ++ +F  IGEK+ L K     A+
Sbjct: 124 LL-ENGEARKVSREEAEKLAEEEGLLFFETSAKTGDKINEVFLAIGEKIPLAKVGEQPAS 182

Query: 184 SQTRHVVNVELQRPTTNDATSCC 206
             +     ++L   ++N   + C
Sbjct: 183 GPSVDNARLDLNAVSSNQHANSC 205

>YNL093W (YPT53) [4498] chr14 (449868..450530) GTP-binding protein
           involved in endocytosis and transport of proteins to the
           vacuole, member of the rab family in the ras superfamily
           [663 bp, 220 aa]
          Length = 220

 Score =  189 bits (481), Expect = 6e-61,   Method: Compositional matrix adjust.
 Identities = 98/192 (51%), Positives = 132/192 (68%), Gaps = 6/192 (3%)

Query: 2   LQFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLKDYNDTVVKFEIWD 61
           L  K+VLLG+S+VGKSSIV RFV D F E +E TIGAAFL++ I     +  V+KFEIWD
Sbjct: 11  LTIKVVLLGESAVGKSSIVLRFVSDDFKESKEPTIGAAFLTKRIT---RDGKVIKFEIWD 67

Query: 62  TAGQERYKSLAPMYYRNANGALVVYDVTQPDSLVKAQNWVDELKSKVGDEDLVICLVGNK 121
           TAGQER+  LAPMYYRNA  ALVV+DVT   S  KAQNWV+EL  KVG  D+VI LVGNK
Sbjct: 68  TAGQERFAPLAPMYYRNAQAALVVFDVTNEGSFYKAQNWVEELHEKVG-HDIVIALVGNK 126

Query: 122 LDLC--EEEGQERGVDKDDAQSYASDKGLLFHEVSAKTGKGVSNIFQEIGEKLYLQKKDS 179
           +DL   ++E + R +     Q+    + LL+ E SAKTG+ +  IFQ +GEK+   ++++
Sbjct: 127 MDLLNNDDENENRAMKAPAVQNLCERENLLYFEASAKTGENIYQIFQTLGEKVPCPEQNT 186

Query: 180 LEAASQTRHVVN 191
            ++++  R + +
Sbjct: 187 RQSSTHDRTITD 198

>Sklu_2366.3 , Contig c2366 5288-5944 reverse complement
          Length = 218

 Score =  152 bits (383), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 85/199 (42%), Positives = 126/199 (63%), Gaps = 21/199 (10%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLK-------DYNDTVV 55
           + KLVLLG+SSVGKSSIV RF   +F     +TIGAAF ++T+ L+       +  D  +
Sbjct: 8   ELKLVLLGESSVGKSSIVTRFTTGNFHR-SNATIGAAFTTKTLSLESIVPETGETIDKKI 66

Query: 56  KFEIWDTAGQERYKSLAPMYYRNANGALVVYDVTQPDSLVKAQNWVDELKSKVGDED--- 112
           K EIWDTAGQERY+SLAPMYYRN + AL+V+DVT  DS+ +AQ+W+DEL   + + +   
Sbjct: 67  KLEIWDTAGQERYRSLAPMYYRNTDVALIVFDVTNKDSIARAQSWIDELNRYINEGEHEE 126

Query: 113 --LVICLVGNKLDLCEEEGQERGVDKDDAQSYASDKGLLFHEVSAKTGKGVSNIFQEIGE 170
             ++I +VGNK+DL  E  + + +       Y  D+G  +  VSAKTG G+  +F  I +
Sbjct: 127 RGILIKIVGNKIDLNPEARETQNL------PYIQDQGYNWFPVSAKTGDGIDELFDTIVK 180

Query: 171 KLYLQK--KDSLEAASQTR 187
           ++  +K  + +L+  ++ R
Sbjct: 181 EIPWEKFTRQNLQKTNEIR 199

>KLLA0F01232g complement(114430..115062) similar to sp|P36019
           Saccharomyces cerevisiae YNL093w YPT53 GTP-binding
           protein of the RAB family (RAS superfamily), start by
           similarity
          Length = 210

 Score =  143 bits (361), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 92/213 (43%), Positives = 130/213 (61%), Gaps = 26/213 (12%)

Query: 5   KLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLKDYNDTV---VKFEIWD 61
           KLVLLG+SSVGKS+IV RF    F      TIGAAF ++ ++  D  D +   V FEIWD
Sbjct: 11  KLVLLGESSVGKSTIVTRFTTGEF-HINSPTIGAAFSTKAMEWVDSEDGIKRRVNFEIWD 69

Query: 62  TAGQERYKSLAPMYYRNANGALVVYDVTQPDSLVKAQNWVDELKSKVGD--EDLV-ICLV 118
           TAGQERY+SLAPMYYRN + AL+V+DVTQ  S  KAQ+W+DEL + + D  +D V + +V
Sbjct: 70  TAGQERYRSLAPMYYRNTDVALIVFDVTQLASEKKAQSWIDELNNYLEDYKKDTVQLRVV 129

Query: 119 GNKLDLCEEEGQERGVDKDDAQSYASDKGLLFHEVSAKTGKGVSNIFQEIG-----EKLY 173
           GNK+DL +EE  +   + +DA+            VSAKTG+G+  +F +IG     +K  
Sbjct: 130 GNKIDLVDEETLQ---NWNDAEL-----------VSAKTGEGIDELFLKIGKDIPIDKFT 175

Query: 174 LQKKDSLEAASQTRHVVNVELQRPTTNDATSCC 206
           L ++D  ++ S +     + L++     +T  C
Sbjct: 176 LLQEDVPQSTSTSNEGGGINLEQSPEAVSTGNC 208

>Kwal_56.22555
          Length = 212

 Score =  142 bits (357), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 78/208 (37%), Positives = 130/208 (62%), Gaps = 10/208 (4%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLKDYNDTVVKFEIW 60
           + ++K+V LG+  VGK+S++ RF+ D+FD+  ++TIG  FLS+T+ L   +D  ++ ++W
Sbjct: 10  LTKYKIVFLGEQGVGKTSLITRFMYDTFDDHYQATIGIDFLSKTMYL---DDKTIRLQLW 66

Query: 61  DTAGQERYKSLAPMYYRNANGALVVYDVTQPDSLVKAQNWVDELKSKVGDEDLVICLVGN 120
           DTAGQER++SL P Y R+++ A+VVYDVT   S      WV+++KS+ G+E++V+C+VGN
Sbjct: 67  DTAGQERFRSLIPSYIRDSHVAIVVYDVTNKKSFEYIDKWVEDVKSERGEENVVLCIVGN 126

Query: 121 KLDLCEEEGQERGVDKDDAQSYASD-KGLLFHEVSAKTGKGVSNIFQEIGEKLY-LQKKD 178
           K DL +    ER V  ++ +  A      +F E S K G  V N+F++I + L   QK D
Sbjct: 127 KNDLSD----ERQVSTEEGERKAQVLNAKIFIETSTKAGFNVKNLFRKIAKTLPEFQKAD 182

Query: 179 SLEAASQTRHVVNV-ELQRPTTNDATSC 205
                 Q ++  +V ++   +  + +SC
Sbjct: 183 EDPLGEQAKNKPDVIDITTASEQEQSSC 210

>Kwal_14.2484
          Length = 203

 Score =  141 bits (355), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 80/178 (44%), Positives = 116/178 (65%), Gaps = 20/178 (11%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLK-DYNDTVVKFEIWD 61
           + KLVLLG+SSVGKS++V RF   SF +   +TIGAAF ++ I  + +     VKFEIWD
Sbjct: 9   ELKLVLLGESSVGKSALVTRFTTGSFHK-SNATIGAAFTTKVISWETETARKEVKFEIWD 67

Query: 62  TAGQERYKSLAPMYYRNANGALVVYDVTQPDSLVKAQNWVDELKSKV-GDE--DLVICLV 118
           TAGQERY++L PMYYRN + A VV+DVT+  + +KA +WV ELKS + G+E  ++VI L+
Sbjct: 68  TAGQERYRALTPMYYRNTDVAFVVFDVTEESTSLKADSWVQELKSYMEGEEAHNIVIKLI 127

Query: 119 GNKLDLCEEEGQERGVDKDDAQSYASDKGLLFHEVSAKTGKGVSNIFQEIGEKLYLQK 176
           GNK+DL +E                  + + +  VSAKTG+GV+++F+ +  ++   K
Sbjct: 128 GNKIDLLDE---------------VPPRKVGWTPVSAKTGEGVADLFESVAREVPSSK 170

>AEL187C [2319] [Homologous to ScYBR264C (YPT10) - SH]
           (284984..285610) [627 bp, 208 aa]
          Length = 208

 Score =  141 bits (355), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 90/206 (43%), Positives = 124/206 (60%), Gaps = 33/206 (16%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLK----DYNDT----V 54
           Q KLVLLG+SSVGKSSIV RF    F +  ++TIGAAF +++++ +    D +D      
Sbjct: 8   QVKLVLLGESSVGKSSIVTRFTTGEFRK-NQATIGAAFTTRSVQWEEDAGDGSDAKEVRS 66

Query: 55  VKFEIWDTAGQERYKSLAPMYYRNANGALVVYDVTQPDSLVKAQNWVDELKSKVGD---E 111
           V FEIWDTAGQERY+SLAPMYYRN + ALVVYDVT+  S   A++W+DEL + +G+    
Sbjct: 67  VTFEIWDTAGQERYRSLAPMYYRNTDVALVVYDVTEQQSFQNARSWIDELNTYIGEAQRN 126

Query: 112 DLVICLVGNKLDLCEEEGQERGVDKDDAQSYASDKGLLFHEVSAKTGKGVSNIFQEIG-- 169
           D+V+ +VGNK+DL        G   +     A+        VSAKTG+G+  +F +I   
Sbjct: 127 DVVVRIVGNKIDL------HAGGQLEQPLPSATF-------VSAKTGEGIEELFMDIAKH 173

Query: 170 ---EKLYLQKKDSLEAASQTRHVVNV 192
              E+  LQ +      S  R ++NV
Sbjct: 174 VKPERFVLQAEPQ---ESPQRSILNV 196

>Sklu_2293.3 YLR262C, Contig c2293 4975-5619
          Length = 214

 Score =  140 bits (352), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 69/173 (39%), Positives = 115/173 (66%), Gaps = 8/173 (4%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLKDYNDTVVKFEIW 60
           + ++K+V LG+  VGK+S++ RF+ D+FD+  ++TIG  FLS+T+ L   +D  ++ ++W
Sbjct: 10  LTKYKIVFLGEQGVGKTSLITRFMYDTFDDHYQATIGIDFLSKTMYL---DDKTIRLQLW 66

Query: 61  DTAGQERYKSLAPMYYRNANGALVVYDVTQPDSLVKAQNWVDELKSKVGDEDLVICLVGN 120
           DTAGQER++SL P Y R+++ A+VVYDVT   S      W++++KS+ G+E++++C+VGN
Sbjct: 67  DTAGQERFRSLIPSYIRDSHVAIVVYDVTNKKSFEYIDKWIEDVKSERGEENVILCIVGN 126

Query: 121 KLDLCEEEGQERGVDKDDAQSYASD-KGLLFHEVSAKTGKGVSNIFQEIGEKL 172
           K DL +    ER V  ++ +  A      +F E S K G  V N+F++I + L
Sbjct: 127 KNDLVD----ERQVSTEEGERKAQVLNAKIFMETSTKAGFNVKNLFKKIAKSL 175

>Scas_574.2
          Length = 222

 Score =  139 bits (351), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 68/173 (39%), Positives = 117/173 (67%), Gaps = 8/173 (4%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLKDYNDTVVKFEIW 60
           + ++K+V LG+  VGK+S++ RF+ D+FD+  ++TIG  FLS+T+ L   +D  ++ ++W
Sbjct: 8   LTKYKIVFLGEQGVGKTSLITRFMYDTFDDHYQATIGIDFLSKTMYL---DDKTIRLQLW 64

Query: 61  DTAGQERYKSLAPMYYRNANGALVVYDVTQPDSLVKAQNWVDELKSKVGDEDLVICLVGN 120
           DTAGQER++SL P Y R++  A+VVYD+T+  S      W++++K++ GD+++++C+VGN
Sbjct: 65  DTAGQERFRSLIPSYIRDSRVAIVVYDITKKKSFEYIDKWIEDVKNERGDDNVILCIVGN 124

Query: 121 KLDLCEEEGQERGVDKDDAQSYASDKGL-LFHEVSAKTGKGVSNIFQEIGEKL 172
           K DL +    ER V  ++ ++ A   G  +F E S K G  V N+F++I + L
Sbjct: 125 KSDLSD----ERQVTIEEGENKAKILGADIFMETSTKAGYNVKNLFKKIAKSL 173

>CAGL0K06017g complement(586093..586752) highly similar to sp|Q99260
           Saccharomyces cerevisiae YLR262c GTP-binding protein,
           start by similarity
          Length = 219

 Score =  139 bits (350), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 68/173 (39%), Positives = 116/173 (67%), Gaps = 8/173 (4%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLKDYNDTVVKFEIW 60
           + ++K+V LG+  VGK+S++ RF+ D+FD+  ++TIG  FLS+T+ L   +D  ++ ++W
Sbjct: 9   LTKYKIVFLGEQGVGKTSLITRFMYDTFDDNYQATIGIDFLSKTMYL---DDKTIRLQLW 65

Query: 61  DTAGQERYKSLAPMYYRNANGALVVYDVTQPDSLVKAQNWVDELKSKVGDEDLVICLVGN 120
           DTAGQER++SL P Y R++  A+VVYD+T+  S      W++++K++ G E++++C+VGN
Sbjct: 66  DTAGQERFRSLIPSYIRDSRVAIVVYDITKRKSFEFIDKWIEDVKNERGAENVILCVVGN 125

Query: 121 KLDLCEEEGQERGVDKDDAQSYASDKGL-LFHEVSAKTGKGVSNIFQEIGEKL 172
           K DL +    ER V  ++ +  A D G  +F + S K G  V N+F++I + L
Sbjct: 126 KSDLAD----ERQVTAEEGEKKAQDLGAKIFMQTSTKVGYNVKNLFKKIAKSL 174

>YLR262C (YPT6) [3655] chr12 complement(668246..668893) GTP-binding
           protein involved in the secretory pathway, member of the
           rab family in the ras superfamily [648 bp, 215 aa]
          Length = 215

 Score =  139 bits (349), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 66/173 (38%), Positives = 115/173 (66%), Gaps = 8/173 (4%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLKDYNDTVVKFEIW 60
           + ++K+V LG+  VGK+S++ RF+ D+FD+  ++TIG  FLS+T+ L   +D  ++ ++W
Sbjct: 8   LTKYKIVFLGEQGVGKTSLITRFMYDTFDDHYQATIGIDFLSKTMYL---DDKTIRLQLW 64

Query: 61  DTAGQERYKSLAPMYYRNANGALVVYDVTQPDSLVKAQNWVDELKSKVGDEDLVICLVGN 120
           DTAGQER++SL P Y R++  A++VYD+T+  S      W++++K++ GDE++++C+VGN
Sbjct: 65  DTAGQERFRSLIPSYIRDSRVAIIVYDITKRKSFEYIDKWIEDVKNERGDENVILCIVGN 124

Query: 121 KLDLCEEEGQERGVDKDDAQSYASDKGL-LFHEVSAKTGKGVSNIFQEIGEKL 172
           K DL +    ER +  ++ +  A   G  +F E S K G  V  +F++I + L
Sbjct: 125 KSDLSD----ERQISTEEGEKKAKLLGAKIFMETSTKAGYNVKALFKKIAKSL 173

>CAGL0I09306g complement(897087..897707) similar to sp|P38146
           Saccharomyces cerevisiae YBR264c GTP-binding protein,
           hypothetical start
          Length = 206

 Score =  135 bits (341), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 75/169 (44%), Positives = 108/169 (63%), Gaps = 14/169 (8%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIK-LKDYNDTVVKFEIWDT 62
            K+VLLG+S+VGKS+IV RF    +     +TIGAA++++ ++ ++D +   V+ EIWDT
Sbjct: 11  LKVVLLGESAVGKSAIVTRFSTGKYLR-NNATIGAAYVTKDLEYIRDGDVYQVRLEIWDT 69

Query: 63  AGQERYKSLAPMYYRNANGALVVYDVTQPDSLVKAQNWVDELKSKV---GDEDLVICLVG 119
           AGQERY+SL PMYYRN + A+VV+DV+   SL  A  W+DEL + V   G E + I LVG
Sbjct: 70  AGQERYRSLTPMYYRNTDVAIVVFDVSNLRSLSMAHKWIDELNTYVENKGRERINIVLVG 129

Query: 120 NKLDLCEEEGQERGVDKDDAQSYASDKGLLFHEVSAKTGKGVSNIFQEI 168
           NK+DLC +E +     + + Q         F  VSAK+G+G+  +F  I
Sbjct: 130 NKMDLCSDEERSTLPQRVEEQ---------FQAVSAKSGEGIEELFDHI 169

>CAGL0K09394g complement(929234..929899) highly similar to sp|P51996
           Saccharomyces cerevisiae YGL210w YPT32 or sp|P38555
           Saccharomyces cerevisiae YER031c YPT31, start by
           similarity
          Length = 221

 Score =  134 bits (338), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 71/170 (41%), Positives = 109/170 (64%), Gaps = 8/170 (4%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLKDYNDTVVKFEIWDTA 63
           FK+VL+GDS VGKS+++ RF  + F+   +STIG  F ++TIK++D     +K +IWDTA
Sbjct: 15  FKIVLIGDSGVGKSNLLSRFTTNEFNLESKSTIGVEFATRTIKVEDKK---IKAQIWDTA 71

Query: 64  GQERYKSLAPMYYRNANGALVVYDVTQPDSLVKAQNWVDELKSKVGDEDLVICLVGNKLD 123
           GQERY+++   YYR A GAL+VYD+++  +     +W+ ELK    D+++ I L+GNK D
Sbjct: 72  GQERYRAITSAYYRGAVGALIVYDISKSGTYENCNHWLTELKENA-DDNVAIGLIGNKSD 130

Query: 124 LCEEEGQERGVDKDDAQSYASDKGLLFHEVSAKTGKGVSNIFQEIGEKLY 173
           L       R V  ++A+ +AS+  L F E SA   + V   F+E+ E++Y
Sbjct: 131 L----EHLRAVPTEEARGFASENQLFFTETSALNSENVDLAFRELIEQIY 176

>AGR257C [4568] [Homologous to ScYLR262C (YPT6) - SH]
           (1225886..1226548) [663 bp, 220 aa]
          Length = 220

 Score =  134 bits (336), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 75/215 (34%), Positives = 127/215 (59%), Gaps = 19/215 (8%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLKDYNDTVVKFEIWDT 62
           ++K+V LG+  VGK+S++ RF+ D+FD+  ++TIG  FLS+T+ L   +D  ++ ++WDT
Sbjct: 12  KYKIVFLGEQGVGKTSLITRFMYDTFDDHYQATIGIDFLSKTVYL---DDRTIRLQLWDT 68

Query: 63  AGQERYKSLAPMYYRNANGALVVYDVTQPDSLVKAQNWVDELKSKVGDEDLVICLVGNKL 122
           AGQER++SL P Y R+++ A+VVYD+T   S      WV++++++ G+E+L++C+VGNK 
Sbjct: 69  AGQERFRSLIPSYIRDSHVAIVVYDITNKKSFEYIDKWVEDVRNERGEENLILCIVGNKS 128

Query: 123 DLCEEEGQERGVDKDDAQSYAS-DKGLLFHEVSAKTGKGVSNIFQEIGEKLY-------- 173
           DL +    ER V  ++ ++ A      +F E S K G  V  +F+ I + L         
Sbjct: 129 DLVD----ERKVTVEEGENKAKLLNAKIFVETSTKAGFNVGALFKRIAKLLPEFQNGKGT 184

Query: 174 --LQKKDSLEAASQTRHVVNVELQRPTTNDATSCC 206
             L   D+ +  + TR  V +++  P      S C
Sbjct: 185 SGLGNGDAEKDGAGTRQGV-IDISVPVAKGGDSSC 218

>Scas_203.2
          Length = 251

 Score =  134 bits (338), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 78/178 (43%), Positives = 110/178 (61%), Gaps = 14/178 (7%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLKDYNDTV-VKFEIWD 61
           + K VLLG+SSVG++SIV RF      + R   IGAAFL++ I+  D ++   V  EIWD
Sbjct: 47  RLKFVLLGESSVGRTSIVTRFTTGKIPKKRMLPIGAAFLNKNIRWVDEDNIYEVDLEIWD 106

Query: 62  TAGQERYKSLAPMYYRNANGALVVYDVTQPDSLVKAQNWVDELKSKVGDE---DLVICLV 118
           TAGQERY+SLAP+YYRN + AL+V+DVT  ++  KA++WVDEL+S + +E   ++ + L+
Sbjct: 107 TAGQERYRSLAPIYYRNTDVALIVFDVTSSNTFQKARSWVDELRSYLDNEQGKEIQLYLI 166

Query: 119 GNKLDLCEEEGQERGVDKDDAQSYASDKGLLFHEVSAKTGKGVSNIFQEIGEKLYLQK 176
           GNK DL E E   +    D            F EVSAK  +G+  +F+EI   +   K
Sbjct: 167 GNKCDL-EHESIAKTAILDMCT---------FKEVSAKRDEGIQELFEEIARGIPTDK 214

>AER434C [2934] [Homologous to ScYGL210W (YPT32) - SH; ScYER031C
           (YPT31) - SH] (1466442..1467052,1467106..1467154) [660
           bp, 219 aa]
          Length = 219

 Score =  133 bits (335), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 70/170 (41%), Positives = 106/170 (62%), Gaps = 8/170 (4%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLKDYNDTVVKFEIWDTA 63
           FK+VL+GDS VGKS+++ RF  D F+   +STIG  F ++TI+++      VK +IWDTA
Sbjct: 15  FKIVLIGDSGVGKSNLLSRFTTDEFNVNSKSTIGVEFATRTIEVEGKK---VKAQIWDTA 71

Query: 64  GQERYKSLAPMYYRNANGALVVYDVTQPDSLVKAQNWVDELKSKVGDEDLVICLVGNKLD 123
           GQERY+++   YYR A GAL+VYD+++  S     +W+ EL+    DE++ + L+GNK D
Sbjct: 72  GQERYRAITSAYYRGAVGALIVYDISKSSSYENCNHWLTELREN-ADENVAVGLIGNKSD 130

Query: 124 LCEEEGQERGVDKDDAQSYASDKGLLFHEVSAKTGKGVSNIFQEIGEKLY 173
           L       R V  D+A+++A    +LF E SA   + V   F+E+   +Y
Sbjct: 131 LA----HLRAVPTDEAKNFAQGNQMLFTETSALNAENVDLAFRELITAIY 176

>YER031C (YPT31) [1456] chr5 complement(214075..214746) GTP-binding
           protein required in the secretory pathway at the stage
           of formation of trans-Golgi vesicles, member of the rab
           family in the ras superfamily of small GTP-binding
           proteins [672 bp, 223 aa]
          Length = 223

 Score =  132 bits (332), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 67/172 (38%), Positives = 109/172 (63%), Gaps = 8/172 (4%)

Query: 2   LQFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLKDYNDTVVKFEIWD 61
           L FK+VL+GDS VGKS+++ RF K+ F+   +STIG  F ++T+++   +   +K +IWD
Sbjct: 12  LLFKIVLIGDSGVGKSNLLSRFTKNEFNMDSKSTIGVEFATRTLEI---DGKRIKAQIWD 68

Query: 62  TAGQERYKSLAPMYYRNANGALVVYDVTQPDSLVKAQNWVDELKSKVGDEDLVICLVGNK 121
           TAGQERY+++   YYR A GAL+VYD+++  S     +W+ EL+    D+++ + L+GNK
Sbjct: 69  TAGQERYRAITSAYYRGAVGALIVYDISKSSSYENCNHWLSELRENA-DDNVAVGLIGNK 127

Query: 122 LDLCEEEGQERGVDKDDAQSYASDKGLLFHEVSAKTGKGVSNIFQEIGEKLY 173
            DL       R V  ++++++A +  LLF E SA   + V   F+E+   +Y
Sbjct: 128 SDLA----HLRAVPTEESKTFAQENQLLFTETSALNSENVDKAFEELINTIY 175

>KLLA0F20471g 1901749..1902387 highly similar to sp|Q99260
           Saccharomyces cerevisiae YLR262c YPT6 GTP-binding
           protein of the rab family, start by similarity
          Length = 212

 Score =  131 bits (329), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 67/173 (38%), Positives = 113/173 (65%), Gaps = 8/173 (4%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLKDYNDTVVKFEIW 60
           + ++K+V LG+  VGK+S++ RF+ D+FD+  ++TIG  FLS+T+ L   +D  ++ ++W
Sbjct: 9   LRKYKIVFLGEQGVGKTSLITRFMYDTFDDNYQATIGIDFLSKTMYL---DDKTIRLQLW 65

Query: 61  DTAGQERYKSLAPMYYRNANGALVVYDVTQPDSLVKAQNWVDELKSKVGDEDLVICLVGN 120
           DTAGQER++SL P Y R+++ A+VVYDVT   S      W++++K + G+E++++ +VGN
Sbjct: 66  DTAGQERFRSLIPSYIRDSHVAIVVYDVTNRKSFEYIDKWIEDVKMERGEENVILVIVGN 125

Query: 121 KLDLCEEEGQERGVDKDDAQSYASD-KGLLFHEVSAKTGKGVSNIFQEIGEKL 172
           K DL E    ER V  ++ +  ++     LF E S K G  V  +F++I + L
Sbjct: 126 KSDLVE----ERQVSTEEGERKSTVLNAKLFIETSTKAGFNVKTLFKKIAKLL 174

>YGL210W (YPT32) [1786] chr7 (93795..94463) GTP-binding protein
           required in the secretory pathway at the stage of
           formation of trans-Golgi vesicles, member of the rab
           family in the ras superfamily [669 bp, 222 aa]
          Length = 222

 Score =  131 bits (329), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 67/165 (40%), Positives = 105/165 (63%), Gaps = 8/165 (4%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLKDYNDTVVKFEIWDTA 63
           FK+VL+GDS VGKS+++ RF  D F+   +STIG  F ++TI++++     +K +IWDTA
Sbjct: 14  FKIVLIGDSGVGKSNLLSRFTTDEFNIESKSTIGVEFATRTIEVENKK---IKAQIWDTA 70

Query: 64  GQERYKSLAPMYYRNANGALVVYDVTQPDSLVKAQNWVDELKSKVGDEDLVICLVGNKLD 123
           GQERY+++   YYR A GAL+VYD+++  S     +W+ EL+    D+++ + L+GNK D
Sbjct: 71  GQERYRAITSAYYRGAVGALIVYDISKSSSYENCNHWLTELREN-ADDNVAVGLIGNKSD 129

Query: 124 LCEEEGQERGVDKDDAQSYASDKGLLFHEVSAKTGKGVSNIFQEI 168
           L       R V  D+A+++A +  +LF E SA     V   F+E+
Sbjct: 130 LA----HLRAVPTDEAKNFAMENQMLFTETSALNSDNVDKAFREL 170

>Scas_712.41
          Length = 219

 Score =  129 bits (324), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 76/215 (35%), Positives = 123/215 (57%), Gaps = 21/215 (9%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLKDYNDTVVKFEIWDTA 63
           FK+VL+GDS VGKS+++ RF  + F+   +STIG  F ++TI+++      +K +IWDTA
Sbjct: 14  FKIVLIGDSGVGKSNLLSRFTTNEFNIESKSTIGVEFATRTIEVEG---KKIKAQIWDTA 70

Query: 64  GQERYKSLAPMYYRNANGALVVYDVTQPDSLVKAQNWVDELKSKVGDEDLVICLVGNKLD 123
           GQERY+++   YYR A GAL+VYD+++  +     +W+ EL+    D+++ + L+GNK D
Sbjct: 71  GQERYRAITSAYYRGAVGALIVYDISKSGTYENCNHWLKELRDNA-DDNVAVGLIGNKSD 129

Query: 124 LCEEEGQERGVDKDDAQSYASDKGLLFHEVSAKTGKGVSNIFQEIGEKLY-------LQK 176
           L       R V   +A+++AS+  LLF E SA   + V   F+E+   +Y       +  
Sbjct: 130 LA----HLRAVPTAEAKNFASENELLFTETSALNSENVDQAFRELITAIYQMVSKHQVDL 185

Query: 177 KDSLEAASQTRHVVNVELQRPTTND-----ATSCC 206
            DS   A+       + L  PT N+     +++CC
Sbjct: 186 GDSGNNAAAAPKGPTISLT-PTPNENKKSSSSNCC 219

>CAGL0C02453g 247493..248149 highly similar to sp|P38555
           Saccharomyces cerevisiae YER031c YPT31, start by
           similarity
          Length = 218

 Score =  129 bits (323), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 68/165 (41%), Positives = 103/165 (62%), Gaps = 8/165 (4%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLKDYNDTVVKFEIWDTA 63
           FK+VL+GDS VGKS+++ RF  + F+   +STIG  F ++TI   D +   +K +IWDTA
Sbjct: 14  FKIVLIGDSGVGKSNLLSRFTTNEFNIDSKSTIGVEFATRTI---DVDGKKIKAQIWDTA 70

Query: 64  GQERYKSLAPMYYRNANGALVVYDVTQPDSLVKAQNWVDELKSKVGDEDLVICLVGNKLD 123
           GQERY+++   YYR A GAL+VYD+++  S     +W+ EL+    D+++ + L+GNK D
Sbjct: 71  GQERYRAITSAYYRGAVGALIVYDISKSSSYENCHHWLSELREN-ADDNVAVGLIGNKSD 129

Query: 124 LCEEEGQERGVDKDDAQSYASDKGLLFHEVSAKTGKGVSNIFQEI 168
           L       R V  ++A+ +AS+  LLF E SA     V   F+E+
Sbjct: 130 LA----HLRAVPTEEAKQFASENQLLFTETSALNSDNVDLAFKEL 170

>YBR264C (YPT10) [444] chr2 complement(737727..738326) Member of the
           rab family in the ras superfamily of small GTP-binding
           proteins [600 bp, 199 aa]
          Length = 199

 Score =  125 bits (313), Expect = 7e-36,   Method: Compositional matrix adjust.
 Identities = 73/159 (45%), Positives = 98/159 (61%), Gaps = 13/159 (8%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLKDYNDTV---VKFEIW 60
            K+VLLGDSSVGK+SIV R     F     +TIGAAF+++TI++   + +    +  EIW
Sbjct: 5   IKVVLLGDSSVGKTSIVTRLKSGKFLAKHAATIGAAFITKTIEVPSNDSSTEKRIHMEIW 64

Query: 61  DTAGQERYKSLAPMYYRNANGALVVYDVTQPDSLVKAQNWVDELKSKVGDEDLVICLVGN 120
           DTAGQERYKSL PMYYR+AN AL+V+++    SL  A+ W  +L+ +     ++I  VGN
Sbjct: 65  DTAGQERYKSLVPMYYRDANIALIVFELGDVSSLQCAKTWFQDLQDRAQGTQVII--VGN 122

Query: 121 KLDL-CEEEGQERGVDKDDAQSYASDKGLLFHEVSAKTG 158
           K DL CEE   E  +        A  +GL +  VSAKTG
Sbjct: 123 KYDLVCEEHSGEVTIP-------AELQGLPYVAVSAKTG 154

>Kwal_23.5058
          Length = 213

 Score =  120 bits (302), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 75/203 (36%), Positives = 109/203 (53%), Gaps = 10/203 (4%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLKDYNDTVVKFEIWDTA 63
            K++L+GDS VGKS ++ RFV+D F     +TIG  F    IK  D N   VK ++WDTA
Sbjct: 21  MKILLVGDSGVGKSCLLVRFVEDKFSPSFITTIGIDF---KIKTVDINGKKVKLQLWDTA 77

Query: 64  GQERYKSLAPMYYRNANGALVVYDVTQPDSLVKAQNWVDELKSKVGDEDLVICLVGNKLD 123
           GQER++++   YYR A G ++VYDVT   +    + W   +     DE  ++ LVGNK D
Sbjct: 78  GQERFRTITTAYYRGAMGIILVYDVTDERTFANVKQWFSTVNQHANDEAQLL-LVGNKSD 136

Query: 124 LCEEEGQERGVDKDDAQSYASDKGLLFHEVSAKTGKGVSNIFQEIGEKLYLQKKDSLEAA 183
           +       R V  D  +S A + G+ F E SAK    V++IF ++  KL  +K DS +  
Sbjct: 137 M-----DTRAVSTDQGESLAKELGIPFVEASAKDDTNVNDIFFQLA-KLIQEKIDSEKLV 190

Query: 184 SQTRHVVNVELQRPTTNDATSCC 206
             T    +V +     N  ++CC
Sbjct: 191 GNTGRDGSVNVGAGGNNAKSNCC 213

>KLLA0D05313g 459496..460110 gi|10129780|emb|CAC08198.1
           Kluyveromyces lactis putative GTP-binding protein, start
           by similarity
          Length = 204

 Score =  119 bits (298), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 76/207 (36%), Positives = 119/207 (57%), Gaps = 15/207 (7%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLKDYNDTVVKFEIWDTA 63
           FKL+L+GDS VGKS ++ RF  D++     STIG  F  +T++L   +   VK +IWDTA
Sbjct: 9   FKLLLIGDSGVGKSCLLLRFADDTYTNDYISTIGVDFKIKTVEL---DGKTVKLQIWDTA 65

Query: 64  GQERYKSLAPMYYRNANGALVVYDVTQPDSLVKAQNWVDELKSKVGDEDLVICLVGNKLD 123
           GQER++++   YYR A+G ++VYDVT  +S    + W+ E+  + G   ++  LVGNK D
Sbjct: 66  GQERFRTITSSYYRGAHGIIIVYDVTDQESFNNVKTWLQEI-DRFGTAGVLKLLVGNKND 124

Query: 124 LCEEEGQERGVDKDDAQSYASDKGLLFHEVSAKTGKGVSNIF----QEIGEKLYLQKKDS 179
           L +    ++ VD + A+ +A   G+ F E SA     V   F    ++I E +  Q+KD+
Sbjct: 125 LTD----KKVVDTEVAKEFADSIGIPFIETSALDSSNVEEAFLIMTKQIKESVAKQQKDN 180

Query: 180 LEAASQTRHVVNVELQRPTTNDATSCC 206
             A  ++   VN++ Q  T ++   CC
Sbjct: 181 GRAEDKSN--VNLKGQSLTGSNG-GCC 204

>Scas_713.5
          Length = 211

 Score =  113 bits (282), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 75/211 (35%), Positives = 115/211 (54%), Gaps = 16/211 (7%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLKDYNDTVVKFEIWDTA 63
           FKL+L+G+S VGKS ++ RF  D++     STIG  F  +T++L   +   VK +IWDTA
Sbjct: 9   FKLLLIGNSGVGKSCLLLRFSDDTYTNDYISTIGVDFKIKTVEL---DGKTVKLQIWDTA 65

Query: 64  GQERYKSLAPMYYRNANGALVVYDVTQPDSLVKAQNWVDELKSKVGDEDLVICLVGNKLD 123
           GQER++++   YYR ++G ++VYDVT  DS    + W+ E+  +     ++  LVGNK D
Sbjct: 66  GQERFRTITSSYYRGSHGIIIVYDVTDQDSFNGVKMWLQEI-DRYATSTVLKLLVGNKCD 124

Query: 124 LCEEEGQERGVDKDDAQSYASDKGLLFHEVSAKTGKGVSNIF----QEIGEKLYLQKKDS 179
           L +    +R V+ D A+ +A    + F E SA     V   F    ++I E +  QK + 
Sbjct: 125 LTD----KRVVEYDVAKEFADANKMPFLETSALNSTNVEEAFLTMARQIKESMSQQKMED 180

Query: 180 LEAASQTRHV---VNVELQ-RPTTNDATSCC 206
             A    ++     NV L  +  TN  +SCC
Sbjct: 181 GGANGGNKNPDGGNNVNLAGQSLTNGGSSCC 211

>Kwal_14.1116
          Length = 204

 Score =  112 bits (281), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 73/208 (35%), Positives = 116/208 (55%), Gaps = 17/208 (8%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLKDYNDTVVKFEIWDTA 63
           FKL+L+GDS VGKS ++ RF  D++     STIG  F  +T++L   +   VK +IWDTA
Sbjct: 9   FKLLLIGDSGVGKSCLLLRFSDDTYTNDYISTIGVDFKIKTVEL---DGKTVKLQIWDTA 65

Query: 64  GQERYKSLAPMYYRNANGALVVYDVTQPDSLVKAQNWVDELKSKVGDEDLVICLVGNKLD 123
           GQER++++   YYR A+G ++VYDVT  DS    + W+ E+  +     ++  +VGNK D
Sbjct: 66  GQERFRTITSSYYRGAHGIIIVYDVTDHDSFNDVKMWLQEI-DRYATAGVLKLMVGNKSD 124

Query: 124 LCEEEGQERGVDKDDAQSYASDKGLLFHEVSAKTGKGVSNIF----QEIGEKLYLQKKDS 179
           L +    +R V+ D A+ +A    + F E SA     V   F    ++I E +  Q +D+
Sbjct: 125 LQD----KRMVEYDVAKEFADSLQIPFLETSALDSSNVEEAFLTMAKQIKESMAQQHRDT 180

Query: 180 LEAASQTRHVVNVELQ-RPTTNDATSCC 206
            +   +     NV L+ +  +N ++ CC
Sbjct: 181 GKKDDK----ANVNLKGQSLSNSSSGCC 204

>AGL021W [4290] [Homologous to ScYFL005W (SEC4) - SH]
           complement(681760..682398) [639 bp, 212 aa]
          Length = 212

 Score =  112 bits (281), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 70/203 (34%), Positives = 111/203 (54%), Gaps = 10/203 (4%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLKDYNDTVVKFEIWDTA 63
            K++L+GDS VGKS ++ RFV+D F     +TIG  F    IK  D N   +K ++WDTA
Sbjct: 20  MKILLVGDSGVGKSCLLVRFVEDKFSPSFITTIGIDF---KIKAVDINGKKIKLQLWDTA 76

Query: 64  GQERYKSLAPMYYRNANGALVVYDVTQPDSLVKAQNWVDELKSKVGDEDLVICLVGNKLD 123
           GQER++++   YYR A G ++VYDVT   +    + W   +     +E+  + LVGNK D
Sbjct: 77  GQERFRTITTAYYRGAMGIILVYDVTDERTFENIRQWFTTVNQH-ANEEAQLLLVGNKKD 135

Query: 124 LCEEEGQERGVDKDDAQSYASDKGLLFHEVSAKTGKGVSNIFQEIGEKLYLQKKDSLEAA 183
           +       R V  +  +S A + G+ F E SAK  + VS+IF  +  KL  +K D+ +  
Sbjct: 136 M-----DTRAVTYEQGESLAKELGVPFIEASAKDDENVSDIFFTLA-KLIQEKIDNDKLV 189

Query: 184 SQTRHVVNVELQRPTTNDATSCC 206
           + +    +V +   +   +++CC
Sbjct: 190 NNSGREGSVNISSGSNMPSSNCC 212

>KLLA0E12111g 1075299..1075943 highly similar to sp|P07560
           Saccharomyces cerevisiae YFL005w SEC4 GTP-binding
           protein of the ras superfamily, start by similarity
          Length = 214

 Score =  112 bits (281), Expect = 6e-31,   Method: Compositional matrix adjust.
 Identities = 73/204 (35%), Positives = 109/204 (53%), Gaps = 11/204 (5%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLKDYNDTVVKFEIWDTA 63
            K++LLGDS VGKS ++ RFV+D F     +TIG  F    IK  D N   VK ++WDTA
Sbjct: 21  MKILLLGDSGVGKSCLLVRFVEDKFTPTFITTIGIDF---KIKTVDINGKRVKLQLWDTA 77

Query: 64  GQERYKSLAPMYYRNANGALVVYDVTQPDSLVKAQNWVDELKSKVGDEDLVICLVGNKLD 123
           GQER++++   YYR A G +++YDVT   +    + W   +      ED+V+ LVGNK D
Sbjct: 78  GQERFRTITTAYYRGAMGIVLIYDVTDERTFENIRQWFSTVNQH-ASEDVVMLLVGNKKD 136

Query: 124 LCEEEGQERGVDKDDAQSYASDKGLLFHEVSAKTGKGVSNIFQEIGEKLYLQKKDSLEAA 183
           +       R V  +  ++ A + G+ F E SAK    VS IF  +  KL  +K D  +  
Sbjct: 137 M-----DTRTVSYEQGEALAKELGIPFIEASAKDDTNVSEIFFTLA-KLIQEKIDDGKME 190

Query: 184 SQTRHVVNVELQ-RPTTNDATSCC 206
            +     NV ++   ++   ++CC
Sbjct: 191 GKAEKEGNVSIRGSGSSGSKSNCC 214

>Scas_707.26
          Length = 210

 Score =  112 bits (280), Expect = 7e-31,   Method: Compositional matrix adjust.
 Identities = 74/204 (36%), Positives = 107/204 (52%), Gaps = 11/204 (5%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLKDYNDTVVKFEIWDTA 63
            K++L+GDS VGKS ++ RFV+D F+    +TIG  F    IK  D N   VK ++WDTA
Sbjct: 17  MKILLIGDSGVGKSCLLVRFVEDKFNPSFITTIGIDF---KIKTVDINGKKVKLQLWDTA 73

Query: 64  GQERYKSLAPMYYRNANGALVVYDVTQPDSLVKAQNWVDELKSKVGDEDLVICLVGNKLD 123
           GQER++++   YYR A G ++VYDVT   +    + W   +     DE  ++ LVGNK D
Sbjct: 74  GQERFRTITTAYYRGAMGIILVYDVTDERTFSNVKQWFKTVNEHANDEAQLL-LVGNKSD 132

Query: 124 LCEEEGQERGVDKDDAQSYASDKGLLFHEVSAKTGKGVSNIFQEIGEKLYLQKKDSLE-A 182
           +       R V  +  +S A + GL F E SAK    V+ IF  +  KL  +K DS + A
Sbjct: 133 M-----DTRVVTYEQGESLAKELGLPFIESSAKNDDNVNEIFFTLA-KLIQEKIDSNKLA 186

Query: 183 ASQTRHVVNVELQRPTTNDATSCC 206
                   N+ +        ++CC
Sbjct: 187 GPGNGKDANISINAKDGGSKSNCC 210

>CAGL0K12672g 1255541..1256161 highly similar to sp|P01123
           Saccharomyces cerevisiae YFL038c YPT1, start by
           similarity
          Length = 206

 Score =  112 bits (280), Expect = 7e-31,   Method: Compositional matrix adjust.
 Identities = 71/207 (34%), Positives = 113/207 (54%), Gaps = 13/207 (6%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLKDYNDTVVKFEIWDTA 63
           FKL+L+G+S VGKS ++ RF  D++     STIG  F  +T++L   +   VK +IWDTA
Sbjct: 9   FKLLLIGNSGVGKSCLLLRFSDDTYTNDYISTIGVDFKIKTVEL---DGKTVKLQIWDTA 65

Query: 64  GQERYKSLAPMYYRNANGALVVYDVTQPDSLVKAQNWVDELKSKVGDEDLVICLVGNKLD 123
           GQER++++   YYR ++G ++VYDVT  +S    + W+ E+  +     ++  LVGNK D
Sbjct: 66  GQERFRTITSSYYRGSHGIIIVYDVTDQESFNGVKMWLQEI-DRYATSTVLKLLVGNKCD 124

Query: 124 LCEEEGQERGVDKDDAQSYASDKGLLFHEVSAKTGKGVSNIF----QEIGEKLYLQKKDS 179
           L +    +R V+ D A+ +A    + F E SA     V   F    ++I E +  Q  + 
Sbjct: 125 LAD----KRVVEYDVAKEFAEANKMPFLETSALDSTNVEEAFLTMARQIKESMTQQNMNE 180

Query: 180 LEAASQTRHVVNVELQRPTTNDATSCC 206
            +     +  VN++ Q   T   +SCC
Sbjct: 181 SQQKKNDKGNVNLKGQ-SLTQSGSSCC 206

>Sklu_1815.2 YFL005W, Contig c1815 3148-3789 reverse complement
          Length = 213

 Score =  112 bits (280), Expect = 8e-31,   Method: Compositional matrix adjust.
 Identities = 70/203 (34%), Positives = 107/203 (52%), Gaps = 10/203 (4%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLKDYNDTVVKFEIWDTA 63
            K++L+GDS VGKS ++ RFV+D F     +TIG  F    IK  D N   +K ++WDTA
Sbjct: 21  MKILLVGDSGVGKSCLLVRFVEDKFSPSFITTIGIDF---KIKTVDINGKKIKLQLWDTA 77

Query: 64  GQERYKSLAPMYYRNANGALVVYDVTQPDSLVKAQNWVDELKSKVGDEDLVICLVGNKLD 123
           GQER++++   YYR A G ++VYDVT   +    + W+  +     DE  ++ LVGNK D
Sbjct: 78  GQERFRTITTAYYRGAMGIILVYDVTDERTFSNIKQWLSTVNQHANDEAQLL-LVGNKSD 136

Query: 124 LCEEEGQERGVDKDDAQSYASDKGLLFHEVSAKTGKGVSNIFQEIGEKLYLQKKDSLEAA 183
           +       R V  +  ++ + + GL F E SAK    V+ IF  +  KL  +K D+ +  
Sbjct: 137 M-----DTRAVTYEQGEALSKELGLPFVEASAKNDDNVNEIFFTLA-KLIQEKIDNDKLV 190

Query: 184 SQTRHVVNVELQRPTTNDATSCC 206
             T    +V +        ++CC
Sbjct: 191 GNTNKDGSVNINSNGGGSKSNCC 213

>YFL005W (SEC4) [1676] chr6 (130329..130976) GTP-binding protein
           involved in vesicular transport between Golgi and plasma
           membrane, member of the rab family in the ras
           superfamily [648 bp, 215 aa]
          Length = 215

 Score =  112 bits (280), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 69/176 (39%), Positives = 99/176 (56%), Gaps = 10/176 (5%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLKDYNDTVVKFEIWDTA 63
            K++L+GDS VGKS ++ RFV+D F+    +TIG  F    IK  D N   VK ++WDTA
Sbjct: 21  MKILLIGDSGVGKSCLLVRFVEDKFNPSFITTIGIDF---KIKTVDINGKKVKLQLWDTA 77

Query: 64  GQERYKSLAPMYYRNANGALVVYDVTQPDSLVKAQNWVDELKSKVGDEDLVICLVGNKLD 123
           GQER++++   YYR A G ++VYDVT   +    + W   +     DE  ++ LVGNK D
Sbjct: 78  GQERFRTITTAYYRGAMGIILVYDVTDERTFTNIKQWFKTVNEHANDEAQLL-LVGNKSD 136

Query: 124 LCEEEGQERGVDKDDAQSYASDKGLLFHEVSAKTGKGVSNIFQEIGEKLYLQKKDS 179
           +     + R V  D  ++ A + G+ F E SAK    V+ IF  +  KL  +K DS
Sbjct: 137 M-----ETRVVTADQGEALAKELGIPFIESSAKNDDNVNEIFFTLA-KLIQEKIDS 186

>Scas_656.2
          Length = 218

 Score =  112 bits (279), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 71/203 (34%), Positives = 108/203 (53%), Gaps = 11/203 (5%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLKDYNDTVVKFEIWDTA 63
            K++L+GDS VGKS ++ RFV++ F+    +TIG  F    IK  D     +K ++WDTA
Sbjct: 27  MKILLIGDSGVGKSCLLVRFVENKFNPSFITTIGIDF---KIKTLDIQGRKIKLQLWDTA 83

Query: 64  GQERYKSLAPMYYRNANGALVVYDVTQPDSLVKAQNWVDELKSKVGDEDLVICLVGNKLD 123
           GQER++++   YYR A G ++VYDVT   +    + W   +     +E + + LVGNK D
Sbjct: 84  GQERFRTITTAYYRGAMGIILVYDVTDERTFQNIRQWYSTVNEH-ANEQVQLLLVGNKSD 142

Query: 124 LCEEEGQERGVDKDDAQSYASDKGLLFHEVSAKTGKGVSNIFQEIGEKLYLQKKDSLEAA 183
           L       R V K+  +  A + GL F E SAK    V+++F ++  KL  +K D+ E  
Sbjct: 143 LG-----NRQVTKEQGEELARELGLPFMEASAKNDDNVNDLFLQLA-KLIQEKIDNDEMG 196

Query: 184 SQTRHVVNVELQRPTTNDATSCC 206
                  NV + +      +SCC
Sbjct: 197 EPRTAKKNVNI-KSKDGKTSSCC 218

>CAGL0E02607g complement(248761..249387) highly similar to sp|P32939
           Saccharomyces cerevisiae YML001w YPT7 GTP-binding
           protein of the RAB family, start by similarity
          Length = 208

 Score =  111 bits (278), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 69/207 (33%), Positives = 114/207 (55%), Gaps = 12/207 (5%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLKDYNDTVVKFEIWDTA 63
            K+++LGDS VGK+S++HR+V D + +  ++TIGA FL++ + L D  D VV  ++WDTA
Sbjct: 9   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDD--DKVVTMQVWDTA 66

Query: 64  GQERYKSLAPMYYRNANGALVVYDVTQPDSLVKAQNWVDEL---KSKVGDEDLVICLVGN 120
           GQER++SL   +YR A+  ++VYDVT   S    ++W DE     +    E     ++GN
Sbjct: 67  GQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPESFPFVILGN 126

Query: 121 KLDLCEEEGQERGVDKDDAQSYASDKG-LLFHEVSAKTGKGVSNIFQEIGEKLYLQKKDS 179
           K+D+   E  ++ V +   Q  A   G +     SAK+   V   F+EI +    Q ++ 
Sbjct: 127 KVDI---EDSKKVVSEKAGQELAKSLGDVPLFLTSAKSAINVDTAFEEIAKSALQQNQND 183

Query: 180 LEA-ASQTRHVVNVELQRPTTNDATSC 205
             A        +N++L+  +  ++ SC
Sbjct: 184 AHAFEDDFNDAINIQLEGES--NSCSC 208

>Scas_674.5
          Length = 208

 Score =  111 bits (277), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 71/207 (34%), Positives = 111/207 (53%), Gaps = 12/207 (5%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLKDYNDTVVKFEIWDTA 63
            K+++LGDS VGK+S++HR+V D + +  ++TIGA FL++ + + D  D V   ++WDTA
Sbjct: 9   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTIDD--DKVATMQVWDTA 66

Query: 64  GQERYKSLAPMYYRNANGALVVYDVTQPDSLVKAQNWVDEL---KSKVGDEDLVICLVGN 120
           GQER++SL   +YR A+  ++VYDVT   S    ++W DE     +    E     ++GN
Sbjct: 67  GQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFPFVILGN 126

Query: 121 KLDLCEEEGQERGVDKDDAQSYASDKG--LLFHEVSAKTGKGVSNIFQEIGEKLYLQKKD 178
           K+D+ E    ++ V  + AQ  A   G   LF   SAK    + N F+EI     LQ+  
Sbjct: 127 KVDIDE---TKKVVSANAAQELAKSLGNTPLFM-TSAKDSINIDNAFEEIARSA-LQQNQ 181

Query: 179 SLEAASQTRHVVNVELQRPTTNDATSC 205
           S   A        + +Q     ++ SC
Sbjct: 182 SDADAFDDDFNDAINIQLDDEPNSCSC 208

>ABR220W [814] [Homologous to ScYFL038C (YPT1) - SH]
           complement(817290..817904) [615 bp, 204 aa]
          Length = 204

 Score =  110 bits (275), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 74/207 (35%), Positives = 113/207 (54%), Gaps = 15/207 (7%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLKDYNDTVVKFEIWDTA 63
           FKL+L+GDS VGKS ++ RF  D++     STIG  F  +T++L   +   VK +IWDTA
Sbjct: 9   FKLLLIGDSGVGKSCLLLRFADDTYTNDYISTIGVDFKIKTVEL---DGKTVKLQIWDTA 65

Query: 64  GQERYKSLAPMYYRNANGALVVYDVTQPDSLVKAQNWVDELKSKVGDEDLVICLVGNKLD 123
           GQER++++   YYR A+G ++VYDVT  +S    + W+ E+  + G   +V  LVGNK D
Sbjct: 66  GQERFRTITSSYYRGAHGIIIVYDVTDQESFDNMKTWLQEI-DRYGTAGVVKLLVGNKND 124

Query: 124 LCEEEGQERGVDKDDAQSYASDKGLLFHEVSAKTGKGVSNIF----QEIGEKLYLQKKDS 179
           L +    ++ VD + A+ +A    +   E SA     V   F    ++I E +  Q+K+S
Sbjct: 125 LKD----KKVVDFEVAREFADSLNIPVLETSALDSSNVEEAFLTMARQIKETMSHQQKES 180

Query: 180 LEAASQTRHVVNVELQRPTTNDATSCC 206
                  +  VN++ Q    N    CC
Sbjct: 181 --GKKDDKSGVNLKGQ-SLANSGGGCC 204

>Sklu_2144.3 YFL038C, Contig c2144 4079-4693
          Length = 204

 Score =  110 bits (275), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 73/207 (35%), Positives = 113/207 (54%), Gaps = 15/207 (7%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLKDYNDTVVKFEIWDTA 63
           FKL+L+GDS VGKS ++ RF  D++     STIG  F    IK  D +   VK +IWDTA
Sbjct: 9   FKLLLIGDSGVGKSCLLLRFADDTYTNDYISTIGVDF---KIKTVDLDGKTVKLQIWDTA 65

Query: 64  GQERYKSLAPMYYRNANGALVVYDVTQPDSLVKAQNWVDELKSKVGDEDLVICLVGNKLD 123
           GQER++++   YYR A+G ++VYDVT  +S    + W+ E+  + G   ++  LVGNK D
Sbjct: 66  GQERFRTITSSYYRGAHGIIIVYDVTDQESFNNVKTWLQEI-DRYGTAGVLKLLVGNKND 124

Query: 124 LCEEEGQERGVDKDDAQSYASDKGLLFHEVSAKTGKGVSNIF----QEIGEKLYLQKKDS 179
           L +++  E  V    A+ +A    +   E SA     V   F    ++I E +  Q++D+
Sbjct: 125 LTDKKVVEYEV----AKEFADSLQIPVLETSALDSSNVEEAFLTMARQIKESMSQQQRDN 180

Query: 180 LEAASQTRHVVNVELQRPTTNDATSCC 206
                + +  VN++ Q   T  ++ CC
Sbjct: 181 --GKKEEKAGVNLKGQ-SLTGTSSGCC 204

>YFL038C (YPT1) [1645] chr6 complement(55365..55985) GTP-binding
           protein required for vesicle transport from ER to Golgi
           and within the Golgi stack, member of the rab family in
           the ras superfamily of GTP-binding proteins [621 bp, 206
           aa]
          Length = 206

 Score =  110 bits (274), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 71/207 (34%), Positives = 113/207 (54%), Gaps = 13/207 (6%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLKDYNDTVVKFEIWDTA 63
           FKL+L+G+S VGKS ++ RF  D++     STIG  F  +T++L   +   VK +IWDTA
Sbjct: 9   FKLLLIGNSGVGKSCLLLRFSDDTYTNDYISTIGVDFKIKTVEL---DGKTVKLQIWDTA 65

Query: 64  GQERYKSLAPMYYRNANGALVVYDVTQPDSLVKAQNWVDELKSKVGDEDLVICLVGNKLD 123
           GQER++++   YYR ++G ++VYDVT  +S    + W+ E+  +     ++  LVGNK D
Sbjct: 66  GQERFRTITSSYYRGSHGIIIVYDVTDQESFNGVKMWLQEI-DRYATSTVLKLLVGNKCD 124

Query: 124 LCEEEGQERGVDKDDAQSYASDKGLLFHEVSAKTGKGVSNIF----QEIGEKLYLQKKDS 179
           L +    +R V+ D A+ +A    + F E SA     V + F    ++I E +  Q  + 
Sbjct: 125 LKD----KRVVEYDVAKEFADANKMPFLETSALDSTNVEDAFLTMARQIKESMSQQNLNE 180

Query: 180 LEAASQTRHVVNVELQRPTTNDATSCC 206
                + +  VN++ Q   TN    CC
Sbjct: 181 TTQKKEDKGNVNLKGQ-SLTNTGGGCC 206

>Kwal_56.22440
          Length = 208

 Score =  108 bits (271), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 65/183 (35%), Positives = 99/183 (54%), Gaps = 9/183 (4%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLKDYNDTVVKFEIWDTA 63
            K+++LGDS VGK+S++HR+V D F +  ++TIGA FL++ + +    D V   ++WDTA
Sbjct: 9   LKVIILGDSGVGKTSLMHRYVSDKFSQQYKATIGADFLTKEVSMD--GDKVATMQVWDTA 66

Query: 64  GQERYKSLAPMYYRNANGALVVYDVTQPDSLVKAQNWVDEL---KSKVGDEDLVICLVGN 120
           GQER++SL   +YR A+  ++VYDVT   S    ++W DE     +    E     ++GN
Sbjct: 67  GQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFPFVILGN 126

Query: 121 KLDLCEEEGQERGVDKDDAQSYASDKG-LLFHEVSAKTGKGVSNIFQEIGEKLYLQKKDS 179
           KLD+   E  ++ V    AQ  A   G +     SAK    V   F+EI      Q +  
Sbjct: 127 KLDV---EESKKVVSNRSAQDMAKSLGNIPLFLTSAKGSINVDTAFEEIARNALQQSQAD 183

Query: 180 LEA 182
            +A
Sbjct: 184 ADA 186

>YML001W (YPT7) [3965] chr13 (267174..267800) GTP-binding protein
           with a role in protein transport between endosome-like
           compartments, member of the rab family in the ras
           superfamily [627 bp, 208 aa]
          Length = 208

 Score =  108 bits (270), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 69/207 (33%), Positives = 108/207 (52%), Gaps = 12/207 (5%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLKDYNDTVVKFEIWDTA 63
            K+++LGDS VGK+S++HR+V D + +  ++TIGA FL++ + +    D V   ++WDTA
Sbjct: 9   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVD--GDKVATMQVWDTA 66

Query: 64  GQERYKSLAPMYYRNANGALVVYDVTQPDSLVKAQNWVDELKSKVG---DEDLVICLVGN 120
           GQER++SL   +YR A+  ++VYDVT   S    ++W DE          E     ++GN
Sbjct: 67  GQERFQSLGVAFYRGADCCVLVYDVTNASSFENIKSWRDEFLVHANVNSPETFPFVILGN 126

Query: 121 KLDLCEEEGQERGVDKDDAQSYASDKG-LLFHEVSAKTGKGVSNIFQEIGEKLYLQKKDS 179
           K+D    E  ++ V +  AQ  A   G +     SAK    V   F+EI      Q +  
Sbjct: 127 KID---AEESKKIVSEKSAQELAKSLGDIPLFLTSAKNAINVDTAFEEIARSALQQNQAD 183

Query: 180 LEAASQTRH-VVNVELQRPTTNDATSC 205
            EA     +  +N+ L     N++ SC
Sbjct: 184 TEAFEDDYNDAINIRLDGE--NNSCSC 208

>CAGL0F02123g 212117..212764 highly similar to sp|P07560
           Saccharomyces cerevisiae YFL005w SEC4, start by
           similarity
          Length = 215

 Score =  108 bits (270), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 68/176 (38%), Positives = 98/176 (55%), Gaps = 10/176 (5%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLKDYNDTVVKFEIWDTA 63
            K++L+GDS VGKS ++ RFV+D F+    +TIG  F    IK  D N   VK ++WDTA
Sbjct: 21  MKILLIGDSGVGKSCLLVRFVEDKFNPSFITTIGIDF---KIKTVDINGKKVKLQLWDTA 77

Query: 64  GQERYKSLAPMYYRNANGALVVYDVTQPDSLVKAQNWVDELKSKVGDEDLVICLVGNKLD 123
           GQER++++   YYR A G ++VYDVT   +    + W   +     DE  ++ LVGNK D
Sbjct: 78  GQERFRTITTAYYRGAMGIILVYDVTDERTFANIKQWFKTVNEHANDEAQLL-LVGNKSD 136

Query: 124 LCEEEGQERGVDKDDAQSYASDKGLLFHEVSAKTGKGVSNIFQEIGEKLYLQKKDS 179
           +       R V  +  ++ A + GL F E SAK    V+ IF  +  +L  +K DS
Sbjct: 137 M-----DTRVVTYEQGEALAKELGLPFIESSAKNDDNVNEIFFTLA-RLIQEKIDS 186

>ACR003C [1051] [Homologous to ScYML001W (YPT7) - SH]
           (359762..360388) [627 bp, 208 aa]
          Length = 208

 Score =  108 bits (269), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 62/178 (34%), Positives = 99/178 (55%), Gaps = 9/178 (5%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLKDYNDTVVKFEIWDTA 63
            K+++LGDS VGK+S++HR+V D + +  ++TIGA FL++ + +    D V   ++WDTA
Sbjct: 9   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVD--GDKVATMQVWDTA 66

Query: 64  GQERYKSLAPMYYRNANGALVVYDVTQPDSLVKAQNWVDEL---KSKVGDEDLVICLVGN 120
           GQER++SL   +YR A+  ++VYDVT   S    ++W DE     +    E     ++GN
Sbjct: 67  GQERFQSLGVAFYRGADCCVLVYDVTNAKSFENVKSWRDEFLVHANVPSPESFPFVILGN 126

Query: 121 KLDLCEEEGQERGVDKDDAQSYASDKG-LLFHEVSAKTGKGVSNIFQEIGEKLYLQKK 177
           K+D+   E  ++ V    +Q  A   G + F   SAK    V + F+EI      Q +
Sbjct: 127 KIDV---EESKKVVTTRTSQELAKSLGNIPFFLTSAKNAINVDDAFEEIARSALQQSQ 181

>Sklu_2373.3 YML001W, Contig c2373 10977-11603
          Length = 208

 Score =  107 bits (266), Expect = 9e-29,   Method: Compositional matrix adjust.
 Identities = 63/183 (34%), Positives = 101/183 (55%), Gaps = 9/183 (4%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLKDYNDTVVKFEIWDTA 63
            K+++LGDS VGK+S++HR+V D + +  ++TIGA FL++ + + +  D V   ++WDTA
Sbjct: 9   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDE--DKVATMQVWDTA 66

Query: 64  GQERYKSLAPMYYRNANGALVVYDVTQPDSLVKAQNWVDEL---KSKVGDEDLVICLVGN 120
           GQER++SL   +YR A+  ++VYDVT   S    ++W DE     +    E     ++GN
Sbjct: 67  GQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPESFPFVILGN 126

Query: 121 KLDLCEEEGQERGVDKDDAQSYASDKG-LLFHEVSAKTGKGVSNIFQEIGEKLYLQKKDS 179
           K+D+   E  ++ V+   AQ  A   G +     SAK    V   F+EI      Q +  
Sbjct: 127 KIDV---EESKKVVNTRSAQELAKSLGNVPLFLTSAKGSINVETAFEEIARSALQQSQAD 183

Query: 180 LEA 182
            +A
Sbjct: 184 ADA 186

>Kwal_47.19055
          Length = 179

 Score =  105 bits (262), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 55/141 (39%), Positives = 86/141 (60%), Gaps = 8/141 (5%)

Query: 33  ESTIGAAFLSQTIKLKDYNDTVVKFEIWDTAGQERYKSLAPMYYRNANGALVVYDVTQPD 92
           +STIG  F ++TI+++      +K +IWDTAGQERY+++   YYR A GAL+VYD+++  
Sbjct: 4   KSTIGVEFATRTIEVEGKK---IKAQIWDTAGQERYRAITSAYYRGAVGALIVYDISKSS 60

Query: 93  SLVKAQNWVDELKSKVGDEDLVICLVGNKLDLCEEEGQERGVDKDDAQSYASDKGLLFHE 152
           S     +W+ EL+    DE++ + L+GNK DL       R V  D+A+++A +  LLF E
Sbjct: 61  SYENCNHWLTELREN-ADENVAVGLIGNKSDL----AHLRAVPTDEAKNFAQENQLLFTE 115

Query: 153 VSAKTGKGVSNIFQEIGEKLY 173
            SA   + V   F+E+   +Y
Sbjct: 116 TSALNSENVDQAFRELISAIY 136

>KLLA0D01265g 110784..111407 highly similar to sp|P32939
           Saccharomyces cerevisiae YML001w YPT7 GTP-binding
           protein of the RAB family, start by similarity
          Length = 207

 Score =  105 bits (263), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 67/198 (33%), Positives = 106/198 (53%), Gaps = 14/198 (7%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLKDYNDTVVKFEIWDTA 63
            K+++LGDS VGK+S++HR+V D + +  ++TIGA FL++ + + D  D V   ++WDTA
Sbjct: 8   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIVND--DKVATMQVWDTA 65

Query: 64  GQERYKSLAPMYYRNANGALVVYDVTQPDSLVKAQNWVDEL---KSKVGDEDLVICLVGN 120
           GQER++SL   +YR A+  ++VYDVT   S    ++W DE     +    E     ++ N
Sbjct: 66  GQERFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKSWRDEFLVHANVSSPETFPFVILAN 125

Query: 121 KLDLCEEEGQERGVDKDDAQSYASDKG---LLFHEVSAKTGKGVSNIFQEIGEKLYLQKK 177
           K+D+   E  ++ V    AQ  A   G   L F   SAK    V + F+EI      Q +
Sbjct: 126 KVDV---EESKKVVSSRSAQEQAKSLGNVPLFF--TSAKDSINVQDAFEEIARSALQQSQ 180

Query: 178 DSLEA-ASQTRHVVNVEL 194
              +A        +N++L
Sbjct: 181 SDADAYEDDLSEAINIQL 198

>Sklu_1136.1 YGL210W, Contig c1136 1284-1832
          Length = 182

 Score =  105 bits (261), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 55/141 (39%), Positives = 87/141 (61%), Gaps = 8/141 (5%)

Query: 33  ESTIGAAFLSQTIKLKDYNDTVVKFEIWDTAGQERYKSLAPMYYRNANGALVVYDVTQPD 92
           +STIG  F ++TI+++      +K +IWDTAGQERY+++   YYR A GAL+VYD+++ +
Sbjct: 4   KSTIGVEFATRTIEVEGKK---IKAQIWDTAGQERYRAITSAYYRGAVGALIVYDISKSN 60

Query: 93  SLVKAQNWVDELKSKVGDEDLVICLVGNKLDLCEEEGQERGVDKDDAQSYASDKGLLFHE 152
           S     +W+ EL+    DE++ + L+GNK DL       R V  D+A+++A +  LLF E
Sbjct: 61  SYENCNHWLTELREN-ADENVAVGLIGNKSDL----AHLRAVPTDEAKNFAQENQLLFTE 115

Query: 153 VSAKTGKGVSNIFQEIGEKLY 173
            SA   + V   F+E+   +Y
Sbjct: 116 TSALNSENVDLAFRELITAIY 136

>Kwal_33.14015
          Length = 271

 Score = 87.8 bits (216), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 54/165 (32%), Positives = 89/165 (53%), Gaps = 7/165 (4%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLKDYNDTVVKFEIWDT 62
             K+V++GD +VGK+ ++  + +  F E     I   F +   K+K  ++TVV+  +WDT
Sbjct: 65  HLKIVVVGDGAVGKTCLLISYTQGHFPE---EYIPTVFENYVTKMKGPDNTVVELALWDT 121

Query: 63  AGQERYKSLAPMYYRNANGALVVYDVTQPDSLVKAQN-WVDELKSKVGDEDLVICLVGNK 121
           AGQE Y  L P+ Y + +  +V Y V    SL+  Q  W+ E++    D    I LVG K
Sbjct: 122 AGQEEYNRLRPLSYTDVDLLMVCYSVDSKTSLLNVQELWIPEVRHFCPDTP--ILLVGLK 179

Query: 122 LDLCEEEGQERGVDKDDAQSYASDKGLLFH-EVSAKTGKGVSNIF 165
            DL   +  ++ VD  +A  +A++  LL H + S+K+ + V  +F
Sbjct: 180 SDLYALDNLDKLVDPGEADLFATEHNLLGHYQCSSKSRQNVEELF 224

>YOR185C (GSP2) [4981] chr15 complement(681444..682106) Ran, a
           GTP-binding protein member of the ras superfamily
           involved in trafficking through nuclear pores [663 bp,
           220 aa]
          Length = 220

 Score = 85.9 bits (211), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 55/170 (32%), Positives = 90/170 (52%), Gaps = 13/170 (7%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLKDY-NDTVVKFEIWDT 62
           FKLVL+GD   GK++ V R +   F++   +TIG     +   L  Y N   +KF++WDT
Sbjct: 14  FKLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGV----EVHPLSFYTNFGEIKFDVWDT 69

Query: 63  AGQERYKSLAPMYYRNANGALVVYDVTQPDSLVKAQNWVDELKSKVGDEDLVICLVGNKL 122
           AGQE++  L   YY NA  A++++DVT   +     NW  +L      E++ I L GNK+
Sbjct: 70  AGQEKFGGLRDGYYINAQCAIIMFDVTSRITYKNVPNWHRDLVRVC--ENIPIVLCGNKV 127

Query: 123 DLCEEEGQERGVDKDDAQSYASDKGLLFHEVSAKTGKGVSNIFQEIGEKL 172
           D+ E + + + +      ++   K L ++++SAK+       F  +  KL
Sbjct: 128 DVKERKVKAKTI------TFHRKKNLQYYDISAKSNYNFEKPFLWLARKL 171

>YLR293C (GSP1) [3684] chr12 complement(720773..721432) Ran, a
           GTP-binding protein of the ras superfamily involved in
           trafficking through nuclear pores [660 bp, 219 aa]
          Length = 219

 Score = 85.5 bits (210), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 55/170 (32%), Positives = 90/170 (52%), Gaps = 13/170 (7%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLKDY-NDTVVKFEIWDT 62
           FKLVL+GD   GK++ V R +   F++   +TIG     +   L  Y N   +KF++WDT
Sbjct: 13  FKLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGV----EVHPLSFYTNFGEIKFDVWDT 68

Query: 63  AGQERYKSLAPMYYRNANGALVVYDVTQPDSLVKAQNWVDELKSKVGDEDLVICLVGNKL 122
           AGQE++  L   YY NA  A++++DVT   +     NW  +L      E++ I L GNK+
Sbjct: 69  AGQEKFGGLRDGYYINAQCAIIMFDVTSRITYKNVPNWHRDLVRVC--ENIPIVLCGNKV 126

Query: 123 DLCEEEGQERGVDKDDAQSYASDKGLLFHEVSAKTGKGVSNIFQEIGEKL 172
           D+ E + + + +      ++   K L ++++SAK+       F  +  KL
Sbjct: 127 DVKERKVKAKTI------TFHRKKNLQYYDISAKSNYNFEKPFLWLARKL 170

>Scas_610.4
          Length = 211

 Score = 85.1 bits (209), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 59/176 (33%), Positives = 91/176 (51%), Gaps = 18/176 (10%)

Query: 2   LQFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLKDYNDTVVKFEIWD 61
           ++ KLV++GD + GK+ ++  F K  F E    T+   +++      + +   V+  +WD
Sbjct: 9   IRRKLVIVGDGACGKTCLLIVFSKGQFPEVYVPTVFENYVADV----EVDGRRVELALWD 64

Query: 62  TAGQERYKSLAPMYYRNANGALVVYDVTQPDSLVKAQ-NWVDELKSKVGDEDLVICLVGN 120
           TAGQE Y  L P+ Y ++N  L+ + +  PDSL   Q  W+ E+      + + I LVG 
Sbjct: 65  TAGQEDYDRLRPLSYPDSNVVLICFSIDLPDSLENVQEKWIAEVLHFC--QGVPIILVGC 122

Query: 121 KLDL---------CEEEGQERGVDKDDAQSYASDKGLL-FHEVSAKTGKGVSNIFQ 166
           K+DL           EEGQ+  V   D QS A   G   ++E SAKTG GV  +F+
Sbjct: 123 KVDLRNDPQTIEALREEGQQP-VSSADGQSVADQIGATGYYECSAKTGFGVREVFE 177

>Kwal_56.23361
          Length = 214

 Score = 84.3 bits (207), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 54/170 (31%), Positives = 89/170 (52%), Gaps = 13/170 (7%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLKDYND-TVVKFEIWDT 62
           FKLVL+GD   GK++ V R +   F++   +TIG     +   L  Y D   +KF++WDT
Sbjct: 8   FKLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGV----EVHPLAFYTDFGELKFDVWDT 63

Query: 63  AGQERYKSLAPMYYRNANGALVVYDVTQPDSLVKAQNWVDELKSKVGDEDLVICLVGNKL 122
           AGQE++  L   YY NA   ++++DVT   +     NW  +L      E++ I L GNK+
Sbjct: 64  AGQEKFGGLRDGYYINAQCGIIMFDVTSRITYKNVPNWHRDLVRVC--ENIPIVLCGNKV 121

Query: 123 DLCEEEGQERGVDKDDAQSYASDKGLLFHEVSAKTGKGVSNIFQEIGEKL 172
           D+ E + + + +      ++   K L ++++SAK+       F  +  KL
Sbjct: 122 DVKERKVKAKTI------TFHRKKNLQYYDISAKSNYNFEKPFLWLARKL 165

>AGR294C [4605] [Homologous to ScYOR185C (GSP2) - SH; ScYLR293C
           (GSP1) - SH] (1287042..1287686) [645 bp, 214 aa]
          Length = 214

 Score = 84.0 bits (206), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 54/170 (31%), Positives = 89/170 (52%), Gaps = 13/170 (7%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLKDY-NDTVVKFEIWDT 62
           FKLVL+GD   GK++ V R +   F++   +TIG     +   L  Y N   +KF++WDT
Sbjct: 8   FKLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGV----EVHPLAFYTNFGEIKFDVWDT 63

Query: 63  AGQERYKSLAPMYYRNANGALVVYDVTQPDSLVKAQNWVDELKSKVGDEDLVICLVGNKL 122
           AGQE++  L   YY NA   ++++DVT   +     NW  +L      E++ I L GNK+
Sbjct: 64  AGQEKFGGLRDGYYINAQCGIIMFDVTSRITYKNVPNWHRDLVRVC--ENIPIVLCGNKV 121

Query: 123 DLCEEEGQERGVDKDDAQSYASDKGLLFHEVSAKTGKGVSNIFQEIGEKL 172
           D+ E + + + +      ++   K L ++++SAK+       F  +  KL
Sbjct: 122 DVKERKVKAKTI------TFHRKKNLQYYDISAKSNYNFEKPFLWLARKL 165

>Sklu_2285.4 YLR293C, Contig c2285 4349-4993 reverse complement
          Length = 214

 Score = 84.0 bits (206), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 54/170 (31%), Positives = 89/170 (52%), Gaps = 13/170 (7%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLKDY-NDTVVKFEIWDT 62
           FKLVL+GD   GK++ V R +   F++   +TIG     +   L  Y N   +KF++WDT
Sbjct: 8   FKLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGV----EVHPLAFYTNFGEIKFDVWDT 63

Query: 63  AGQERYKSLAPMYYRNANGALVVYDVTQPDSLVKAQNWVDELKSKVGDEDLVICLVGNKL 122
           AGQE++  L   YY NA   ++++DVT   +     NW  +L      E++ I L GNK+
Sbjct: 64  AGQEKFGGLRDGYYINAQCGIIMFDVTSRITYKNVPNWHRDLVRVC--ENIPIVLCGNKV 121

Query: 123 DLCEEEGQERGVDKDDAQSYASDKGLLFHEVSAKTGKGVSNIFQEIGEKL 172
           D+ E + + + +      ++   K L ++++SAK+       F  +  KL
Sbjct: 122 DVKERKVKAKTI------TFHRKKNLQYYDISAKSNYNFEKPFLWLARKL 165

>KLLA0C05126g complement(463657..464301) highly similar to sp|P32836
           Saccharomyces cerevisiae YOR185c GSP2 GTP-binding
           protein of the RAS superfamily, start by similarity
          Length = 214

 Score = 83.6 bits (205), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 54/170 (31%), Positives = 89/170 (52%), Gaps = 13/170 (7%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLKDY-NDTVVKFEIWDT 62
           FKLVL+GD   GK++ V R +   F++   +TIG     +   L  Y N   +KF++WDT
Sbjct: 8   FKLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGV----EVHPLAFYTNFGEIKFDVWDT 63

Query: 63  AGQERYKSLAPMYYRNANGALVVYDVTQPDSLVKAQNWVDELKSKVGDEDLVICLVGNKL 122
           AGQE++  L   YY NA   ++++DVT   +     NW  +L      E++ I L GNK+
Sbjct: 64  AGQEKFGGLRDGYYINAQCGIIMFDVTSRITYKNVPNWHRDLVRVC--ENIPIVLCGNKV 121

Query: 123 DLCEEEGQERGVDKDDAQSYASDKGLLFHEVSAKTGKGVSNIFQEIGEKL 172
           D+ E + + + +      ++   K L ++++SAK+       F  +  KL
Sbjct: 122 DVKERKVKAKTI------TFHRKKNLQYYDISAKSNYNFEKPFLWLARKL 165

>KLLA0A04499g complement(404732..405376) highly similar to sp|P32836
           Saccharomyces cerevisiae YOR185c GSP2 GTP-binding
           protein of the RAS superfamily, start by similarity
          Length = 214

 Score = 83.6 bits (205), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 54/170 (31%), Positives = 89/170 (52%), Gaps = 13/170 (7%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLKDY-NDTVVKFEIWDT 62
           FKLVL+GD   GK++ V R +   F++   +TIG     +   L  Y N   +KF++WDT
Sbjct: 8   FKLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGV----EVHPLAFYTNFGEIKFDVWDT 63

Query: 63  AGQERYKSLAPMYYRNANGALVVYDVTQPDSLVKAQNWVDELKSKVGDEDLVICLVGNKL 122
           AGQE++  L   YY NA   ++++DVT   +     NW  +L      E++ I L GNK+
Sbjct: 64  AGQEKFGGLRDGYYINAQCGIIMFDVTSRITYKNVPNWHRDLVRVC--ENIPIVLCGNKV 121

Query: 123 DLCEEEGQERGVDKDDAQSYASDKGLLFHEVSAKTGKGVSNIFQEIGEKL 172
           D+ E + + + +      ++   K L ++++SAK+       F  +  KL
Sbjct: 122 DVKERKVKAKTI------TFHRKKNLQYYDISAKSNYNFEKPFLWLARKL 165

>Scas_586.6
          Length = 219

 Score = 83.6 bits (205), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 52/169 (30%), Positives = 88/169 (52%), Gaps = 11/169 (6%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLKDYNDTVVKFEIWDTA 63
           FKLVL+GD   GK++ V R +   F++   +TIG      +    +Y +  +KF+ WDTA
Sbjct: 13  FKLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGVEVHPLSF-FTNYGE--IKFDCWDTA 69

Query: 64  GQERYKSLAPMYYRNANGALVVYDVTQPDSLVKAQNWVDELKSKVGDEDLVICLVGNKLD 123
           GQE++  L   YY NA   ++++DVT   +     NW  +L      E++ I L GNK+D
Sbjct: 70  GQEKFGGLRDGYYINAQCGIIMFDVTSRITYKNVPNWHRDLVRVC--ENIPIVLCGNKVD 127

Query: 124 LCEEEGQERGVDKDDAQSYASDKGLLFHEVSAKTGKGVSNIFQEIGEKL 172
           + E + + + +      ++   K L ++++SAK+       F  +  KL
Sbjct: 128 VKERKVKAKTI------TFHRKKNLQYYDISAKSNYNFEKPFLWLARKL 170

>CAGL0I00594g 44835..45479 highly similar to sp|P32835 Saccharomyces
           cerevisiae YLR293c GSP1, start by similarity
          Length = 214

 Score = 83.6 bits (205), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 52/169 (30%), Positives = 86/169 (50%), Gaps = 11/169 (6%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLKDYNDTVVKFEIWDTA 63
           FKLVL+GD   GK++ V R +   F++   +TIG             N   +KF++WDTA
Sbjct: 8   FKLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGVEVHPLAFHT---NFGEIKFDVWDTA 64

Query: 64  GQERYKSLAPMYYRNANGALVVYDVTQPDSLVKAQNWVDELKSKVGDEDLVICLVGNKLD 123
           GQE++  L   YY NA   ++++DVT   +     NW  +L      E++ I L GNK+D
Sbjct: 65  GQEKFGGLRDGYYINAQCGIIMFDVTSRITYKNVPNWHRDLVRVC--ENIPIVLCGNKVD 122

Query: 124 LCEEEGQERGVDKDDAQSYASDKGLLFHEVSAKTGKGVSNIFQEIGEKL 172
           + E + + + +      ++   K L ++++SAK+       F  +  KL
Sbjct: 123 VKERKVKAKTI------TFHRKKNLQYYDISAKSNYNFEKPFLWLARKL 165

>ABR182W [775] [Homologous to ScYPR165W (RHO1) - SH]
           complement(754517..755146) [630 bp, 209 aa]
          Length = 209

 Score = 83.2 bits (204), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 58/172 (33%), Positives = 88/172 (51%), Gaps = 18/172 (10%)

Query: 5   KLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLKDYNDTVVKFEIWDTAG 64
           KLV++GD + GK+ ++  F K  F E    T+   +++      D +   V+  +WDTAG
Sbjct: 12  KLVIVGDGACGKTCLLVVFSKGQFPEIHVPTVFENYVADV----DIDGRRVELALWDTAG 67

Query: 65  QERYKSLAPMYYRNANGALVVYDVTQPDSLVKAQ-NWVDELKSKVGDEDLVICLVGNKLD 123
           QE Y  L P+ Y ++N  L+ + V  PDSL   Q  WV E+      + + I LVG K+D
Sbjct: 68  QEDYDRLRPLSYPDSNVVLICFSVDLPDSLDNVQEKWVSEVLHFC--QGVPILLVGCKVD 125

Query: 124 L---------CEEEGQERGVDKDDAQSYASDKG-LLFHEVSAKTGKGVSNIF 165
           L          + EGQ R V   +  + A   G + + E SA+TG+GV  +F
Sbjct: 126 LRNDPQVLQQLQAEGQ-RPVTAAEGSAVAGKIGAVAYLECSARTGQGVKEVF 176

>YKR055W (RHO4) [3306] chr11 (547858..548733) GTP-binding protein,
           member of the rho family in the ras superfamily [876 bp,
           291 aa]
          Length = 291

 Score = 84.3 bits (207), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 60/199 (30%), Positives = 95/199 (47%), Gaps = 10/199 (5%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLKDYNDTVVKFEIWDT 62
             K+V++GD +VGK+ ++  +V+ +F      TI   F +    ++  N  +++  +WDT
Sbjct: 72  HLKIVVVGDGAVGKTCLLISYVQGTFPTDYIPTI---FENYVTNIEGPNGQIIELALWDT 128

Query: 63  AGQERYKSLAPMYYRNANGALVVYDVTQPDSLVKAQN-WVDELKSKVGDEDLVICLVGNK 121
           AGQE Y  L P+ Y NA+  +V Y V    SL   ++ W  E+K         I LVG K
Sbjct: 129 AGQEEYSRLRPLSYTNADVLMVCYSVGSKTSLKNVEDLWFPEVKHFCPSTP--IMLVGLK 186

Query: 122 LDLCEEEGQERGVDKDDAQSYASDKGLLFH-EVSAKTGKGVSNIFQEIGEKLYLQKKDSL 180
            DL E +     V+   A+S A   G   H + SA+  + +  +F+     L     DSL
Sbjct: 187 SDLYEADNLSDLVEPSSAESLAKRLGAFAHIQCSARLKENIDEVFETAIHTLL---SDSL 243

Query: 181 EAASQTRHVVNVELQRPTT 199
            A  +  H +    +R TT
Sbjct: 244 YAPREPTHTIKNPFKRNTT 262

>YPR165W (RHO1) [5580] chr16 (875362..875991) GTP-binding protein
           required to activate the PKC1 pathway and
           beta-1,3-glucan synthase and to coordinate exocyst
           assembly, member of the rho family of the ras
           superfamily [630 bp, 209 aa]
          Length = 209

 Score = 82.8 bits (203), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 57/176 (32%), Positives = 91/176 (51%), Gaps = 18/176 (10%)

Query: 2   LQFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLKDYNDTVVKFEIWD 61
           ++ KLV++GD + GK+ ++  F K  F E    T+   +++      + +   V+  +WD
Sbjct: 9   IRRKLVIVGDGACGKTCLLIVFSKGQFPEVYVPTVFENYVADV----EVDGRRVELALWD 64

Query: 62  TAGQERYKSLAPMYYRNANGALVVYDVTQPDSLVKAQ-NWVDELKSKVGDEDLVICLVGN 120
           TAGQE Y  L P+ Y ++N  L+ + +  PDSL   Q  W+ E+      + + I LVG 
Sbjct: 65  TAGQEDYDRLRPLSYPDSNVVLICFSIDLPDSLENVQEKWIAEVLHFC--QGVPIILVGC 122

Query: 121 KLDL---------CEEEGQERGVDKDDAQSYASDKGLL-FHEVSAKTGKGVSNIFQ 166
           K+DL           +EGQ+  V   + QS A   G   ++E SAKTG GV  +F+
Sbjct: 123 KVDLRNDPQTIEQLRQEGQQP-VTSQEGQSVADQIGATGYYECSAKTGYGVREVFE 177

>KLLA0C13816g 1183412..1183975 highly similar to sp|P06781
           Saccharomyces cerevisiae YNL090w RHO2 GTP-binding
           protein of the RHO subfamily of RAS-like proteins, start
           by similarity
          Length = 187

 Score = 81.3 bits (199), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 52/164 (31%), Positives = 88/164 (53%), Gaps = 8/164 (4%)

Query: 5   KLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLKDYNDTVVKFEIWDTAG 64
           KLV++GD + GK+S+++ F    F E    T+   +++        +   V+  +WDTAG
Sbjct: 9   KLVIIGDGACGKTSLLYVFTLGQFPEEYHPTVFENYVTDC----RVDGIKVQLTLWDTAG 64

Query: 65  QERYKSLAPMYYRNANGALVVYDVTQPDSLVKAQN-WVDELKSKVGDEDLVICLVGNKLD 123
           QE Y+ L P  Y  A+  L+ + +  P+SLV A+N W +E+     +  +V  LVG K D
Sbjct: 65  QEEYERLRPFSYSKADIILIGFAIDDPESLVNARNKWSEEVLRYCPEAPVV--LVGLKKD 122

Query: 124 LCEEEGQERGVDKDDAQSYASDKGL-LFHEVSAKTGKGVSNIFQ 166
           L   + + + V ++ A+  A   G   + E SA TG+ V ++F+
Sbjct: 123 LRSPDNEHQMVTREQAEQVARAIGAKKYMECSALTGENVDDVFE 166

>Kwal_55.21937
          Length = 208

 Score = 79.7 bits (195), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 57/173 (32%), Positives = 88/173 (50%), Gaps = 18/173 (10%)

Query: 5   KLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLKDYNDTVVKFEIWDTAG 64
           KLV++GD + GK+ ++  F K  F E    T+   +++        +   V+  +WDTAG
Sbjct: 12  KLVIVGDGACGKTCLLIVFSKGQFPEVYVPTVFENYVADV----QVDGRQVELALWDTAG 67

Query: 65  QERYKSLAPMYYRNANGALVVYDVTQPDSLVKAQ-NWVDELKSKVGDEDLVICLVGNKLD 123
           QE Y  L P+ Y ++N  L+ + +  PDSL   Q  W+ E+      + + I LVG K+D
Sbjct: 68  QEDYDRLRPLSYPDSNVVLICFSIDLPDSLDNVQEKWIAEVMHFC--QGVPIILVGCKVD 125

Query: 124 LCEEE---------GQERGVDKDDAQSYASDKGL-LFHEVSAKTGKGVSNIFQ 166
           L +           GQ+  V   +AQS A   G   ++E SAKTG GV  +F+
Sbjct: 126 LRDNPQTVEALRAIGQQP-VTGPEAQSVADKIGASAYYECSAKTGYGVREVFE 177

>Sklu_1816.1 YNL090W, Contig c1816 115-681
          Length = 188

 Score = 79.3 bits (194), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 55/169 (32%), Positives = 89/169 (52%), Gaps = 9/169 (5%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLKDYNDTVVKFEIW 60
           +++ KLV++GD + GK+S+++ F    F E    T+   +++        +   V+  +W
Sbjct: 5   VVRRKLVIIGDGACGKTSLLYVFTLGKFPEEYHPTVFENYVTDC----RVDGIKVQLALW 60

Query: 61  DTAGQERYKSLAPMYYRNANGALVVYDVTQPDSLVKAQN-WVDELKSKVGDEDLVICLVG 119
           DTAGQE Y+ L P  Y  AN  L+ + +  P+SL+ A+  W +E         +V  LVG
Sbjct: 61  DTAGQEEYERLRPFSYSKANIILIGFAIDDPESLMNARTKWTEEALRYCPTAPIV--LVG 118

Query: 120 NKLDLCEEEGQ-ERGVDKDDAQSYASDKGL-LFHEVSAKTGKGVSNIFQ 166
            K DL +  G  E  V ++ A+  A   G   + E SA TG+GV +IF+
Sbjct: 119 LKKDLRKSVGNGEEVVTREAAEQVARAIGAKRYMECSALTGEGVDDIFE 167

>Sklu_2151.4 , Contig c2151 3640-4263 reverse complement
          Length = 207

 Score = 79.7 bits (195), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 54/172 (31%), Positives = 89/172 (51%), Gaps = 16/172 (9%)

Query: 5   KLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLKDYNDTVVKFEIWDTAG 64
           KLV++GD + GK+ ++  F K  F E    T+   +++      + +   V+  +WDTAG
Sbjct: 12  KLVIVGDGACGKTCLLIVFSKGQFPEVYVPTVFENYVTDV----EVDGRHVELTLWDTAG 67

Query: 65  QERYKSLAPMYYRNANGALVVYDVTQPDSLVKAQ-NWVDELKSKVGDEDLVICLVGNKLD 123
           QE Y  L P  Y ++N  L+ + +  PDSL   Q  W++E+      + + I LVG K+D
Sbjct: 68  QEDYDRLRPFSYPDSNVVLICFSIDLPDSLDNVQEKWINEVLYFC--KGVPIILVGCKVD 125

Query: 124 LCEEEGQ--------ERGVDKDDAQSYASDKGLL-FHEVSAKTGKGVSNIFQ 166
           L ++           +R V   D Q+ A   G + ++E SAK+G GV  +F+
Sbjct: 126 LRDDTQTIETLKAIGQRPVSTTDGQTVADRIGAVGYYECSAKSGLGVREVFE 177

>Scas_691.36
          Length = 212

 Score = 79.7 bits (195), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 52/175 (29%), Positives = 89/175 (50%), Gaps = 16/175 (9%)

Query: 2   LQFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLKDYNDTVVKFEIWD 61
           ++ KLV++GD + GK+ ++  F K  F E    T+   +++      + +   V+  +WD
Sbjct: 9   IRRKLVIVGDGACGKTCLLIVFSKGQFPEVYVPTVFENYVADV----EVDGRRVELALWD 64

Query: 62  TAGQERYKSLAPMYYRNANGALVVYDVTQPDSLVKAQ-NWVDELKSKVGDEDLVICLVGN 120
           TAGQE Y  L P+ Y ++N  L+ + +  PDSL   Q  W+ E+      + + I LVG 
Sbjct: 65  TAGQEDYDRLRPLSYPDSNVVLICFSIDLPDSLENVQEKWIAEVLHFC--QGVPIILVGC 122

Query: 121 KLDLCEEEGQERGVDKDDAQSYASDKG---------LLFHEVSAKTGKGVSNIFQ 166
           K+DL  +      +  D+ Q  ++ +G           ++E SAKTG GV  +F+
Sbjct: 123 KVDLRNDPQAIEALRADEQQPVSTAEGQSVAEQIGATGYYECSAKTGLGVREVFE 177

>CAGL0I08459g 829292..829924 highly similar to sp|P06780
           Saccharomyces cerevisiae YPR165w RHO1, start by
           similarity
          Length = 210

 Score = 78.6 bits (192), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 56/176 (31%), Positives = 89/176 (50%), Gaps = 18/176 (10%)

Query: 2   LQFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLKDYNDTVVKFEIWD 61
           ++ KLV++GD + GK+ ++  F K  F E    T+   +++      + +   V+  +WD
Sbjct: 9   IRRKLVIVGDGACGKTCLLIVFSKGQFPEVYVPTVFENYVADV----EVDGRRVELALWD 64

Query: 62  TAGQERYKSLAPMYYRNANGALVVYDVTQPDSLVKAQ-NWVDELKSKVGDEDLVICLVGN 120
           TAGQE Y  L P+ Y ++N  L+ + +  PDSL   Q  W+ E+      + + I LVG 
Sbjct: 65  TAGQEDYDRLRPLSYPDSNVVLICFSIDLPDSLENVQEKWIAEVLHFC--QGVPIILVGC 122

Query: 121 KLDL---------CEEEGQERGVDKDDAQSYASDKGLL-FHEVSAKTGKGVSNIFQ 166
           K+DL            EG +  V   D Q+ A   G   ++E SAKTG GV  +F+
Sbjct: 123 KVDLRNDPQTLEQLRAEGLQP-VATADGQNVADQIGATGYYECSAKTGYGVREVFE 177

>ABR183W [776] [Homologous to ScYPR165W (RHO1) - SH]
           complement(755914..756537) [624 bp, 207 aa]
          Length = 207

 Score = 78.2 bits (191), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 55/176 (31%), Positives = 90/176 (51%), Gaps = 18/176 (10%)

Query: 2   LQFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLKDYNDTVVKFEIWD 61
           ++ KLV++GD + GK+ ++  F K  F +    T+   +++      + +   V+  +WD
Sbjct: 10  IRRKLVIVGDGACGKTCLLIVFAKGKFPQVYVPTVFDNYVADV----EVDGRRVELALWD 65

Query: 62  TAGQERYKSLAPMYYRNANGALVVYDVTQPDSLVKA-QNWVDELKSKVGDEDLVICLVGN 120
           TAGQE Y  L P+ Y ++N  L+ Y +  PDSL    + W+ E+      + + I LVG 
Sbjct: 66  TAGQEDYDRLRPLSYPDSNVVLICYSIDLPDSLENVMEKWISEVLYFC--QGVPIILVGC 123

Query: 121 KLDL---------CEEEGQERGVDKDDAQSYASDKGLL-FHEVSAKTGKGVSNIFQ 166
           K DL           ++GQ+  V +  AQ  A   G + + E SAKTG GV  +F+
Sbjct: 124 KADLRNDPQVIEQLRQQGQQP-VSQAQAQEVADQIGAVEYIECSAKTGFGVREVFE 178

>KLLA0B10626g 936497..937123 gi|22858698|gb|AAN05733.1 Kluyveromyces
           lactis RHO1, start by similarity
          Length = 208

 Score = 77.8 bits (190), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 56/175 (32%), Positives = 90/175 (51%), Gaps = 16/175 (9%)

Query: 2   LQFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLKDYNDTVVKFEIWD 61
           ++ KLV++GD + GK+ ++  F K  F +    T+   +++      + +   V+  +WD
Sbjct: 11  IRRKLVIVGDGACGKTCLLIVFAKGKFPQVYVPTVFDNYVADV----EVDGRRVELALWD 66

Query: 62  TAGQERYKSLAPMYYRNANGALVVYDVTQPDSLVKA-QNWVDELKSKVGDEDLVICLVGN 120
           TAGQE Y  L P+ Y ++N  L+ Y +  PDSL    + W+ E+      + + I LVG 
Sbjct: 67  TAGQEDYDRLRPLSYPDSNVVLICYSIDLPDSLENVMEKWISEVLHFC--QGVPIILVGC 124

Query: 121 KLDL-----CEEEGQERG---VDKDDAQSYASDKGLL-FHEVSAKTGKGVSNIFQ 166
           K DL       EE + +G   V +  AQ  A   G + + E SAKTG GV  +F+
Sbjct: 125 KADLRNDPQVVEELRAQGLQPVSQAQAQEVADQIGAVDYIECSAKTGYGVREVFE 179

>Sklu_2345.5 YCR027C, Contig c2345 9936-10595
          Length = 219

 Score = 77.8 bits (190), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 56/169 (33%), Positives = 86/169 (50%), Gaps = 5/169 (2%)

Query: 5   KLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLKDYNDTVVKFEIWDTAG 64
           K+ ++G  +VGKSSI  +FV+  F E    TI   F S+T+KL      +   EI DTAG
Sbjct: 27  KIAVVGARNVGKSSITVQFVESHFVESYYPTIENEF-SRTVKL---GKVMYTLEICDTAG 82

Query: 65  QERYKSLAPMYYRNANGALVVYDVTQPDSLVKAQNWVDELKSKVG-DEDLVICLVGNKLD 123
           Q+ +  +         G LVVY V    S        D++  ++G DE++ + + GNK+D
Sbjct: 83  QDEFSLVNNRSLMGVAGFLVVYSVVNRHSFELVGLIRDKILDQLGLDENVPVVVAGNKID 142

Query: 124 LCEEEGQERGVDKDDAQSYASDKGLLFHEVSAKTGKGVSNIFQEIGEKL 172
           LC + G  R V +++ Q  A   G  F E SAK    V ++   + +K+
Sbjct: 143 LCPDGGNNRQVTREEGQQLAKSLGAGFSECSAKLNWNVEDVMMLLLKKI 191

>Sklu_2151.3 YPR165W, Contig c2151 2495-3124 reverse complement
          Length = 209

 Score = 77.4 bits (189), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 55/176 (31%), Positives = 89/176 (50%), Gaps = 18/176 (10%)

Query: 2   LQFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLKDYNDTVVKFEIWD 61
           ++ KLV++GD + GK+ ++  F K  F +    T+   +++      + +   V+  +WD
Sbjct: 11  IRRKLVIVGDGACGKTCLLIVFAKGKFPQVYVPTVFDNYVADV----EVDGRRVELALWD 66

Query: 62  TAGQERYKSLAPMYYRNANGALVVYDVTQPDSLVKA-QNWVDELKSKVGDEDLVICLVGN 120
           TAGQE Y  L P+ Y ++N  L+ + +  PDSL    + W+ E+      + + I LVG 
Sbjct: 67  TAGQEDYDRLRPLSYPDSNVVLICFSIDLPDSLENVMEKWISEVLHFC--QGVPIILVGC 124

Query: 121 KLDL---------CEEEGQERGVDKDDAQSYASDKGLL-FHEVSAKTGKGVSNIFQ 166
           K+DL             GQE  V +  AQ  A   G + + E SAKTG GV  +F+
Sbjct: 125 KVDLRNDPQVVESLRTNGQEP-VSQASAQEVADQIGAVEYIECSAKTGFGVREVFE 179

>YNL090W (RHO2) [4501] chr14 (456565..457143) GTP-binding protein,
           member of the rho family in the ras superfamily [579 bp,
           192 aa]
          Length = 192

 Score = 77.0 bits (188), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 58/182 (31%), Positives = 89/182 (48%), Gaps = 13/182 (7%)

Query: 5   KLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLKDYNDTVVKFEIWDTAG 64
           KLV++GD + GK+S+++ F    F E    T+   +++        +   V   +WDTAG
Sbjct: 9   KLVIIGDGACGKTSLLYVFTLGKFPEQYHPTVFENYVTDC----RVDGIKVSLTLWDTAG 64

Query: 65  QERYKSLAPMYYRNANGALVVYDVTQPDSLVKAQN-WVDELKSKVGDEDLVICLVGNKLD 123
           QE Y+ L P  Y  A+  L+ + V   +SL+ A+  W DE      D  +V  LVG K D
Sbjct: 65  QEEYERLRPFSYSKADIILIGFAVDNFESLINARTKWADEALRYCPDAPIV--LVGLKKD 122

Query: 124 L-----CEEEGQERGVDKDDAQSYASDKGL-LFHEVSAKTGKGVSNIFQEIGEKLYLQKK 177
           L      +E   +  V  +DA+  A   G   + E SA TG+GV ++F+       L KK
Sbjct: 123 LRQEAHFKENATDEMVPIEDAKQVARAIGAKKYMECSALTGEGVDDVFEVATRTSLLMKK 182

Query: 178 DS 179
           + 
Sbjct: 183 EP 184

>ACR257C [1304] [Homologous to ScYKR055W (RHO4) - SH]
           (808667..809446) [780 bp, 259 aa]
          Length = 259

 Score = 77.8 bits (190), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 57/186 (30%), Positives = 90/186 (48%), Gaps = 12/186 (6%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLKDYNDTVVKFEIWDT 62
           + K+V++GD + GK+S++  + +  F E    TI   F +    ++     V++  +WDT
Sbjct: 52  RIKIVVVGDGATGKTSLLMSYTQGQFPEDYVPTI---FENYVTNIEGPRGKVIELALWDT 108

Query: 63  AGQERYKSLAPMYYRNANGALVVYDVTQPDSLVKAQN-WVDELKSKVGDEDLVICLVGNK 121
           AGQE Y  L P+ Y + +  +V Y      SL  A+  W  E++       ++  LVG K
Sbjct: 109 AGQEEYSRLRPLSYGDVDIVMVCYAADNRTSLTNAEELWFPEVRHFCPHAPMM--LVGLK 166

Query: 122 LDLCEEEGQERGVDKDDAQSYASDKGLLFH-EVSAKTGKGVSNIFQ-EIGEKLYLQKKDS 179
            DL   +  +R VD  DA+  A   G   H + SAKT + + ++F   I   LY    D 
Sbjct: 167 SDLYSLDALDRLVDPTDAELVARKMGAFVHLQCSAKTRQCLEDVFNTAIHTALY----DE 222

Query: 180 LEAASQ 185
           L A  Q
Sbjct: 223 LRAPPQ 228

>ACL087C [962] [Homologous to ScYNL090W (RHO2) - SH]
           (191573..192136) [564 bp, 187 aa]
          Length = 187

 Score = 75.9 bits (185), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 53/168 (31%), Positives = 83/168 (49%), Gaps = 8/168 (4%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLKDYNDTVVKFEIW 60
           +++ KLV++GD + GK+S++H F    F E    T+   +++        +   V+  +W
Sbjct: 5   VVRRKLVIIGDGACGKTSLLHVFTLGKFPEEYLPTVFENYVTDC----RVDGIKVQLALW 60

Query: 61  DTAGQERYKSLAPMYYRNANGALVVYDVTQPDSLVKA-QNWVDELKSKVGDEDLVICLVG 119
           DTAGQE Y+ L PM Y  A+  L+ + +  P SL  A + W  E      +  ++  LVG
Sbjct: 61  DTAGQEEYERLRPMSYSKADIILIGFAIDDPGSLSNAREKWTVEALRYCPNAPII--LVG 118

Query: 120 NKLDLCEEEGQERGVDKDDAQSYASDKGL-LFHEVSAKTGKGVSNIFQ 166
            K DL     Q   V    AQ      G   + E SA TG+GV ++F+
Sbjct: 119 LKKDLRRPGTQCAMVAPSQAQEVVRAIGAKKYMECSALTGEGVDDVFE 166

>CAGL0K08316g 838393..839364 some similarities with sp|Q00246
           Saccharomyces cerevisiae YKR055w RHO4 GTP-binding
           protein, hypothetical start
          Length = 323

 Score = 78.2 bits (191), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 51/165 (30%), Positives = 83/165 (50%), Gaps = 7/165 (4%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLKDYNDTVVKFEIWDT 62
             K+V++GD +VGK+S++  +V+  F   +   I   F +    ++     +++  +WDT
Sbjct: 83  HLKIVVVGDGAVGKTSLLISYVEKVF---KHENIPTIFENYVTNIQGPKGQIIELALWDT 139

Query: 63  AGQERYKSLAPMYYRNANGALVVYDVTQPDSLVKAQN-WVDELKSKVGDEDLVICLVGNK 121
           AGQE Y  L P+ Y  A+  ++ Y +    SL   ++ W  E++       ++  LVG K
Sbjct: 140 AGQEEYSRLRPLSYTGADVLMICYAIDSITSLKNVEDVWFPEVRHFCPGTPVM--LVGLK 197

Query: 122 LDLCEEEGQERGVDKDDAQSYASDKGLLFH-EVSAKTGKGVSNIF 165
            DL EEE  +  VD  +A S A   G   H + SAK    V N+F
Sbjct: 198 SDLYEEESCDSKVDPAEADSIAKKNGAFAHIQCSAKLRVKVDNVF 242

>Kwal_55.21941
          Length = 209

 Score = 75.9 bits (185), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 54/176 (30%), Positives = 88/176 (50%), Gaps = 18/176 (10%)

Query: 2   LQFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLKDYNDTVVKFEIWD 61
           ++ KLV++GD + GK+ ++  F K  F +    T+   +++      + +   V+  +WD
Sbjct: 11  IRRKLVIVGDGACGKTCLLIVFAKGKFPQVYVPTVFDNYVADV----EVDGRRVELALWD 66

Query: 62  TAGQERYKSLAPMYYRNANGALVVYDVTQPDSLVKA-QNWVDELKSKVGDEDLVICLVGN 120
           TAGQE Y  L P+ Y ++N  L+ + +  PDSL    + W+ E+      + + I LVG 
Sbjct: 67  TAGQEDYDRLRPLSYPDSNVVLICFSIDLPDSLENVMEKWISEVLHFC--QGVPIILVGC 124

Query: 121 KLDL---------CEEEGQERGVDKDDAQSYASDKGLL-FHEVSAKTGKGVSNIFQ 166
           K+DL             G E  V +  AQ  A   G + + E SAKTG GV  +F+
Sbjct: 125 KVDLRNDSQVIENLRANGHEP-VSQGAAQEVAEQIGAVEYIECSAKTGYGVREVFE 179

>Kwal_33.14452
          Length = 260

 Score = 76.6 bits (187), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 60/212 (28%), Positives = 100/212 (47%), Gaps = 30/212 (14%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLKDYNDT---VVKF 57
           M   K V++GD +VGK+S++  +  ++F +    T+   + + TI L D +     V + 
Sbjct: 1   MRSVKCVIVGDGAVGKTSLLISYTTNTFPQDYIPTVFDNY-TTTIALNDGDSAEPQVFRL 59

Query: 58  EIWDTAGQERYKSLAPMYYRNANGALVVYDVTQPDSLVKAQN-WVDELKSKVGDEDL--- 113
            +WDTAGQE Y  L P+ Y   +  L+ + + +P+S    ++ W  E++     E+L   
Sbjct: 60  NLWDTAGQEEYDRLRPLSYPQTDIFLLCFSINEPNSFENVKDKWFPEIRHNTNYENLELF 119

Query: 114 ------VICLVGNKLDLCEEEGQERG--------VDKDDAQSYASDKGLL-FHEVSAKTG 158
                  I LVG K DL ++E ++          V + D     S  GL+ + E SA T 
Sbjct: 120 RVCGKYPILLVGTKADLRDDEHEQDRLAEVNSDFVSRGDIDQCVSQCGLMGYVECSAATQ 179

Query: 159 KGVSNIFQEI-------GEKLYLQKKDSLEAA 183
            GV+++F+          E+L  Q K    AA
Sbjct: 180 VGVADVFERAVRCVVSEPERLLGQSKQRTNAA 211

>Scas_444.4*
          Length = 289

 Score = 76.6 bits (187), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 54/167 (32%), Positives = 84/167 (50%), Gaps = 8/167 (4%)

Query: 2   LQFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLKDYNDTVVKFEIWD 61
              K+V++GD  VGK+ ++  +V+    EF    I   F +     +  +  VV+  +WD
Sbjct: 62  FHVKIVIVGDEGVGKTCLLISYVQR---EFPTGDIPTVFENYVTDFEGPDGEVVELALWD 118

Query: 62  TAGQERYKSLAPMYYRNANGALVVYDVTQPDSLVK-AQNWVDELKSKVGDEDLVICLVGN 120
           TA QE Y  L P+ Y + +  LV Y V  P SL    ++W+ E+K       ++  LVG 
Sbjct: 119 TAAQEDYNRLRPLSYTDVDILLVCYSVANPTSLKNIKRSWIPEVKHFCYKTPVI--LVGL 176

Query: 121 KLDLCE-EEGQERGVDKDDAQSYASDKGLLFH-EVSAKTGKGVSNIF 165
           K DL +  E  +  VD  +A+  A   G L H + SAKT + V ++F
Sbjct: 177 KSDLYDSNENTDTLVDPKEAEQLAEKLGALAHLQCSAKTRQNVEDVF 223

>Sklu_1655.1 YKR055W, Contig c1655 395-1258 reverse complement
          Length = 287

 Score = 76.6 bits (187), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 52/165 (31%), Positives = 82/165 (49%), Gaps = 7/165 (4%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLKDYNDTVVKFEIWDT 62
             K+V++GD +VGK+ ++  + +  F      TI   ++S   K++   + V++  +WDT
Sbjct: 77  HLKIVVVGDGAVGKTCLLISYTQGRFPTEYVPTIFENYVS---KVQGPRNKVIELALWDT 133

Query: 63  AGQERYKSLAPMYYRNANGALVVYDVTQPDSLVKAQN-WVDELKSKVGDEDLVICLVGNK 121
           AGQE Y  L P+ Y + +  +V Y V    S    Q  W  E+K    D  ++  LVG K
Sbjct: 134 AGQEEYNRLRPLSYTDVDILMVCYSVDSKTSFYNVQELWFPEVKHFCPDAPVM--LVGLK 191

Query: 122 LDLCEEEGQERGVDKDDAQSYASDKGLLFH-EVSAKTGKGVSNIF 165
            DL   +  E+ VD  DA + A   G   H + SAK+   V  +F
Sbjct: 192 SDLYALDNLEQLVDPKDADTLAQQLGAFAHVQCSAKSRDNVDEVF 236

>Scas_547.3
          Length = 223

 Score = 75.5 bits (184), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 44/152 (28%), Positives = 84/152 (55%), Gaps = 8/152 (5%)

Query: 2   LQFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLKDYNDTVVKFEIWD 61
           +Q ++ L+GD+ VGK+S++ ++ ++ FDE    T+G   L + +++K  N   + F + D
Sbjct: 23  IQIQVGLVGDAQVGKTSLMVKYAQNGFDEEYTQTLGVNLLKRKVRIKSSN---IVFSLMD 79

Query: 62  TAGQERYKSLAPMYYRNANGALVVYDVTQPDSLVKAQNWVDELKSKVGDEDLVICLVGNK 121
             GQ+ + ++ P+   N++  + ++D+T+P+SL   +NW   +++   + D V  LVG K
Sbjct: 80  LGGQKEFINMLPIASVNSSVIIFLFDLTRPESLESIKNWY--MQAHGLNHDAVCILVGTK 137

Query: 122 LDL---CEEEGQERGVDKDDAQSYASDKGLLF 150
            DL      E QE+        + A D  L+F
Sbjct: 138 YDLFIDLPTEYQEQISRTSMKYAQAMDSPLIF 169

>Scas_578.7
          Length = 187

 Score = 74.3 bits (181), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 51/164 (31%), Positives = 85/164 (51%), Gaps = 8/164 (4%)

Query: 5   KLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLKDYNDTVVKFEIWDTAG 64
           KLV++GD + GK+S+++ F    F +    T+   +++        +   V   +WDTAG
Sbjct: 9   KLVIIGDGACGKTSLLYVFTLGKFPQEYHPTVFENYVTDC----RVDGIKVSLTLWDTAG 64

Query: 65  QERYKSLAPMYYRNANGALVVYDVTQPDSLVKAQN-WVDELKSKVGDEDLVICLVGNKLD 123
           QE Y+ L P  Y  A+  L+ + +   +SL  A+N W +E      +  ++  LVG K D
Sbjct: 65  QEEYERLRPFSYSKADIILIGFAINDTESLDNARNKWTEEALRYCPEAPII--LVGLKKD 122

Query: 124 LCEEEGQERGVDKDDAQSYASDKGL-LFHEVSAKTGKGVSNIFQ 166
           L +++     V  +DAQ  A   G   + E SA TG+GV ++F+
Sbjct: 123 LRQKQDGVEMVKPEDAQQVARIIGAKKYVECSALTGEGVDDVFE 166

>KLLA0D08327g 708240..709004 similar to sp|P53879 Saccharomyces
           cerevisiae YNL180c RHO5, start by similarity
          Length = 254

 Score = 75.5 bits (184), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 58/191 (30%), Positives = 90/191 (47%), Gaps = 25/191 (13%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLKD-YND----TVV 55
           M   K V++GD +VGK+S++  +  ++F +    T+   + S TI L D YN      + 
Sbjct: 1   MRSIKCVIVGDGAVGKTSLLISYTTNTFPQDYIPTVFDNY-STTIALPDPYNPDSEPQIF 59

Query: 56  KFEIWDTAGQERYKSLAPMYYRNANGALVVYDVTQPDSLVKAQN-WVDELKSKVGDED-- 112
           K  +WDTAGQE Y  L P+ Y   +  L+ + V +P+S     + W  E+K     E+  
Sbjct: 60  KLNLWDTAGQEEYDRLRPLSYPQTDIFLICFSVNEPNSFENVYDKWFPEIKHSTNFENLD 119

Query: 113 -------LVICLVGNKLDLCE--------EEGQERGVDKDDAQSYASDKGLL-FHEVSAK 156
                  L I LVG K DL +        +E     V +   Q   +  GL+ + E SA 
Sbjct: 120 LYHQSGKLPILLVGTKADLRDDDHERDRLQESNSDFVSQQQIQELVNKLGLMGYVECSAA 179

Query: 157 TGKGVSNIFQE 167
           T  GV  +F++
Sbjct: 180 TQVGVREVFEK 190

>Sklu_2007.2 YNL180C, Contig c2007 789-1574 reverse complement
          Length = 261

 Score = 75.1 bits (183), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 57/194 (29%), Positives = 89/194 (45%), Gaps = 25/194 (12%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLKDYNDT-----VV 55
           M   K V++GD +VGK+S++  +  ++F +    T+   + S TI L D +D      V 
Sbjct: 1   MRSIKCVIVGDGAVGKTSLLISYTTNTFPQDYIPTVFDNY-STTIALADPSDLSAEQEVF 59

Query: 56  KFEIWDTAGQERYKSLAPMYYRNANGALVVYDVTQPDSLVKA-QNWVDELKSKVGDEDL- 113
           K  +WDTAGQE Y  L P+ Y   +  ++ + V +P S       W  E++     E++ 
Sbjct: 60  KLNLWDTAGQEEYDRLRPLSYPQTDIFIICFSVNEPSSFENVIDKWFPEIRHNTNYENME 119

Query: 114 --------VICLVGNKLDLCEEEGQ--------ERGVDKDDAQSYASDKGLL-FHEVSAK 156
                    I LVG K DL E+E +           VD+ +     S  G + + E SA 
Sbjct: 120 LFSSCGKFPILLVGTKADLREDEHELDRLRELNSDFVDRHEIDHAVSKCGFMGYVECSAA 179

Query: 157 TGKGVSNIFQEIGE 170
           T  GV  +F+   E
Sbjct: 180 TQFGVREVFERAVE 193

>CAGL0J05632g complement(537342..537908) highly similar to sp|P06781
           Saccharomyces cerevisiae YNL090w RHO2, start by
           similarity
          Length = 188

 Score = 73.9 bits (180), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 53/170 (31%), Positives = 89/170 (52%), Gaps = 13/170 (7%)

Query: 2   LQFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLKDYNDTVVKFEIWD 61
           ++ KLV++GD + GK+S+++ F    F E    T+   +++        +   V   +WD
Sbjct: 6   IRRKLVIIGDGACGKTSLLYVFTLGKFPEQYHPTVFENYVTDC----RVDGIKVSLALWD 61

Query: 62  TAGQERYKSLAPMYYRNANGALVVYDVTQPDSLVKAQN-WVDELKSKVGDEDLVICLVGN 120
           TAGQE Y+ L P  Y  A+  L+ + V   +SL  A+  W +E      D  ++  LVG 
Sbjct: 62  TAGQEEYERLRPFSYSGADVILIAFSVDNVESLHNARTKWAEEAFRYCPDAPVI--LVGL 119

Query: 121 KLDLCEEEGQERG---VDKDDAQSYASDKGL-LFHEVSAKTGKGVSNIFQ 166
           K DL   + ++ G   V+++DA+  A   G   + E SA TG+GV ++F+
Sbjct: 120 KEDL--RKSKQEGIVFVNREDAEQVAKAIGAKKYLECSALTGEGVDDVFE 167

>KLLA0A05643g 528976..529632 similar to sp|Q00246 Saccharomyces
           cerevisiae YKR055w RHO4 GTP-binding protein of the rho
           family, hypothetical start
          Length = 218

 Score = 73.6 bits (179), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 50/165 (30%), Positives = 82/165 (49%), Gaps = 7/165 (4%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLKDYNDTVVKFEIWDT 62
             K+V++GD +VGK+S++  + +  F E    TI   F +    L+  N  +V+  +WDT
Sbjct: 31  HLKIVVVGDGAVGKTSLLISYTQGKFPEDYVPTI---FENYVTNLEGPNGKIVELALWDT 87

Query: 63  AGQERYKSLAPMYYRNANGALVVYDVTQPDSLVKAQN-WVDELKSKVGDEDLVICLVGNK 121
           AGQE Y  L P+ Y + +  ++ Y +    S    +  W+ E+K      D+ I +VG K
Sbjct: 88  AGQEEYSRLRPLSYTDVDVLMICYAINSKVSFYNIEEMWLPEVKHFC--PDVPIMIVGLK 145

Query: 122 LDLCEEEGQERGVDKDDAQSYASDKGLLFH-EVSAKTGKGVSNIF 165
            DL  E+     VD   A+  A   G   H + S+K+ + V  +F
Sbjct: 146 SDLYAEDNISDFVDAFKAEETAKRIGAFVHLQCSSKSQQKVREVF 190

>Sklu_1653.3 YML064C, Contig c1653 2277-3047
          Length = 256

 Score = 73.6 bits (179), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 50/175 (28%), Positives = 88/175 (50%), Gaps = 10/175 (5%)

Query: 2   LQFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLKDYNDTVVKFEIWD 61
           ++ K+ L+GD+ VGK+S++ ++V++ FDE    T+G  +L + I L     T V F I D
Sbjct: 58  VKVKIGLIGDAQVGKTSLMVKYVQNVFDEEYTQTLGVHYLERKIAL---GSTDVVFSIMD 114

Query: 62  TAGQERYKSLAPMYYRNANGALVVYDVTQPDSLVKAQNWVDELKSKVGDEDLVICLVGNK 121
             GQ  + ++ P+    A   + ++D+T+P++L   + W  + +    +E  +  LVG K
Sbjct: 115 LGGQREFINMLPLVSEGAVSIIFLFDLTRPETLSSIKEWYRQARG--FNETAIALLVGTK 172

Query: 122 LDL---CEEEGQERGVDKDDAQSYASDKGLLFHEVSAKTGKGVSNIFQEIGEKLY 173
            DL    + E QE+        + A D  L+F   S      +  IF+ I  K +
Sbjct: 173 YDLFITMDSEYQEQISRTSMKYAQAMDSPLVF--CSTSNSINIQKIFKVIIAKAF 225

>AER132W [2636] [Homologous to ScYML064C (TEM1) - SH]
           complement(888052..888750) [699 bp, 232 aa]
          Length = 232

 Score = 71.6 bits (174), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 38/123 (30%), Positives = 69/123 (56%), Gaps = 5/123 (4%)

Query: 2   LQFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLKDYNDTVVKFEIWD 61
           ++ K+ L+GD+ VGK+S++ ++V++ FDE    T+G  +L + I L     T V F I D
Sbjct: 14  VKIKIGLIGDAQVGKTSLMVKYVQNVFDEEYTQTLGVHYLERKINL---GSTDVIFSIMD 70

Query: 62  TAGQERYKSLAPMYYRNANGALVVYDVTQPDSLVKAQNWVDELKSKVGDEDLVICLVGNK 121
             GQ  + ++ P+    A   + ++D+T+P++L   + W  + +    +E  +  LVG K
Sbjct: 71  LGGQREFINMLPLVSNRAVAIIFLFDLTRPETLTSIREWYRQARG--FNETAIPLLVGTK 128

Query: 122 LDL 124
            DL
Sbjct: 129 YDL 131

>ABL139C [453] [Homologous to ScYNL180C (RHO5) - SH]
           (134875..135759) [885 bp, 294 aa]
          Length = 294

 Score = 72.0 bits (175), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 54/190 (28%), Positives = 94/190 (49%), Gaps = 25/190 (13%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLKDYNDT-----VV 55
           M   K V++GD +VGK+S++  +  +SF +    T+   + S TI ++D   +     + 
Sbjct: 17  MRSIKCVVIGDGAVGKTSLLISYTTNSFPQDYIPTVFDNY-STTIAVQDPASSTGEQQLF 75

Query: 56  KFEIWDTAGQERYKSLAPMYYRNANGALVVYDVTQPDSLVKAQN-WVDELKSKVGDEDL- 113
           K  +WDTAGQE Y  L P+ Y   +  L+ + + +P S    ++ W  E+K     E++ 
Sbjct: 76  KLNLWDTAGQEEYDRLRPLSYPQTDIFLICFSINEPVSFQNIRDKWFPEIKHNTNYENME 135

Query: 114 --------VICLVGNKLDLCEEEGQE---RGVDKD-----DAQSYASDKGLL-FHEVSAK 156
                    I LVG K DL +++ +E   R ++ D     + +    D G + + E SA 
Sbjct: 136 LFLECGKYPILLVGTKADLRDDDHEEDRLREMNTDFVSQAEIERVVQDCGFMGYVECSAA 195

Query: 157 TGKGVSNIFQ 166
           T +GV  +F+
Sbjct: 196 TQEGVREVFE 205

>Kwal_47.16983
          Length = 223

 Score = 70.9 bits (172), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 51/173 (29%), Positives = 86/173 (49%), Gaps = 10/173 (5%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLKDYNDTVVKFEIWDTA 63
            K+ L+GD+ VGK+S++ ++V++ FDE    T+G   LS+ I L       + F I D  
Sbjct: 19  LKIGLIGDAQVGKTSLMVKYVENVFDEEYTQTLGVNCLSKKITL---GSAEILFYIMDLG 75

Query: 64  GQERYKSLAPMYYRNANGALVVYDVTQPDSLVKAQNWVDELKSKVGDEDLVICLVGNKLD 123
           GQ  + ++ P+    A   + ++D+T+P++L   + W    ++   +E  V  LVG K D
Sbjct: 76  GQREFINMLPLASEGAKAIIFLFDLTRPETLKSIKEW--HRQATGFNEQAVPLLVGTKYD 133

Query: 124 L---CEEEGQERGVDKDDAQSYASDKGLLFHEVSAKTGKGVSNIFQEIGEKLY 173
           L    + E Q +   +    + A D  L+F   S      V  IF+ +  KLY
Sbjct: 134 LFVNLDPEYQAQISKQSMRYAQAMDAPLIFCSTSHSI--NVQKIFKIVIAKLY 184

>Scas_417.3
          Length = 291

 Score = 71.2 bits (173), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 57/200 (28%), Positives = 93/200 (46%), Gaps = 34/200 (17%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLKDY---------- 50
           M Q K V++GD +VGK+S++  +  ++F +    T+   + S TI L+D           
Sbjct: 1   MRQIKTVIVGDGAVGKTSLLISYTTNTFPQDYIPTVFDNY-STTISLRDPFLSRESLANE 59

Query: 51  --ND--TVVKFEIWDTAGQERYKSLAPMYYRNANGALVVYDVTQPDSLVK-AQNWVDELK 105
             ND   + K  +WDTAGQE Y  L P+ Y   +  L+ + V +  S       W+ E+K
Sbjct: 60  NENDHLELFKLNLWDTAGQEEYDRLRPLSYPQTDVFLICFSVAELSSFENVVDKWLPEIK 119

Query: 106 SKVGDED---------LVICLVGNKLDLCEEEGQERGVDKDDAQSYASDK--------GL 148
                E          L I L+G K DL ++E  ++ + + ++Q    D+        G 
Sbjct: 120 QNANVESSELFLQFGKLPIMLIGTKADLRDDEAVQKKLQETNSQFITRDQIDQVVDKYGF 179

Query: 149 L-FHEVSAKTGKGVSNIFQE 167
           L + E SA T  GV  +F++
Sbjct: 180 LGYVECSAATQMGVREVFEK 199

>KLLA0F03443g 324020..324691 highly similar to sp|Q9HF51 Ashbya
           gossypii Rho3, start by similarity
          Length = 223

 Score = 68.9 bits (167), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 54/189 (28%), Positives = 86/189 (45%), Gaps = 29/189 (15%)

Query: 2   LQFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLKDYNDTVVKFEIWD 61
           ++ K+V+LGD + GK+S+++ F +  F +  E TI   ++         ++  +   +WD
Sbjct: 13  IERKIVILGDGACGKTSLLNVFTRGYFPKVYEPTIFENYIHDIF----VDNQHISLSLWD 68

Query: 62  TAGQERYKSLAPMYYRNANGALVVYDVTQPDSLVKAQN-WVDELKSKVGDEDLVICLVGN 120
           TAGQE +  L  + Y + +  ++ + V   DSL   QN WV E+      E + + LV  
Sbjct: 69  TAGQEEFDRLRSLSYSDTHTIMLCFSVDSRDSLENVQNKWVGEIADHC--EGVKLVLVAL 126

Query: 121 KLDL--CEEEGQERGV----DKDDAQSYASDKGLL----------------FHEVSAKTG 158
           K DL   EE G E          +  S A D GL+                + E SAK  
Sbjct: 127 KCDLRNLEEFGNESAAITPGSIQNRNSNAKDNGLISYEEGLDMAKKIGALRYLECSAKMN 186

Query: 159 KGVSNIFQE 167
           +GV+  F E
Sbjct: 187 RGVNEAFTE 195

>CAGL0L11242g 1197075..1197839 highly similar to sp|P38987
           Saccharomyces cerevisiae YML064c TEM1 GTP-binding
           protein of the RAS superfamily, hypothetical start
          Length = 254

 Score = 69.3 bits (168), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 43/147 (29%), Positives = 79/147 (53%), Gaps = 10/147 (6%)

Query: 8   LLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLKDYNDTVVKFEIWDTAGQER 67
           L+GD+ VGK+S++ ++V++ FDE    T+G  FL + + ++    T + F + D  GQ  
Sbjct: 33  LIGDAQVGKTSLMVKYVQNIFDEEYTQTLGVNFLKRKVSIR---STDIVFSLMDLGGQRE 89

Query: 68  YKSLAPMYYRNANGALVVYDVTQPDSLVKAQNWVDELKSKVGDEDLVI-CLVGNKLDL-- 124
           + ++ P+    ++  ++++D+T+P++L   + W    +  +G  D  I  LVG K DL  
Sbjct: 90  FINMLPIATLGSSVIILLFDLTRPETLNSIKEW---YRQALGLNDSAIPILVGTKYDLFI 146

Query: 125 -CEEEGQERGVDKDDAQSYASDKGLLF 150
             EEE QE+        +   D  L+F
Sbjct: 147 DLEEEYQEKVSKTSMKYAQVMDAPLIF 173

>Scas_703.41
          Length = 225

 Score = 68.9 bits (167), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 38/119 (31%), Positives = 72/119 (60%), Gaps = 7/119 (5%)

Query: 8   LLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLKDYNDTVVKFEIWDTAGQER 67
           L+GD+ VGK+S++ ++V++ FDE    T+G  FL + +KL   + T + F + D  GQ+ 
Sbjct: 25  LVGDAQVGKTSLMVKYVQNIFDEEYTQTLGVNFLKRKVKL---HSTDIVFSLMDLGGQKE 81

Query: 68  YKSLAPMYYRNANGALVVYDVTQPDSLVKAQNWVDELKSKVGDEDLVI-CLVGNKLDLC 125
           + ++ P+    ++  + ++D+T+P++L   ++W  ++K   G  D+ I  LVG K DL 
Sbjct: 82  FINMLPIAAVGSSVIVFLFDLTRPETLNSIKDWYRQVK---GLNDIAIPILVGTKYDLL 137

>YIL118W (RHO3) [2558] chr9 (139749..140444) GTP-binding protein
           involved in control of actin cytoskeleton, exocytosis,
           and beta 1,6-glucan biosynthesis, member of the rho
           family in the ras superfamily [696 bp, 231 aa]
          Length = 231

 Score = 67.4 bits (163), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 51/197 (25%), Positives = 85/197 (43%), Gaps = 37/197 (18%)

Query: 2   LQFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLKDYNDTVVKFEIWD 61
           ++ K+V+LGD + GK+S+++ F +  F E  E T+   ++        +    +   +WD
Sbjct: 15  IERKIVILGDGACGKTSLLNVFTRGYFPEVYEPTVFENYIHDIFVDSKH----ITLSLWD 70

Query: 62  TAGQERYKSLAPMYYRNANGALVVYDVTQPDSLVKAQN-WVDELKSKVGDEDLVICLVGN 120
           TAGQE +  L  + Y +    ++ + +   DSL   QN WV E+      E + + LV  
Sbjct: 71  TAGQEEFDRLRSLSYSDTQCIMLCFSIDSRDSLENVQNKWVGEITDHC--EGVKLVLVAL 128

Query: 121 KLDLCEEEGQERGVDKDDAQ---SYASDKG---------------------------LLF 150
           K DL   E +   +  ++ Q   S ++D G                           L +
Sbjct: 129 KCDLRNNENESNAITPNNIQQDNSVSNDNGNNINSTSNGKNLISYEEGLAMAKKIGALRY 188

Query: 151 HEVSAKTGKGVSNIFQE 167
            E SAK  KGV+  F E
Sbjct: 189 LECSAKLNKGVNEAFTE 205

>Scas_575.10
          Length = 271

 Score = 67.8 bits (164), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 56/190 (29%), Positives = 104/190 (54%), Gaps = 12/190 (6%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLKDYNDTVVKFEIW 60
           M  +KLV+LG   VGKS +  +FV+  + +  + TI  ++  +TI++   ++ V   EI 
Sbjct: 1   MRDYKLVVLGAGGVGKSCLTVQFVQGIYLDTYDPTIEDSY-RKTIEI---DNKVFDLEIL 56

Query: 61  DTAGQERYKSLAPMYYRNANGALVVYDVTQPDSLVKAQNWVDELKSKVGDEDLV-ICLVG 119
           DTAG  ++ ++  +Y ++  G L+VY VT P SL +     +++  ++ D D V + LVG
Sbjct: 57  DTAGVAQFTAMRELYIKSGMGFLLVYSVTDPQSLDELMELREQV-LRIKDTDRVPMVLVG 115

Query: 120 NKLDLCEEEGQERGVDKDDAQSYASDKG-LLFHEVSAKTGKGVSNIFQEIGEKLYLQKKD 178
           NK DL E    +R +  ++    +S  G + F+E SA     V  +F ++  ++   + +
Sbjct: 116 NKADLTE----DRVISVEEGIEVSSKWGKVPFYETSALLRSNVDEVFVDLVRQIIRNEME 171

Query: 179 SLEAASQTRH 188
           ++ A S+ R+
Sbjct: 172 TV-AKSEARY 180

>KLLA0B05038g complement(457608..458279) similar to sp|P38987
           Saccharomyces cerevisiae YML064c TEM1 GTP-binding
           protein of the RAS superfamily, start by similarity
          Length = 223

 Score = 65.9 bits (159), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 39/124 (31%), Positives = 69/124 (55%), Gaps = 7/124 (5%)

Query: 2   LQFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLKDYNDTVVKFEIWD 61
           ++ K+ L+GD+ VGK+S++ ++V++ FDE    T+G  +L + + L     T V F I D
Sbjct: 15  VKVKVGLIGDAQVGKTSLMVKYVQNVFDEEYTQTLGVHYLERKVVL---GSTDVIFSIMD 71

Query: 62  TAGQERYKSLAPMYYRNANGALVVYDVTQPDSLVKAQNWVDELKSKVGDEDLVI-CLVGN 120
             GQ  + ++ P+    A   + ++D+T+P++L   + W  + +   G  D  I  LVG 
Sbjct: 72  LGGQREFINMLPLVSEGAVAIVFLFDLTRPETLNSIKEWYRQAR---GFNDTAISILVGT 128

Query: 121 KLDL 124
           K DL
Sbjct: 129 KYDL 132

>ADL252W [1489] [Homologous to ScYIL118W (RHO3) - SH]
           complement(258349..259023) [675 bp, 224 aa]
          Length = 224

 Score = 65.5 bits (158), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 49/189 (25%), Positives = 85/189 (44%), Gaps = 29/189 (15%)

Query: 2   LQFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLKDYNDTVVKFEIWD 61
           ++ K+V+LGD + GK+S+++ F +  F +  E T+   ++         ++  +   +WD
Sbjct: 14  IERKIVILGDGACGKTSLLNVFTRGYFPKVYEPTVFENYIHDIF----VDNQHITLSLWD 69

Query: 62  TAGQERYKSLAPMYYRNANGALVVYDVTQPDSLVKAQN-WVDELKSKVGDEDLVICLVGN 120
           TAGQE +  L  + Y + +  ++ + V   DSL   +N WV E+      E + + LV  
Sbjct: 70  TAGQEEFDRLRSLSYSDTHTIMLCFSVDSRDSLENVKNKWVSEIADHC--EGVKLVLVAL 127

Query: 121 KLDL--CEEEGQERGVDKDDAQSYASDKG--------------------LLFHEVSAKTG 158
           K DL   +E G E  +     Q+   + G                    L + E SAK  
Sbjct: 128 KCDLRSSDEYGNESAITPGSIQNQKYNGGGGNGLIPYDEGLAMAKQIGALRYLECSAKMN 187

Query: 159 KGVSNIFQE 167
           +GV+  F E
Sbjct: 188 RGVNEAFTE 196

>AFR464W [3656] [Homologous to ScYGR152C (RSR1) - SH]
           complement(1274158..1274952) [795 bp, 264 aa]
          Length = 264

 Score = 65.5 bits (158), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 50/182 (27%), Positives = 91/182 (50%), Gaps = 9/182 (4%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLKDYNDTVVKFEIW 60
           M  +KLV+LG   VGKS +  +FV+  + +  + TI  ++     K  + +D     EI 
Sbjct: 1   MRDYKLVVLGAGGVGKSCLTVQFVQGEYLDTYDPTIEDSYR----KSMEIDDKAFDLEIL 56

Query: 61  DTAGQERYKSLAPMYYRNANGALVVYDVTQPDSLVKAQNWVDELKSKVGDEDLVICLVGN 120
           DTAG  ++ ++  +Y ++  G L+VY VT   SL +     +++      + + + LVGN
Sbjct: 57  DTAGVAQFTAMRELYIKSGMGFLLVYSVTDRQSLAELMELREQILRIKDSKRVPMVLVGN 116

Query: 121 KLDLCEEEGQERGVDKDDAQSYASDKG-LLFHEVSAKTGKGVSNIFQEIGEKLYLQKKDS 179
           K DL      ER +  ++    +S  G + F+E SA     V  +F ++  ++   + ++
Sbjct: 117 KADL----QNERAISVEEGIDVSSRWGKVPFYETSALLKSNVDEVFIDLVRQIMRAELET 172

Query: 180 LE 181
           LE
Sbjct: 173 LE 174

>KLLA0C12001g complement(1029092..1029871) similar to sp|P13856
           Saccharomyces cerevisiae YGR152c RSR1 GTP-binding
           protein, start by similarity
          Length = 259

 Score = 65.1 bits (157), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 58/193 (30%), Positives = 100/193 (51%), Gaps = 20/193 (10%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLKDYNDTVVKFEIW 60
           M  +KLV+LG   VGKS +  +FV+  + +  + TI  ++     K  + ++ V   EI 
Sbjct: 1   MRDYKLVVLGAGGVGKSCLTVQFVQGVYLDSYDPTIEDSYR----KTMEIDNKVFDLEIL 56

Query: 61  DTAGQERYKSLAPMYYRNANGALVVYDVTQPDSLVKAQNWVDELKS---KVGDEDLV-IC 116
           DTAG  ++ ++  +Y ++  G L+VY V+   SL    N + EL+    ++ D D V I 
Sbjct: 57  DTAGVAQFTAMRELYIKSGMGFLLVYSVSDRQSL----NELLELREQVLRIKDSDRVPIV 112

Query: 117 LVGNKLDLCEEEGQERGVDKDDAQSYASDKG-LLFHEVSAKTGKGVSNIFQEIGEKLYLQ 175
           LVGNK DL +    ER +  ++    +S  G + F+E SA     V  +F ++  ++   
Sbjct: 113 LVGNKADLQD----ERVISVEEGIEVSSKWGKVPFYEASALLRSNVDEVFIDLVRQII-- 166

Query: 176 KKDSLEAASQTRH 188
            ++ LE+AS   +
Sbjct: 167 -RNELESASNINN 178

>CAGL0G08558g complement(804969..805652) highly similar to sp|Q00245
           Saccharomyces cerevisiae YIL118w RHO3, start by
           similarity
          Length = 227

 Score = 64.3 bits (155), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 49/181 (27%), Positives = 81/181 (44%), Gaps = 24/181 (13%)

Query: 5   KLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLKDYNDTVVKFEIWDTAG 64
           K+V+LGD + GK+S+++ F +  F E  E T+   ++         ++  +   +WDTAG
Sbjct: 22  KIVILGDGACGKTSLLNVFTRGYFPEVYEPTVFENYIHDIF----VDNRHITLSLWDTAG 77

Query: 65  QERYKSLAPMYYRNANGALVVYDVTQPDSLVKAQN-WVDELKSKVGDEDLVICLVGNKLD 123
           QE +  L  + Y + +  ++ + +   DSL   +N WV E+       +LV  LV  K D
Sbjct: 78  QEEFDRLRSLSYSDTHTIMLCFSIDSRDSLENVKNKWVGEITDHCEGVNLV--LVALKCD 135

Query: 124 LCEEEGQ----------------ERGVDKDDAQSYASDKGLL-FHEVSAKTGKGVSNIFQ 166
           L   E                     +  ++  + A   G L + E SAK  KGV+  F 
Sbjct: 136 LRNNENNVITPNNIQNNRNNNNNNNLITYEEGLAMAKQIGALRYLECSAKLNKGVNEAFT 195

Query: 167 E 167
           E
Sbjct: 196 E 196

>Scas_671.35
          Length = 234

 Score = 64.3 bits (155), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 50/199 (25%), Positives = 86/199 (43%), Gaps = 39/199 (19%)

Query: 2   LQFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLKDYNDTVVKFEIWD 61
           ++ K+V+LGD + GK+S+++ F +  F E  E T+   ++         ++  +   +WD
Sbjct: 15  IERKIVILGDGACGKTSLLNVFTRGYFPEVYEPTVFENYIHDIF----VDNKHITLSLWD 70

Query: 62  TAGQERYKSLAPMYYRNANGALVVYDVTQPDSLVKAQN-WVDELKSKVGDEDLVICLVGN 120
           TAGQE +  L  + Y + +  ++ + +   DSL   Q+ WV E+      E + + LV  
Sbjct: 71  TAGQEEFDRLRSLSYSDTHTIMLCFSIDSRDSLANVQHKWVGEIADHC--EGVKLVLVAL 128

Query: 121 KLDL--------------CEEEGQERGVDKDDAQSYASDKG------------------L 148
           K DL               +++ Q   V+    Q Y  + G                  L
Sbjct: 129 KCDLRNNDNERSAITPGVIKQQSQTDSVNDLQQQEYQRNNGNNLISYEEGLAMAKKVGAL 188

Query: 149 LFHEVSAKTGKGVSNIFQE 167
            + E SAK  KGV+  F E
Sbjct: 189 RYLECSAKLNKGVNEAFTE 207

>YGR152C (RSR1) [2106] chr7 complement(794677..795495) GTP-binding
           protein involved in bud site selection, member of the
           ras family in the ras superfamily [819 bp, 272 aa]
          Length = 272

 Score = 63.9 bits (154), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 58/210 (27%), Positives = 110/210 (52%), Gaps = 16/210 (7%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLKDYNDTVVKFEIW 60
           M  +KLV+LG   VGKS +  +FV+  + +  + TI  ++  +TI++   ++ V   EI 
Sbjct: 1   MRDYKLVVLGAGGVGKSCLTVQFVQGVYLDTYDPTIEDSY-RKTIEI---DNKVFDLEIL 56

Query: 61  DTAGQERYKSLAPMYYRNANGALVVYDVTQPDSLVKAQNWVDELKSKVGDEDLV-ICLVG 119
           DTAG  ++ ++  +Y ++  G L+VY VT   SL +     +++  ++ D D V + L+G
Sbjct: 57  DTAGIAQFTAMRELYIKSGMGFLLVYSVTDRQSLEELMELREQV-LRIKDSDRVPMVLIG 115

Query: 120 NKLDLCEEEGQERGVDKDDAQSYASDKGLL-FHEVSAKTGKGVSNIFQEIGEKLYLQKKD 178
           NK DL      ER +  ++    +S  G + F+E SA     V  +F ++  ++   + +
Sbjct: 116 NKADLI----NERVISVEEGIEVSSKWGRVPFYETSALLRSNVDEVFVDLVRQIIRNEME 171

Query: 179 SL---EAASQTRHVVNVELQRPTTNDATSC 205
           S+   +A +Q++    +E   P+T   +S 
Sbjct: 172 SVAVKDARNQSQQFSKIE--SPSTRLPSSA 199

>YOR101W (RAS1) [4906] chr15 (515244..516173) GTP-binding protein
           involved in regulation of cAMP pathway, homolog of
           mammalian proto-oncogene ras [930 bp, 309 aa]
          Length = 309

 Score = 63.9 bits (154), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 53/166 (31%), Positives = 86/166 (51%), Gaps = 10/166 (6%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLKDYNDTVVKFEIW 60
           + ++K+V++G   VGKS++  +F++  F +  + TI  ++  Q +     +D V   +I 
Sbjct: 8   IREYKIVVVGGGGVGKSALTIQFIQSYFVDEYDPTIEDSYRKQVV----IDDKVSILDIL 63

Query: 61  DTAGQERYKSLAPMYYRNANGALVVYDVTQPDSLVKAQNWVDELKSKVGDEDLV-ICLVG 119
           DTAGQE Y ++   Y R   G L+VY VT  +S  +  ++  +++ +V D D + + +VG
Sbjct: 64  DTAGQEEYSAMREQYMRTGEGFLLVYSVTSRNSFDELLSYYQQIQ-RVKDSDYIPVVVVG 122

Query: 120 NKLDLCEEEGQERGVDKDDAQSYASDKGLLFHEVSAKTGKGVSNIF 165
           NKLDL      ER V  +D    A      F E SAK    V   F
Sbjct: 123 NKLDL----ENERQVSYEDGLRLAKQLNAPFLETSAKQAINVDEAF 164

>KLLA0A11330g 982552..983124 similar to ca|CA6070|IPF4842 Candida
           albicans, start by similarity
          Length = 190

 Score = 62.4 bits (150), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 46/170 (27%), Positives = 84/170 (49%), Gaps = 9/170 (5%)

Query: 5   KLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLKDYNDTVVKF--EIWDT 62
           K+++LG  +VGK++++ +  +  F E    TI   F+ + + LK  N T +KF  +I DT
Sbjct: 7   KIIVLGSRNVGKTTLLVQLTESHFVESYYPTIENQFIHEFV-LKKPNGTELKFNLDIVDT 65

Query: 63  AGQERYKSLAPMYYRNANGALVVYDVTQPDSLVKAQNWVDELKSKVGDEDLVICLVGNKL 122
           +GQ+ +  +         G +++Y V    S    +   D++   +G  +L + LVGNK+
Sbjct: 66  SGQDEFSMINAKSMLGVAGCILMYSVANRHSFEIVELIRDKMLDMLGLLELPMVLVGNKI 125

Query: 123 DLCEEEGQERGVDKDDAQSYASDKGLLFHEVSAKTGKGVSNIFQEIGEKL 172
           DL      +R V   + +  A      F E+  K G G+   F+ + +K+
Sbjct: 126 DL------DRQVSYKEGEELAKRLKCGFVEICVKQGSGIEMPFKTLIQKI 169

>CAGL0E03113g complement(289164..290135) some similarities with
           sp|P13856 Saccharomyces cerevisiae YGR152c RSR1
           GTP-binding protein, start by similarity
          Length = 323

 Score = 63.5 bits (153), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 50/166 (30%), Positives = 88/166 (53%), Gaps = 9/166 (5%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLKDYNDTVVKFEIW 60
           M  +KLV+LG   VGKSS+  +FV+  + +  + TI  ++  +TI++   ++ V   EI 
Sbjct: 1   MRDYKLVVLGAGGVGKSSLTVQFVQGVYLDTYDPTIEDSY-RKTIEI---DNKVFDLEIL 56

Query: 61  DTAGQERYKSLAPMYYRNANGALVVYDVTQPDSLVKAQNWVDELKSKVGDEDLVICLVGN 120
           DTAG  ++ ++  +Y +   G L+VY VT  DSL +     +++      + + + LVGN
Sbjct: 57  DTAGVAQFTAMRELYIKAGMGFLLVYSVTDRDSLRELMELKEQVLRIKDSQRVPMVLVGN 116

Query: 121 KLDLCEEEGQERGVDKDDAQSYASDKG-LLFHEVSAKTGKGVSNIF 165
           K DL +    +R +  ++    +S  G + F+E SA     V  +F
Sbjct: 117 KADLVD----DRIIPVEEGIGVSSQWGKVPFYETSALLRSNVDEVF 158

>AGL093W [4218] [Homologous to ScYLR229C (CDC42) - SH]
           complement(532002..532577) [576 bp, 191 aa]
          Length = 191

 Score = 60.8 bits (146), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 48/178 (26%), Positives = 85/178 (47%), Gaps = 18/178 (10%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLKDYNDTVVKFEIW 60
           M   K V++GD +VGK+ ++  +  + F      T+   + + T+ + D   T+    ++
Sbjct: 1   MQTLKCVVVGDGAVGKTCLLISYTTNQFPADYVPTVFDNY-AVTVMIGDEPYTL---GLF 56

Query: 61  DTAGQERYKSLAPMYYRNANGALVVYDVTQPDSLVKA-QNWVDELKSKVGDEDLVICL-V 118
           DTAGQE Y  L P+ Y + +  LV + V  P S     + W  E+         V CL V
Sbjct: 57  DTAGQEDYDRLRPLSYPSTDVFLVCFSVVSPPSFENVKEKWFPEVHHHCPG---VPCLIV 113

Query: 119 GNKLDLCE--------EEGQERGVDKDDAQSYASD-KGLLFHEVSAKTGKGVSNIFQE 167
           G ++DL E        +  + R +  +  + +A + + + + E SA T +G+ N+F E
Sbjct: 114 GTQIDLRENKMVIEKLQRQRLRPITPEQGEKFARELRAVKYVECSALTQRGLKNVFDE 171

>YNL180C (RHO5) [4420] chr14 complement(299654..300649) GTPase of
           the rho family in the ras superfamily, involved in
           negative regulation of the Slt2p MAP kinase branch of
           the Pkc1p pathway [996 bp, 331 aa]
          Length = 331

 Score = 62.4 bits (150), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 62/248 (25%), Positives = 109/248 (43%), Gaps = 53/248 (21%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDSF---------DEFRES-TIGAAFLSQTIKLKDY 50
           M   K V++GD +VGK+S++  +  +SF         D +  +  I     S  ++L + 
Sbjct: 1   MRSIKCVIIGDGAVGKTSLLISYTTNSFPTDYVPTVFDNYSTTIAIPNGTASSPLELDNG 60

Query: 51  NDT----------------VVKFEIWDTAGQERYKSLAPMYYRNANGALVVYDVTQPDSL 94
           ND                 + K  +WDTAGQE Y  L P+ Y   +  L+ + V++  S 
Sbjct: 61  NDKRGSLSSASSSPSTDRKLYKINLWDTAGQEDYDRLRPLCYPQTDIFLICFSVSEHASF 120

Query: 95  VK-AQNWVDELK-----------SKVGDEDLVICLVGNKLDLCEEEGQERGVDKDDAQSY 142
               + W+ ELK           +K+G     I LVG K DL ++   ++ + + ++   
Sbjct: 121 ANVTEKWLPELKQTSNIEGTSLYTKLG--KYPILLVGTKSDLRDDPATQKKLQEANSDYV 178

Query: 143 ASDK--------GLL-FHEVSAKTGKGVSNIF-QEIGEKLYLQKKDSLEAASQTRHVVNV 192
           + ++        G + + E SA T  GV  +F Q +   +Y  +  + ++A+   H +  
Sbjct: 179 SQEEIDELVQRCGFMGYTECSAATQAGVREVFEQAVRYAIYEPESPNQKSAN---HTLTD 235

Query: 193 ELQRPTTN 200
           EL   TTN
Sbjct: 236 ELTTATTN 243

>Kwal_34.16142
          Length = 192

 Score = 60.8 bits (146), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 46/157 (29%), Positives = 71/157 (45%), Gaps = 4/157 (2%)

Query: 5   KLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLKDYNDTVVKFEIWDTAG 64
           K+ ++G  +VGKSS+  +FV+  F E    TI   F  Q +       T    EI DTAG
Sbjct: 13  KIAVVGARNVGKSSLTVQFVESRFVEPYYPTIENQFTKQIV----LGRTTYTLEICDTAG 68

Query: 65  QERYKSLAPMYYRNANGALVVYDVTQPDSLVKAQNWVDELKSKVGDEDLVICLVGNKLDL 124
           Q+ +  +         G  +VY      S    +   D++  +VG E +   ++GNK+DL
Sbjct: 69  QDEFSLINTKSLIGVKGVAIVYSCVNRASFEIVELIRDKILDQVGLEQIPTVILGNKIDL 128

Query: 125 CEEEGQERGVDKDDAQSYASDKGLLFHEVSAKTGKGV 161
            +       V + + +  A+  G  F E SAK   GV
Sbjct: 129 RDSGINGGKVRRQEGEELAARLGAGFVECSAKLNIGV 165

>Kwal_14.2244
          Length = 244

 Score = 61.2 bits (147), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 48/169 (28%), Positives = 86/169 (50%), Gaps = 9/169 (5%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLKDYNDTVVKFEIW 60
           M  +KLV+LG   VGKS +  +FV+  + +  + TI  ++     K  + ++ V   EI 
Sbjct: 1   MRDYKLVVLGAGGVGKSCLTVQFVQGVYLDTYDPTIEDSYR----KTMEIDNKVFDLEIL 56

Query: 61  DTAGQERYKSLAPMYYRNANGALVVYDVTQPDSLVKAQNWVDELKSKVGDEDLVICLVGN 120
           DTAG  ++ ++  +Y ++  G L+VY VT   SL +     +++     +  + + LVGN
Sbjct: 57  DTAGVAQFTAMRELYIKSGMGFLLVYSVTDRQSLEELIELREQVLRIKDNSRVPMVLVGN 116

Query: 121 KLDLCEEEGQERGVDKDDAQSYASDKG-LLFHEVSAKTGKGVSNIFQEI 168
           K DL +    ER +  ++    +S  G + F+E SA     V  +F ++
Sbjct: 117 KADLQD----ERVISVEEGIEMSSKWGKVPFYETSALLRSNVDEVFVDV 161

>YML064C (TEM1) [3905] chr13 complement(145139..145876) GTP-binding
           protein involved in termination of M-phase, member of
           the ras superfamily [738 bp, 245 aa]
          Length = 245

 Score = 60.8 bits (146), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 37/129 (28%), Positives = 71/129 (55%), Gaps = 10/129 (7%)

Query: 8   LLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLKDYNDTVVKFEIWDTAGQER 67
           L+GD+ VGK+S++ ++V++ +D+    T+G  FL + + ++    T + F I D  GQ  
Sbjct: 25  LVGDAQVGKTSLMVKYVQNIYDKEYTQTLGVNFLKRKVSIR---STDIIFSIMDLGGQRE 81

Query: 68  YKSLAPMYYRNANGALVVYDVTQPDSLVKAQNWVDELKSKVGDEDLVI-CLVGNKLDL-- 124
           + ++ P+    ++  + ++D+T+P++L   + W    +   G  D  I  LVG K DL  
Sbjct: 82  FINMLPIATVGSSVIIFLFDLTRPETLSSIKEW---YRQAYGLNDSAIPILVGTKYDLLI 138

Query: 125 -CEEEGQER 132
             + E QE+
Sbjct: 139 DLDPEYQEQ 147

>Scas_628.21
          Length = 208

 Score = 60.1 bits (144), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 54/189 (28%), Positives = 87/189 (46%), Gaps = 16/189 (8%)

Query: 2   LQFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLKDYNDTVVKFEIWD 61
            Q K+ +LG  +VGK+++  R+V+  F E    T+   F     KL D+ +     EI D
Sbjct: 13  FQRKIAVLGAKNVGKTTLTIRYVESRFLESYYPTVENHF----TKLIDFKNQHFTLEIVD 68

Query: 62  TAGQERYKSLAPMYYRNANGALVVYDVTQPDSLVKAQNWVDELKSKVGDEDLVICLVGNK 121
           TAGQ+    L         G ++ Y V    +        D+L  ++  +D+ + +VGNK
Sbjct: 69  TAGQDESSLLNLKSLAGVRGVILCYSVVNISTFDMIPVVWDKLLDQLERDDIPVIIVGNK 128

Query: 122 LDLCEEEGQERGVDKDDAQSYA-----SDKGLL--FHEVSAKTGKGVSNIFQEIGEKLYL 174
           +DL  +      V K + +  A     SDK +   F E SAK    V   FQ++     L
Sbjct: 129 IDLRNDLDNRTVVTKQEGKKLANLIRSSDKNIKAGFIECSAKDDTNVGTTFQKL-----L 183

Query: 175 QKKDSLEAA 183
           ++ + LEA+
Sbjct: 184 KQMELLEAS 192

>YNL098C (RAS2) [4493] chr14 complement(439602..440570) GTP-binding
           protein involved in regulation of cAMP pathway, homolog
           of mammalian proto-oncogene ras [969 bp, 322 aa]
          Length = 322

 Score = 60.1 bits (144), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 56/164 (34%), Positives = 82/164 (50%), Gaps = 10/164 (6%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLKDYNDTVVKFEIWDT 62
           ++KLV++G   VGKS++  +  +  F +  + TI  ++  Q +     +D V   +I DT
Sbjct: 10  EYKLVVVGGGGVGKSALTIQLTQSHFVDEYDPTIEDSYRKQVV----IDDEVSILDILDT 65

Query: 63  AGQERYKSLAPMYYRNANGALVVYDVTQPDSLVKAQNWVDELKSKVGDEDLV-ICLVGNK 121
           AGQE Y ++   Y RN  G L+VY +T   SL +   +  ++  +V D D V I +VGNK
Sbjct: 66  AGQEEYSAMREQYMRNGEGFLLVYSITSKSSLDELMTYYQQIL-RVKDTDYVPIVVVGNK 124

Query: 122 LDLCEEEGQERGVDKDDAQSYASDKGLLFHEVSAKTGKGVSNIF 165
            DL E E Q   V   D  + A      F E SAK    V   F
Sbjct: 125 SDL-ENEKQ---VSYQDGLNMAKQMNAPFLETSAKQAINVEEAF 164

>Kwal_26.8387
          Length = 292

 Score = 59.7 bits (143), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 54/166 (32%), Positives = 84/166 (50%), Gaps = 10/166 (6%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLKDYNDTVVKFEIW 60
           + ++KLV++G   VGKS++  + ++  F +  + TI  ++  Q +     +D V   +I 
Sbjct: 14  IREYKLVVVGGGGVGKSALTIQLIQSHFVDEYDPTIEDSYRKQVV----IDDKVSILDIL 69

Query: 61  DTAGQERYKSLAPMYYRNANGALVVYDVTQPDSLVKAQNWVDELKSKVGDEDLV-ICLVG 119
           DTAGQE Y ++   Y R   G L+VY VT   S  +   +  ++  +V D D V + LVG
Sbjct: 70  DTAGQEEYSAMREQYMRTGEGFLLVYSVTSRTSFDELMTYYQQI-LRVKDADYVPVFLVG 128

Query: 120 NKLDLCEEEGQERGVDKDDAQSYASDKGLLFHEVSAKTGKGVSNIF 165
           NK DL +    ER V  ++  S A      F E SAK    V + F
Sbjct: 129 NKSDLED----ERQVAYEEGVSLAKQFNAPFMETSAKQAINVEDSF 170

>CAGL0J11242g 1092630..1093784 similar to sp|P53879 Saccharomyces
           cerevisiae YNL180c RHO5, start by similarity
          Length = 384

 Score = 60.1 bits (144), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 43/133 (32%), Positives = 62/133 (46%), Gaps = 19/133 (14%)

Query: 54  VVKFEIWDTAGQERYKSLAPMYYRNANGALVVYDVTQPDSLVK-AQNWVDELKSKVGDE- 111
           + K  +WDTAGQE Y  L P+ YR  +  L+ + V++P S       W  ELK   G E 
Sbjct: 116 IFKLNLWDTAGQEEYDRLRPLSYRQTDVFLICFSVSEPSSFRNVVDKWFPELKRVSGIES 175

Query: 112 -DL-------VICLVGNKLDLCEEEGQERG--------VDKDDAQSYASDKGLL-FHEVS 154
            DL        I LVG K DL ++E + +         V K++      D G + + E S
Sbjct: 176 GDLYTNFKKYPILLVGTKSDLRDDENEIQKMRDQNLSFVSKEEIDKVVEDNGFMGYVECS 235

Query: 155 AKTGKGVSNIFQE 167
           A T   V  +F++
Sbjct: 236 AATQNNVRQVFEK 248

>Kwal_23.4875
          Length = 230

 Score = 58.9 bits (141), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 35/124 (28%), Positives = 64/124 (51%), Gaps = 7/124 (5%)

Query: 2   LQFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLKDYNDTVVKFEIWD 61
           ++ K+V+LGD + GK+S+++ F +  F +  E T+   ++         ++  +   +WD
Sbjct: 14  IERKIVILGDGACGKTSLLNVFTRGYFPKVYEPTVFENYIHDIF----VDNQHITLSLWD 69

Query: 62  TAGQERYKSLAPMYYRNANGALVVYDVTQPDSLVKAQN-WVDELKSKVGDEDLVICLVGN 120
           TAGQE +  L  + Y + +  ++ + V   DSL   Q+ WV E+      E + + LV  
Sbjct: 70  TAGQEEFDRLRSLSYSDTHTIMLCFSVDSRDSLDNVQHKWVGEIADHC--EGVKLVLVAL 127

Query: 121 KLDL 124
           K DL
Sbjct: 128 KCDL 131

>YCR027C (RHB1) [561] chr3 complement(167365..167994) Protein
           involved in regulation of arginine and lysine uptake,
           member of the Rheb family in the Ras superfamily of G
           proteins [630 bp, 209 aa]
          Length = 209

 Score = 58.5 bits (140), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 46/147 (31%), Positives = 72/147 (48%), Gaps = 5/147 (3%)

Query: 2   LQFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLKDYNDTVVKFEIWD 61
            Q K+ L+G  +VGK+++  RFV+  F E    TI   F ++ I  K ++ T+   EI D
Sbjct: 15  FQRKIALIGARNVGKTTLTVRFVESRFVESYYPTIENEF-TRIIPYKSHDCTL---EILD 70

Query: 62  TAGQERYKSLAPMYYRNANGALVVYDVTQPDSLVKAQNWVDELKSKVGDEDLVICLVGNK 121
           TAGQ+    L         G ++ Y +    S        D+L  ++G ++L + LVG K
Sbjct: 71  TAGQDEVSLLNIKSLTGVRGIILCYSIINRASFDLIPILWDKLVDQLGKDNLPVILVGTK 130

Query: 122 LDLCEE-EGQERGVDKDDAQSYASDKG 147
            DL    +G +R V K + +  AS  G
Sbjct: 131 ADLGRSTKGVKRCVTKAEGEKLASTIG 157

>Scas_697.46
          Length = 324

 Score = 59.3 bits (142), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 50/166 (30%), Positives = 82/166 (49%), Gaps = 10/166 (6%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLKDYNDTVVKFEIW 60
           + ++KLV++G   VGKS++  + +   F +  + TI  ++  Q +     +D V   ++ 
Sbjct: 8   IREYKLVVVGGGGVGKSALTIQLIHSHFVDEYDPTIEDSYRKQVV----IDDKVTVLDVL 63

Query: 61  DTAGQERYKSLAPMYYRNANGALVVYDVTQPDSLVKAQNWVDELKSKVGDEDLV-ICLVG 119
           DTAGQE Y ++   Y R   G L+VY VT  +S  +   +  +++ +V D D + + +VG
Sbjct: 64  DTAGQEEYSAMREQYMRTGEGFLLVYSVTSKNSFEELLTYYQQIQ-RVKDSDYIPVVIVG 122

Query: 120 NKLDLCEEEGQERGVDKDDAQSYASDKGLLFHEVSAKTGKGVSNIF 165
           NK DL +    ER V      + A      F E SAK    V   F
Sbjct: 123 NKSDLED----ERQVPYQSGVNLAKQMNAPFLETSAKQAINVEEAF 164

>KLLA0A04213g complement(382243..382818) highly similar to sp|P19073
           Saccharomyces cerevisiae YLR229c CDC42 GTP-binding
           protein of RAS superfamily, start by similarity
          Length = 191

 Score = 57.8 bits (138), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 47/178 (26%), Positives = 84/178 (47%), Gaps = 18/178 (10%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLKDYNDTVVKFEIW 60
           M   K V++GD +VGK+ ++  +  + F      T+   + + T+ + D   T+    ++
Sbjct: 1   MQTLKCVVIGDGAVGKTCLLISYTTNQFPADYVPTVFDNY-AVTVMIGDEPYTL---GLF 56

Query: 61  DTAGQERYKSLAPMYYRNANGALVVYDVTQPDSLVKA-QNWVDELKSKVGDEDLVICL-V 118
           DTAGQE Y  L P+ Y + +  LV + V  P S     + W  E+         V CL V
Sbjct: 57  DTAGQEDYDRLRPLSYPSTDVFLVCFSVISPPSFENVKEKWFPEVHHHCPG---VPCLIV 113

Query: 119 GNKLDLCE--------EEGQERGVDKDDAQSYASD-KGLLFHEVSAKTGKGVSNIFQE 167
           G ++DL +        +  + R +  +  +  A + + + + E SA T +G+ N+F E
Sbjct: 114 GTQIDLRDDKVIIEKLQRQRLRPITPEQGERLARELRAVKYVECSALTQRGLKNVFDE 171

>Kwal_23.3135
          Length = 191

 Score = 57.4 bits (137), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 47/178 (26%), Positives = 84/178 (47%), Gaps = 18/178 (10%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLKDYNDTVVKFEIW 60
           M   K V++GD +VGK+ ++  +  + F      T+   + + T+ + D   T+    ++
Sbjct: 1   MQTLKCVVVGDGAVGKTCLLISYTTNQFPADYVPTVFDNY-AVTVMIGDEPYTL---GLF 56

Query: 61  DTAGQERYKSLAPMYYRNANGALVVYDVTQPDSLVKA-QNWVDELKSKVGDEDLVICL-V 118
           DTAGQE Y  L P+ Y + +  LV + V  P S     + W  E+         V CL V
Sbjct: 57  DTAGQEDYDRLRPLSYPSTDVFLVCFSVISPPSFENVKEKWFPEVHHHCPG---VPCLIV 113

Query: 119 GNKLDLCE--------EEGQERGVDKDDAQSYASD-KGLLFHEVSAKTGKGVSNIFQE 167
           G ++DL +        +  + R +  +  +  A + + + + E SA T +G+ N+F E
Sbjct: 114 GTQIDLRDDKVIIEKLQRQRLRPISAEQGERLARELRAIKYVECSALTQRGLKNVFDE 171

>YLR229C (CDC42) [3629] chr12 complement(604214..604789) Rho-type
           GTPase involved in bud site assembly, cell polarity, and
           exocytosis, member of the rho family of the ras
           superfamily [576 bp, 191 aa]
          Length = 191

 Score = 57.0 bits (136), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 47/178 (26%), Positives = 84/178 (47%), Gaps = 18/178 (10%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLKDYNDTVVKFEIW 60
           M   K V++GD +VGK+ ++  +  + F      T+   + + T+ + D   T+    ++
Sbjct: 1   MQTLKCVVVGDGAVGKTCLLISYTTNQFPADYVPTVFDNY-AVTVMIGDEPYTL---GLF 56

Query: 61  DTAGQERYKSLAPMYYRNANGALVVYDVTQPDSLVKA-QNWVDELKSKVGDEDLVICL-V 118
           DTAGQE Y  L P+ Y + +  LV + V  P S     + W  E+         V CL V
Sbjct: 57  DTAGQEDYDRLRPLSYPSTDVFLVCFSVISPPSFENVKEKWFPEVHHHCPG---VPCLVV 113

Query: 119 GNKLDLCEEEGQERGVDKDDAQSYASDKG---------LLFHEVSAKTGKGVSNIFQE 167
           G ++DL +++     + +   +   S++G         + + E SA T +G+ N+F E
Sbjct: 114 GTQIDLRDDKVIIEKLQRQRLRPITSEQGSRLARELKAVKYVECSALTQRGLKNVFDE 171

>Scas_721.96
          Length = 191

 Score = 56.6 bits (135), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 48/178 (26%), Positives = 82/178 (46%), Gaps = 18/178 (10%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLKDYNDTVVKFEIW 60
           M   K V +GD +VGK+ ++  +  + F      T+   + + T+ + D   T+    ++
Sbjct: 1   MKTIKAVTIGDGAVGKTCLLISYTTNQFPADYVPTVFDNY-AVTVMIGDEPYTL---GLF 56

Query: 61  DTAGQERYKSLAPMYYRNANGALVVYDVTQPDSLVKA-QNWVDELKSKVGDEDLVICL-V 118
           DTAGQE Y  L P+ Y + +  LV + V  P S     + W  E+         V CL V
Sbjct: 57  DTAGQEDYDRLRPLSYPSTDVFLVCFSVISPPSFENVKEKWFPEVHHHCPG---VPCLIV 113

Query: 119 GNKLDLCE--------EEGQERGVDKDDAQSYASD-KGLLFHEVSAKTGKGVSNIFQE 167
           G ++DL          +  + R +  +  +  A + K + + E SA T +G+ N+F E
Sbjct: 114 GTQIDLRSDPIIIEKLQRQRLRPISPEQGERLARELKAVKYVECSALTQRGLKNVFDE 171

>CAGL0F05269g complement(533759..534334) highly similar to sp|P19073
           Saccharomyces cerevisiae YLR229c CDC42, start by
           similarity
          Length = 191

 Score = 56.6 bits (135), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 47/178 (26%), Positives = 85/178 (47%), Gaps = 18/178 (10%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLKDYNDTVVKFEIW 60
           M   K V++GD +VGK+ ++  +  + F      T+   + + T+ + D   T+    ++
Sbjct: 1   MQTLKCVVVGDGAVGKTCLLISYTTNQFPADYVPTVFDNY-AVTVMIGDEPYTL---GLF 56

Query: 61  DTAGQERYKSLAPMYYRNANGALVVYDVTQPDSLVKA-QNWVDELKSKVGDEDLVICL-V 118
           DTAGQE Y  L P+ Y + +  LV + V  P S     + W  E+         V CL V
Sbjct: 57  DTAGQEDYDRLRPLSYPSTDVFLVCFSVISPPSFENVKEKWFPEVHHHCPG---VPCLVV 113

Query: 119 GNKLDLCEEE--------GQERGVDKDDAQSYASD-KGLLFHEVSAKTGKGVSNIFQE 167
           G ++DL +++         + R +  +  +  A + + + + E SA T +G+ N+F E
Sbjct: 114 GTQVDLRDDKVIIEKLRRQRLRPITAEQGERLARELRAVKYVECSALTQRGLKNVFDE 171

>Kwal_55.21971
          Length = 421

 Score = 57.4 bits (137), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 35/94 (37%), Positives = 52/94 (55%), Gaps = 6/94 (6%)

Query: 34  STIGAAFLSQTIKLKDYNDTVVKFEIWDTAGQERYK-SLAPMYYRNANGALVVYDVTQPD 92
           STIG    +  + +   ++   K  +WDTAGQERY+ ++ P  Y+ +NG L+ YD+    
Sbjct: 202 STIGVDIRTNLVNI---DNRYFKVTMWDTAGQERYRNAMIPSLYKGSNGILLSYDICSRK 258

Query: 93  SLVKAQN-WVDE-LKSKVGDEDLVICLVGNKLDL 124
           S     + W+ E L     D+ L I LVGNK+DL
Sbjct: 259 SFQNCLDYWLQEVLNCCADDKALRIYLVGNKIDL 292

>CAGL0B04521g complement(439732..440751) similar to sp|P01120
           Saccharomyces cerevisiae YNL098c RAS2 GTP-binding
           protein or sp|P01119 Saccharomyces cerevisiae YOR101w
           RAS1, hypothetical start
          Length = 339

 Score = 56.6 bits (135), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 51/163 (31%), Positives = 79/163 (48%), Gaps = 8/163 (4%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLKDYNDTVVKFEIWDT 62
           ++KLV++G   VGKS++  + V   F +  + TI  ++  Q +     +D V   +I DT
Sbjct: 8   EYKLVVVGGGGVGKSALTIQLVHSHFVDEYDPTIEDSYRKQVV----IDDKVTILDILDT 63

Query: 63  AGQERYKSLAPMYYRNANGALVVYDVTQPDSLVKAQNWVDELKSKVGDEDLVICLVGNKL 122
           AGQE Y ++   Y R   G L+VY VT   S  +   +  +++     E + + +VGNK 
Sbjct: 64  AGQEEYSAMREQYMRTGEGFLLVYSVTSRTSFEELITYYQQIQRVKDVEYIPVVVVGNKS 123

Query: 123 DLCEEEGQERGVDKDDAQSYASDKGLLFHEVSAKTGKGVSNIF 165
           DL      ER V  ++  S A      F E SAK    V + F
Sbjct: 124 DLET----ERQVSFEEGASLAKQLNAPFLETSAKQAINVEDAF 162

>Scas_677.20
          Length = 283

 Score = 56.2 bits (134), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 55/227 (24%), Positives = 100/227 (44%), Gaps = 26/227 (11%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLKDYN-----DTVV 55
           M   K  ++GD  VGK+ ++  +  ++F      T+   + S TI L             
Sbjct: 1   MRSIKCTVIGDGCVGKTCLLISYTTNTFPNEYVPTVFDNY-STTITLPPVGKGKEEPEYY 59

Query: 56  KFEIWDTAGQERYKSLAPMYYRNANGALVVYDVTQPDSL--VKAQNWVDELKSKVGDEDL 113
           K  +WDTAGQ+ Y +L P+ Y   +  ++ + V    SL  VK++ WV E+K+   +++L
Sbjct: 60  KLNLWDTAGQDDYDTLRPLSYPQTDIFIICFAVNDLVSLDNVKSK-WVPEIKNSFNEDEL 118

Query: 114 ---------VICLVGNKLDL-CEEEGQERGVDKDDAQSYASDKGLL-FHEVSAKTGKGVS 162
                     + LVG K D   ++E   +    +  QS     G + + E SA +  G+ 
Sbjct: 119 KVFQSRNRFPMLLVGTKADTRYDDEIDGKFATNETIQSVVDQCGFVGYVECSALSQMGIK 178

Query: 163 NIFQEI------GEKLYLQKKDSLEAASQTRHVVNVELQRPTTNDAT 203
           ++F+E       G+ +   ++ ++ A        N  L  P +  +T
Sbjct: 179 DVFEEAVKAVVYGDGIETPERGAMAAQKTRTTSTNTALDVPVSGVST 225

>Kwal_23.2944
          Length = 184

 Score = 54.3 bits (129), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 34/125 (27%), Positives = 66/125 (52%), Gaps = 14/125 (11%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLKDYNDTVVKFEIWDT 62
           + K+++LG  + GK++I+++      ++ + S     F  +T+  ++     VKF +WD 
Sbjct: 17  EMKILMLGLDNAGKTTILYKL---KLNKIKTSAPTVGFNVETVSFRN-----VKFNMWDV 68

Query: 63  AGQERYKSLAPMYYRNANGALVVYDVTQPDSLVKAQNWVDELKSKVGD---EDLVICLVG 119
            GQ+R + L   Y+      + V D    + L +A+   +EL S +GD   E++V+ ++ 
Sbjct: 69  GGQDRLRPLWRHYFPATTALIFVVDSQDMERLNEAK---EELYSIIGDKEMENVVLLVLA 125

Query: 120 NKLDL 124
           NK DL
Sbjct: 126 NKQDL 130

>YOR094W (ARF3) [4899] chr15 (502795..503346) Protein with
           similarity to members of the arf family (ras
           superfamily) of GTP-binding proteins [552 bp, 183 aa]
          Length = 183

 Score = 53.9 bits (128), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 34/125 (27%), Positives = 66/125 (52%), Gaps = 14/125 (11%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLKDYNDTVVKFEIWDT 62
           + K+++LG    GK++I+++      ++ + ST    F  +T+  K+     VKF +WD 
Sbjct: 17  EMKILMLGLDKAGKTTILYKL---KLNKIKTSTPTVGFNVETVTYKN-----VKFNMWDV 68

Query: 63  AGQERYKSLAPMYYRNANGALVVYDVTQPDSLVKAQNWVDELKSKVGD---EDLVICLVG 119
            GQ+R + L   Y+      + V D +  + + +A+   +EL S +G+   E++V+ +  
Sbjct: 69  GGQQRLRPLWRHYFPATTALIFVIDSSARNRMEEAK---EELYSIIGEKEMENVVLLVWA 125

Query: 120 NKLDL 124
           NK DL
Sbjct: 126 NKQDL 130

>Sklu_2320.2 YOR094W, Contig c2320 3571-4065
          Length = 164

 Score = 53.5 bits (127), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 36/124 (29%), Positives = 63/124 (50%), Gaps = 14/124 (11%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLKDYNDTVVKFEIWDTA 63
            K+++LG  + GK++I+++      ++ + S     F  +T+  K+     VKF +WD  
Sbjct: 1   MKILMLGLDNAGKTTILYKL---KLNKIKTSAPTVGFNVETVTYKN-----VKFNMWDVG 52

Query: 64  GQERYKSLAPMYYRNANGALVVYDVTQPDSLVKAQNWVDELKSKVGD---EDLVICLVGN 120
           GQER + L   Y+      + V D    D L +A+   +E  S VG+   E +V+ ++ N
Sbjct: 53  GQERLRPLWRHYFPATTALIFVIDSQDKDRLNEAK---EEFYSIVGEKEMEKVVLLVLAN 109

Query: 121 KLDL 124
           K DL
Sbjct: 110 KQDL 113

>YNL304W (YPT11) [4309] chr14 (60482..61549) Predicted GTPase
           possibly involved in non-selective vesicle transport,
           interacts with Myo2p and plays a role in distribution of
           mitochondria into growing buds [1068 bp, 355 aa]
          Length = 355

 Score = 53.9 bits (128), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 32/99 (32%), Positives = 52/99 (52%), Gaps = 8/99 (8%)

Query: 34  STIGAAFLSQTIKLKDYNDTVVKFEIWDTAGQERYK-SLAPMYYRNANGALVVYDVTQPD 92
           STIG    +  + + +    V+   +WDTAGQERY+ ++ P  Y+  N  ++ YD+T   
Sbjct: 142 STIGIDIKTNLVNIDNRFFNVI---LWDTAGQERYQNAIIPSLYKKTNAVILTYDITNAK 198

Query: 93  SLVKA-QNWVDELKSKVGDEDLV---ICLVGNKLDLCEE 127
           S     + W+ +       +DL+     LVGNK+DL +E
Sbjct: 199 SFQSCMERWIVQALENFSSQDLLKARFFLVGNKIDLYKE 237

>ACL078W [971] [Homologous to ScYOR094W (ARF3) - SH]
           complement(212664..213209) [546 bp, 181 aa]
          Length = 181

 Score = 52.8 bits (125), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 34/125 (27%), Positives = 65/125 (52%), Gaps = 14/125 (11%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLKDYNDTVVKFEIWDT 62
           + K+++LG  + GK++I+++      ++ + S     F  +T+  ++     VKF +WD 
Sbjct: 17  EMKILMLGLDNAGKTTILYKL---KLNKIKTSAPTVGFNVETVAFRN-----VKFNMWDV 68

Query: 63  AGQERYKSLAPMYYRNANGALVVYDVTQPDSLVKAQNWVDELKSKVGD---EDLVICLVG 119
            GQER + L   Y+      + V D      L +A+   +EL S +G+   E++V+ ++ 
Sbjct: 69  GGQERLRPLWRHYFPATTALIFVIDSHDQARLNEAK---EELYSIIGEKEMENVVLLVLA 125

Query: 120 NKLDL 124
           NK DL
Sbjct: 126 NKQDL 130

>Scas_697.54*
          Length = 181

 Score = 52.4 bits (124), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 35/125 (28%), Positives = 65/125 (52%), Gaps = 14/125 (11%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLKDYNDTVVKFEIWDT 62
           + K+++LG  + GK++I+++      ++ + ST    F  +T+  K+     VKF +WD 
Sbjct: 17  EMKILMLGLDNAGKTTILYKL---KLNKIKTSTPTVGFNVETVSYKN-----VKFNMWDV 68

Query: 63  AGQERYKSLAPMYYRNANGALVVYDVTQPDSLVKAQNWVDELKSKVGD---EDLVICLVG 119
            GQER + L   Y+      + V D +  + L +A+   +EL S + +   E +V+ +  
Sbjct: 69  GGQERLRPLWRHYFPATTALIFVIDSSDQERLNEAK---EELYSIISEKEMEKVVLLVWA 125

Query: 120 NKLDL 124
           NK DL
Sbjct: 126 NKQDL 130

>ADL262W [1479] [Homologous to ScYOR101W (RAS1) - SH; ScYNL098C
           (RAS2) - SH] complement(243998..244012,244074..244871)
           [813 bp, 270 aa]
          Length = 270

 Score = 53.1 bits (126), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 51/163 (31%), Positives = 78/163 (47%), Gaps = 8/163 (4%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLKDYNDTVVKFEIWDT 62
           ++KLV++G   VGKS++  + ++  F +  + TI  ++  Q +     +  V   +I DT
Sbjct: 10  EYKLVVVGGGGVGKSALTIQLIQSHFVDEYDPTIEDSYRKQVV----IDGQVSILDILDT 65

Query: 63  AGQERYKSLAPMYYRNANGALVVYDVTQPDSLVKAQNWVDELKSKVGDEDLVICLVGNKL 122
           AGQE Y ++   Y R   G L+VY VT   S  +   +  ++      E + I +VGNK 
Sbjct: 66  AGQEEYSAMREQYMRTGEGFLLVYSVTSRTSFEELMTYYQQILRVKDVEYVPIFVVGNKS 125

Query: 123 DLCEEEGQERGVDKDDAQSYASDKGLLFHEVSAKTGKGVSNIF 165
           DL   EG ER V  ++    A      F E SAK    V   F
Sbjct: 126 DL---EG-ERQVSFEEGAELARHFNASFLETSAKQAINVEESF 164

>ADL162W [1579] [Homologous to ScYNL304W (YPT11) - SH]
           complement(405601..406815) [1215 bp, 404 aa]
          Length = 404

 Score = 53.5 bits (127), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 41/130 (31%), Positives = 65/130 (50%), Gaps = 16/130 (12%)

Query: 33  ESTIGAAFLSQTIKLKDYNDTVVKFEIWDTAGQERYK-SLAPMYYRNANGALVVYDV--- 88
           +STIG    +  +   D +  + K  +WDTAGQERY+ ++ P  Y+   G ++ YD+   
Sbjct: 165 KSTIGVDIKTSFV---DIDRQLFKVIMWDTAGQERYRNAMVPSLYKGTQGIILSYDICSR 221

Query: 89  -TQPDSLVKAQNWVDELKSKVGDEDLVICLVGNKLDLCEEEGQERGVDKDDAQSYASDKG 147
            T PD L   ++W+ E       E     LVGNK+DL     ++R V   D  ++A +  
Sbjct: 222 ETFPDCL---EHWLPEALEHCQVEHTRFYLVGNKVDLY----KQRQVTHADVLAFADEAK 274

Query: 148 LLF-HEVSAK 156
             +  E+S K
Sbjct: 275 RRYGFEISGK 284

>CAGL0G05764g complement(552809..553681) similar to sp|P53879
           Saccharomyces cerevisiae YNL180c RHO5, start by
           similarity
          Length = 290

 Score = 52.8 bits (125), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 50/187 (26%), Positives = 84/187 (44%), Gaps = 19/187 (10%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLKDYNDTVVKFEIW 60
           M   K VL+GDS VGK++ +  +   SF      T+   +L+ TI+ K+   T      W
Sbjct: 1   MKSLKCVLVGDSEVGKTAFLMSYTTGSFSPEYVPTVFDEYLT-TIQDKETGYT-FHTTFW 58

Query: 61  DTAGQERYKSLAPMYYRNANGALVVYDVTQPDSLVKAQN-WVDELKSKVGDED----LVI 115
           DT+G +++  L P+ Y   +  L  +      S    ++ W+ ELK  +   D    + I
Sbjct: 59  DTSGDKQHDHLRPLTYPQTDVFLACFPYNDIRSFRNVKDKWIPELKKYIRKSDNSSTVPI 118

Query: 116 CLVGNKLDLCEEE------GQERGVD-----KDDAQSYASDKGLL-FHEVSAKTGKGVSN 163
            LV  K DL ++        Q + VD     +        D+ LL F + S+KTG G+ +
Sbjct: 119 LLVATKCDLNDDNSSNNILNQSQEVDGMPLPESLVDGLVIDENLLGFVKCSSKTGYGLQD 178

Query: 164 IFQEIGE 170
           +   + +
Sbjct: 179 VIDNVAK 185

>Sklu_2365.2 YPL051W, Contig c2365 827-1420 reverse complement
          Length = 197

 Score = 52.0 bits (123), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 48/167 (28%), Positives = 79/167 (47%), Gaps = 13/167 (7%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLKDYNDTVVKFEIWDT 62
           QF +++LG  + GK++ +    K+     +        + Q +      D V+KF  WD 
Sbjct: 17  QFSILILGLDNAGKTTFLETLKKEYSLHSKPLEKITPTVGQNVATIPVQDCVLKF--WDV 74

Query: 63  AGQERYKSLAPMYYRNANGALVVYDVTQPDSLVKAQNWVDELKSKVGDED---LVICLVG 119
            GQE  +SL   YY  A+G + V D T  D L + +   + L+S V DED   + + ++ 
Sbjct: 75  GGQETLRSLWAEYYSQAHGIIFVVDSTDRDRLDECK---ETLRSIVMDEDVEGVPVLMLA 131

Query: 120 NKL---DLCEEEGQERGVDKDDAQSYASDKGLLFHEVSAKTGKGVSN 163
           NK    D  E +  +   +K      A D  +L   +SA TG+GV++
Sbjct: 132 NKQDREDRMEVQDIKEIFNKIAEHLGARDSRVL--PISALTGEGVTD 176

>KLLA0C13563g complement(1157278..1157826) highly similar to
           sp|P40994 Saccharomyces cerevisiae YOR094w ARF3
           ADP-ribosylation factor 3, start by similarity
          Length = 182

 Score = 51.2 bits (121), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 34/125 (27%), Positives = 65/125 (52%), Gaps = 14/125 (11%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLKDYNDTVVKFEIWDT 62
           + K+++LG  + GK++I+++      ++ + S     F  +T+  K+     VKF +WD 
Sbjct: 17  EMKILMLGLDNAGKTTILYKL---KLNKIKTSAPTVGFNVETLSFKN-----VKFNMWDV 68

Query: 63  AGQERYKSLAPMYYRNANGALVVYDVTQPDSLVKAQNWVDELKSKVGD---EDLVICLVG 119
            GQ R + L   Y+   +  + V D    + L +A+   +EL S +G+   E +V+ ++ 
Sbjct: 69  GGQARLRPLWRHYFPATSALIFVIDSNDKERLDQAK---EELFSIIGEKEMEKVVLLVLA 125

Query: 120 NKLDL 124
           NK DL
Sbjct: 126 NKQDL 130

>CAGL0I03916g 343014..343559 highly similar to sp|P11076
           Saccharomyces cerevisiae YDL192w ARF1 or sp|P19146
           Saccharomyces cerevisiae YDL137w ARF2, start by
           similarity
          Length = 181

 Score = 50.1 bits (118), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 38/163 (23%), Positives = 73/163 (44%), Gaps = 17/163 (10%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLKDYNDTVVKFEIWDT 62
           + +++++G    GK++++++       E   +     F  +T++ K+     + F +WD 
Sbjct: 17  EMRILMVGLDGAGKTTVLYKL---KLGEVITTIPTIGFNVETVQYKN-----ISFTVWDV 68

Query: 63  AGQERYKSLAPMYYRNANGALVVYDVTQPDSLVKAQNWVDELKSKVGDED----LVICLV 118
            GQ+R +SL   YYRN  G + V D      + +A+    E+  ++ +ED     V  + 
Sbjct: 69  GGQDRIRSLWRHYYRNTEGVIFVVDSNDRSRIGEAR----EVMQRMLNEDELRNAVWLVF 124

Query: 119 GNKLDLCEEEGQERGVDKDDAQSYASDKGLLFHEVSAKTGKGV 161
            NK DL E        +K    S   ++        A TG+G+
Sbjct: 125 ANKQDLPEAMSAAEITEKLGLHS-IRNRPWFIQATCATTGEGL 166

>KLLA0C12881g 1090895..1092016 weakly similar to sp|P48559
           Saccharomyces cerevisiae YNL304w YPT11, start by
           similarity
          Length = 373

 Score = 50.8 bits (120), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 35/114 (30%), Positives = 59/114 (51%), Gaps = 10/114 (8%)

Query: 34  STIGAAFLSQTIKLKDYNDTVVKFEIWDTAGQERYK-SLAPMYYRNANGALVVYDVTQPD 92
           STIG    +  + +   ++   +  +WDTAGQERY+ ++    Y+ +NG ++ YD+   +
Sbjct: 159 STIGIDIKTNLVNI---DNRFFRVIMWDTAGQERYRNAMISSLYKGSNGVILSYDICDFN 215

Query: 93  SLVKAQN-WVDELKSKVGDEDLV-ICLVGNKLDLCEEEGQERGVDKDDAQSYAS 144
           S +   N W+ E    + +  +    LVGNKLDL     +ER V  +D   + S
Sbjct: 216 SFLNCLNFWLVESIENIPNLSMTRFYLVGNKLDLY----KERKVTHEDVLQFIS 265

>YDL137W (ARF2) [731] chr4 (216529..217074) GTP-binding protein of
           the arf family (ras superfamily) involved in assembly of
           coated vesicles of the secretory system [546 bp, 181 aa]
          Length = 181

 Score = 48.5 bits (114), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 34/159 (21%), Positives = 71/159 (44%), Gaps = 9/159 (5%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLKDYNDTVVKFEIWDT 62
           + +++++G    GK++++++       E   +     F  +T++ K+     + F +WD 
Sbjct: 17  EMRILMVGLDGAGKTTVLYKL---KLGEVITTIPTIGFNVETVQYKN-----ISFTVWDV 68

Query: 63  AGQERYKSLAPMYYRNANGALVVYDVTQPDSLVKAQNWVDELKSKVGDEDLVICLVGNKL 122
            GQ+R +SL   YYRN  G + V D      + +A+  +  + ++    + V  +  NK 
Sbjct: 69  GGQDRIRSLWRHYYRNTEGVIFVIDSNDRSRIGEAREVMQRMLNEDELRNAVWLVFANKQ 128

Query: 123 DLCEEEGQERGVDKDDAQSYASDKGLLFHEVSAKTGKGV 161
           DL E        +K    S   ++        A +G+G+
Sbjct: 129 DLPEAMSAAEITEKLGLHS-IRNRPWFIQSTCATSGEGL 166

>Scas_624.4*
          Length = 181

 Score = 48.1 bits (113), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 34/159 (21%), Positives = 71/159 (44%), Gaps = 9/159 (5%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLKDYNDTVVKFEIWDT 62
           + +++++G    GK++++++       E   +     F  +T++ K+     + F +WD 
Sbjct: 17  EMRILMVGLDGAGKTTVLYKL---KLGEVITTIPTIGFNVETVQYKN-----ISFTVWDV 68

Query: 63  AGQERYKSLAPMYYRNANGALVVYDVTQPDSLVKAQNWVDELKSKVGDEDLVICLVGNKL 122
            GQ+R +SL   YYRN  G + V D      + +A+  +  + ++    + V  +  NK 
Sbjct: 69  GGQDRIRSLWRHYYRNTEGVIFVVDSNDRSRIGEAREVMQRMLNEDELRNAVWLVFANKQ 128

Query: 123 DLCEEEGQERGVDKDDAQSYASDKGLLFHEVSAKTGKGV 161
           DL E        +K    S   ++        A +G+G+
Sbjct: 129 DLPEAMSAAEITEKLGLHS-IRNRPWFIQATCATSGEGL 166

>Scas_701.42*
          Length = 181

 Score = 48.1 bits (113), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 34/159 (21%), Positives = 71/159 (44%), Gaps = 9/159 (5%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLKDYNDTVVKFEIWDT 62
           + +++++G    GK++++++       E   +     F  +T++ K+     + F +WD 
Sbjct: 17  EMRILMVGLDGAGKTTVLYKL---KLGEVITTIPTIGFNVETVQYKN-----ISFTVWDV 68

Query: 63  AGQERYKSLAPMYYRNANGALVVYDVTQPDSLVKAQNWVDELKSKVGDEDLVICLVGNKL 122
            GQ+R +SL   YYRN  G + V D      + +A+  +  + ++    + V  +  NK 
Sbjct: 69  GGQDRIRSLWRHYYRNTEGVIFVVDSNDRSRIGEAREVMQRMLNEDELRNAVWLVFANKQ 128

Query: 123 DLCEEEGQERGVDKDDAQSYASDKGLLFHEVSAKTGKGV 161
           DL E        +K    S   ++        A +G+G+
Sbjct: 129 DLPEAMSAAEITEKLGLHS-IRNRPWFIQATCATSGEGL 166

>CAGL0J09064g 892556..893101 highly similar to sp|P11076
           Saccharomyces cerevisiae YDL192w ARF1 or sp|P19146
           Saccharomyces cerevisiae YDL137w ARF2, start by
           similarity
          Length = 181

 Score = 48.1 bits (113), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 37/163 (22%), Positives = 73/163 (44%), Gaps = 17/163 (10%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLKDYNDTVVKFEIWDT 62
           + +++++G    GK++++++       E   +     F  +T++ K+     + F +WD 
Sbjct: 17  EMRILMVGLDGAGKTTVLYKL---KLGEVITTIPTIGFNVETVQYKN-----ISFTVWDV 68

Query: 63  AGQERYKSLAPMYYRNANGALVVYDVTQPDSLVKAQNWVDELKSKVGDED----LVICLV 118
            GQ+R +SL   YYRN  G + V D      + +A+    E+  ++ +ED     V  + 
Sbjct: 69  GGQDRIRSLWRHYYRNTEGVIFVVDSNDRSRIGEAR----EVMQRMLNEDELRNAVWLVF 124

Query: 119 GNKLDLCEEEGQERGVDKDDAQSYASDKGLLFHEVSAKTGKGV 161
            NK DL E        +K    S   ++        A +G+G+
Sbjct: 125 ANKQDLPEAMSAAEITEKLGLHS-IRNRPWFIQATCATSGEGL 166

>Sklu_2354.10 YNL304W, Contig c2354 13851-15119
          Length = 422

 Score = 48.5 bits (114), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 37/122 (30%), Positives = 57/122 (46%), Gaps = 18/122 (14%)

Query: 18  SIVHRFVKDSFDEFRES------------TIGAAFLSQTIKLKDYNDTVVKFEIWDTAGQ 65
           S  H+ +K+  D  ++S            TIG    +  I +   ++   K  +WDTAGQ
Sbjct: 180 STSHQMIKEEPDNQKDSQDPDEIVIDTKTTIGIDIKTSLINI---DNRFFKVIMWDTAGQ 236

Query: 66  ERYK-SLAPMYYRNANGALVVYDVTQPDSLVKAQN-WVDELKSKVGD-EDLVICLVGNKL 122
           ERY+ ++ P  Y+ +NG ++ YD+    S     N W+ E      D       LVGNK+
Sbjct: 237 ERYRNAMIPSLYKGSNGIILTYDICDRASFDSCLNHWLREAIQNCKDLGKTRFYLVGNKI 296

Query: 123 DL 124
           DL
Sbjct: 297 DL 298

>YDL192W (ARF1) [681] chr4 (116322..116867) GTP-binding protein
           involved in assembly of coated vesicles of the secretory
           system, member of the arf family in the ras superfamily
           [546 bp, 181 aa]
          Length = 181

 Score = 46.6 bits (109), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 33/159 (20%), Positives = 70/159 (44%), Gaps = 9/159 (5%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLKDYNDTVVKFEIWDT 62
           + +++++G    GK++++++       E   +     F  +T++ K+     + F +WD 
Sbjct: 17  EMRILMVGLDGAGKTTVLYKL---KLGEVITTIPTIGFNVETVQYKN-----ISFTVWDV 68

Query: 63  AGQERYKSLAPMYYRNANGALVVYDVTQPDSLVKAQNWVDELKSKVGDEDLVICLVGNKL 122
            GQ+R +SL   YYRN  G + V D      + +A+  +  + ++    +    +  NK 
Sbjct: 69  GGQDRIRSLWRHYYRNTEGVIFVVDSNDRSRIGEAREVMQRMLNEDELRNAAWLVFANKQ 128

Query: 123 DLCEEEGQERGVDKDDAQSYASDKGLLFHEVSAKTGKGV 161
           DL E        +K    S   ++        A +G+G+
Sbjct: 129 DLPEAMSAAEITEKLGLHS-IRNRPWFIQATCATSGEGL 166

>ADR094W [1835] [Homologous to ScYDL192W (ARF1) - SH; ScYDL137W
           (ARF2) - SH] complement(878123..878668) [546 bp, 181 aa]
          Length = 181

 Score = 46.2 bits (108), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 26/124 (20%), Positives = 60/124 (48%), Gaps = 8/124 (6%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLKDYNDTVVKFEIWDT 62
           + +++++G    GK++++++       E   +     F  +T++ K+     + F +WD 
Sbjct: 17  EMRILMVGLDGAGKTTVLYKL---KLGEVVTTIPTIGFNVETVEYKN-----ISFTVWDV 68

Query: 63  AGQERYKSLAPMYYRNANGALVVYDVTQPDSLVKAQNWVDELKSKVGDEDLVICLVGNKL 122
            GQ++ + L   Y+RN  G + V D      + +A+  +  + ++    + V+ +  NK 
Sbjct: 69  GGQDKIRPLWRHYFRNTEGIIFVVDSNDRSRIAEAREVLQRMLNEDEIRNAVLLVFANKQ 128

Query: 123 DLCE 126
           DL E
Sbjct: 129 DLPE 132

>KLLA0F05225g 515391..515936 highly similar to sp|P19146
           Saccharomyces cerevisiae YDL137w ARF2 GTP-binding
           protein of the ARF family, start by similarity
          Length = 181

 Score = 45.4 bits (106), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 26/124 (20%), Positives = 60/124 (48%), Gaps = 8/124 (6%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLKDYNDTVVKFEIWDT 62
           + +++++G    GK++++++       E   +     F  +T++ K+     + F +WD 
Sbjct: 17  EMRILMVGLDGAGKTTVLYKL---KLGEVVTTIPTIGFNVETVEYKN-----ISFTVWDV 68

Query: 63  AGQERYKSLAPMYYRNANGALVVYDVTQPDSLVKAQNWVDELKSKVGDEDLVICLVGNKL 122
            GQ++ + L   Y+RN  G + V D      + +A+  +  + ++    + V+ +  NK 
Sbjct: 69  GGQDKIRPLWRHYFRNTEGIIFVVDSNDRARIAEAREVLQRMLNEDEIRNAVLLVFANKQ 128

Query: 123 DLCE 126
           DL E
Sbjct: 129 DLPE 132

>Sklu_1681.2 YDL137W, Contig c1681 2279-2767
          Length = 162

 Score = 45.1 bits (105), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 27/123 (21%), Positives = 59/123 (47%), Gaps = 8/123 (6%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLKDYNDTVVKFEIWDTA 63
            +++++G    GK++I+++       E   +     F  +T++ K+     + F +WD  
Sbjct: 1   MRVLMVGLDGAGKATILYKL---KLGEVVTTIPTIGFNVETVEYKN-----ISFTVWDVG 52

Query: 64  GQERYKSLAPMYYRNANGALVVYDVTQPDSLVKAQNWVDELKSKVGDEDLVICLVGNKLD 123
           GQ++ + L   Y+RN  G + V D      + +A+  +  + ++    + V+ +  NK D
Sbjct: 53  GQDKIRPLWRHYFRNTEGIIFVVDSNDRSRISEAREVLQRMLNEDEIRNAVLLVFANKQD 112

Query: 124 LCE 126
           L E
Sbjct: 113 LPE 115

>Kwal_56.24453
          Length = 181

 Score = 45.4 bits (106), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 26/124 (20%), Positives = 60/124 (48%), Gaps = 8/124 (6%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLKDYNDTVVKFEIWDT 62
           + +++++G    GK++++++       E   +     F  +T++ K+     + F +WD 
Sbjct: 17  EMRILMVGLDGAGKTTVLYKL---KLGEVVTTIPTIGFNVETVEYKN-----ISFTVWDV 68

Query: 63  AGQERYKSLAPMYYRNANGALVVYDVTQPDSLVKAQNWVDELKSKVGDEDLVICLVGNKL 122
            GQ++ + L   Y+RN  G + V D      + +A+  +  + ++    + V+ +  NK 
Sbjct: 69  GGQDKIRPLWRHYFRNTEGIIFVVDSNDRSRISEAREVLQRMLNEDEIRNAVLLVFANKQ 128

Query: 123 DLCE 126
           DL E
Sbjct: 129 DLPE 132

>Kwal_27.11872
          Length = 197

 Score = 45.4 bits (106), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 30/124 (24%), Positives = 59/124 (47%), Gaps = 8/124 (6%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLKDYNDTVVKFEIWDT 62
           Q+ +++LG  + GK++ +    ++     +        + Q +      + ++KF  WD 
Sbjct: 17  QYSILILGLDNAGKTTFLEMLKREYSKSGKAPDKITPTVGQNVATVPVGNCLLKF--WDV 74

Query: 63  AGQERYKSLAPMYYRNANGALVVYDVTQPDSLVKAQNWVDELKSKVGDED---LVICLVG 119
            GQE  ++L P YY+ A+G + V D    + L +       L++ V DED   + + ++ 
Sbjct: 75  GGQESLRALWPEYYKQAHGIIFVIDSADRERLDEC---CQTLRTIVMDEDVEGIPVLMLA 131

Query: 120 NKLD 123
           NK D
Sbjct: 132 NKQD 135

>CAGL0M03817g complement(431237..432664) weakly similar to sp|P48559
           Saccharomyces cerevisiae YNL304w YPT11, hypothetical
           start
          Length = 475

 Score = 46.2 bits (108), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 28/97 (28%), Positives = 49/97 (50%), Gaps = 8/97 (8%)

Query: 33  ESTIGAAFLSQTIKLKDYNDTVVKFEIWDTAGQERYK-SLAPMYYRNANGALVVYDVTQP 91
           ++TIG    +  I +   ++ +    +WDTAGQERY+ ++ P  Y+ +N  ++ YD+T  
Sbjct: 237 KTTIGVDIKTNIINI---DNRIFNCILWDTAGQERYRNAIMPSLYKKSNAIILSYDITDK 293

Query: 92  DSLVKA-QNWVDELKSKVGDEDL---VICLVGNKLDL 124
            S   + ++W+ E        D        +GNK DL
Sbjct: 294 CSFKNSYEHWLVEAMGHFAARDYEKARFYFIGNKTDL 330

>Kwal_56.24462
          Length = 181

 Score = 44.7 bits (104), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 29/128 (22%), Positives = 62/128 (48%), Gaps = 16/128 (12%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLKDYNDTVVKFEIWDT 62
           + +++++G    GK++++++       E   +     F  +T++ K+     + F +WD 
Sbjct: 17  EMRILMVGLDGAGKTTVLYKL---KLGEVVTTIPTIGFNVETVEYKN-----ISFTVWDV 68

Query: 63  AGQERYKSLAPMYYRNANGALVVYDVTQPDSLVKAQNWVDELKSKVGDEDLV----ICLV 118
            GQ++ + L   YYRN  G + V D      + +A+    E+  ++ +ED +    + + 
Sbjct: 69  GGQDKIRPLWRHYYRNTEGIIFVVDSNDRSRISEAR----EVLQRMLNEDEIRNASLLVF 124

Query: 119 GNKLDLCE 126
            NK DL E
Sbjct: 125 ANKQDLPE 132

>CAGL0E05896g
           join(complement(585178..585202),
           complement(584348..584892)) highly similar to sp|P20606
           Saccharomyces cerevisiae YPL218w SAR1 GTP-binding
           protein of the ARF family
          Length = 189

 Score = 43.5 bits (101), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 31/119 (26%), Positives = 58/119 (48%), Gaps = 8/119 (6%)

Query: 5   KLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLKDYNDTVVKFEIWDTAG 64
           KL+ LG  + GK++++H    D     R +T+   +   + +L   N   +KF  +D  G
Sbjct: 24  KLLFLGLDNAGKTTLLHMLKND-----RLATLQPTWHPTSEELAIGN---IKFTTFDLGG 75

Query: 65  QERYKSLAPMYYRNANGALVVYDVTQPDSLVKAQNWVDELKSKVGDEDLVICLVGNKLD 123
             + + L   Y+   NG + + D   PD   +A+  +D L +    +D+   ++GNK+D
Sbjct: 76  HVQARRLWKDYFPEVNGIVFLVDSADPDRFDEARVELDALFNITELKDVPFVILGNKID 134

>YPL218W (SAR1) [5231] chr16 (138697..138724,138864..139408)
           Component of COPII coat of vesicles involved in
           endoplasmic reticulum to Golgi transport, GTP-binding
           protein of the arf family in the ras superfamily [573
           bp, 190 aa]
          Length = 190

 Score = 42.4 bits (98), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 30/119 (25%), Positives = 58/119 (48%), Gaps = 8/119 (6%)

Query: 5   KLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLKDYNDTVVKFEIWDTAG 64
           KL+ LG  + GK++++H    D     R +T+   +   + +L   N   +KF  +D  G
Sbjct: 25  KLLFLGLDNAGKTTLLHMLKND-----RLATLQPTWHPTSEELAIGN---IKFTTFDLGG 76

Query: 65  QERYKSLAPMYYRNANGALVVYDVTQPDSLVKAQNWVDELKSKVGDEDLVICLVGNKLD 123
             + + L   Y+   NG + + D   P+   +A+  +D L +    +D+   ++GNK+D
Sbjct: 77  HIQARRLWKDYFPEVNGIVFLVDAADPERFDEARVELDALFNIAELKDVPFVILGNKID 135

>Scas_706.2*
          Length = 190

 Score = 42.0 bits (97), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 30/119 (25%), Positives = 56/119 (47%), Gaps = 8/119 (6%)

Query: 5   KLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLKDYNDTVVKFEIWDTAG 64
           KL+ LG  + GK++++H    D     R +T+   +   + +L   N   +KF  +D  G
Sbjct: 25  KLLFLGLDNAGKTTLLHMLKND-----RLATLQPTWHPTSEELAIGN---IKFTTFDLGG 76

Query: 65  QERYKSLAPMYYRNANGALVVYDVTQPDSLVKAQNWVDELKSKVGDEDLVICLVGNKLD 123
             + + L   Y+   NG + + D   P+   +A   +D L      +D+   ++GNK+D
Sbjct: 77  HIQARRLWKDYFPEVNGIVFLVDAADPERFHEAYVELDALFKIAELKDVPFVILGNKID 135

>Scas_503.2
          Length = 527

 Score = 42.0 bits (97), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 39/117 (33%), Positives = 54/117 (46%), Gaps = 24/117 (20%)

Query: 24  VKDSFDEFRE------STIGAAFLSQTIKL--KDYNDTVVKFEIWDTAGQERYKS-LAPM 74
            K SFD+  E       TIG    S  + +  K YN        WD AGQ+R+K+ +   
Sbjct: 235 AKASFDDREEMIIDTRPTIGIDIKSTLVNIQGKKYNCI-----FWDPAGQDRFKNVMMDS 289

Query: 75  YYRNANGALVVYDVTQPDSLVKAQN----WVDELKSKVGDEDLV---ICLVGNKLDL 124
            Y+ +N  ++ YD+    +L   QN    W++E    V   DL      LVGNKLDL
Sbjct: 290 LYKISNAIILCYDIC---NLTSFQNCCRYWLNETLENVRSGDLSEIKFYLVGNKLDL 343

>Scas_567.9
          Length = 199

 Score = 40.8 bits (94), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 46/189 (24%), Positives = 83/189 (43%), Gaps = 27/189 (14%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKD------SFDEFRESTIGAAFLSQTIKLKDYNDTVVK 56
           Q+ +++LG  + GK++ +    K+        D+    T+G    + ++   + N  ++K
Sbjct: 17  QYSILILGLDNAGKTTFLETCKKEFNLNSKPLDKI-TPTVGQNVATISV---ENNKKLLK 72

Query: 57  FEIWDTAGQERYKSLAPMYYRNANGALVVYDVTQPDSLVKAQNWVDELKSKVGD------ 110
           F  WD  GQE  +S+   YY   +G + V D T        ++ +DE    +G       
Sbjct: 73  F--WDVGGQENLRSMWSEYYSQCHGIIFVVDSTD-------RSRIDECSKTLGKIVMDDE 123

Query: 111 -EDLVICLVGNKLDLCEE-EGQERGVDKDDAQSYASDKGLLFHEVSAKTGKGVSNIFQEI 168
            E + I ++ NK D+ E  E Q+     +    + S +      VSA TG+GV +    +
Sbjct: 124 VEGVPILMLANKQDMPERMEVQDIKEIFNQIAEHLSARDSRVLPVSALTGEGVKDAIDWM 183

Query: 169 GEKLYLQKK 177
             +L   KK
Sbjct: 184 TLRLERNKK 192

>Kwal_47.18241
          Length = 230

 Score = 40.4 bits (93), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 29/122 (23%), Positives = 60/122 (49%), Gaps = 7/122 (5%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLKDYNDTVVKFEIWDT 62
           Q  +V++G  + GK+S+    +   F++    T+G      T+ L      +V+  I+D 
Sbjct: 4   QLNIVIVGLQNSGKTSLTRALLSKPFEQDTIPTLGMRMEQFTMGLN-----IVR--IFDL 56

Query: 63  AGQERYKSLAPMYYRNANGALVVYDVTQPDSLVKAQNWVDELKSKVGDEDLVICLVGNKL 122
           AGQ R++ L   Y+  A+  + V D+    +  + +  V ++      + + + ++GNK+
Sbjct: 57  AGQYRFQHLWDRYFDRADLIIYVIDLADQTNWAECKEAVRKVIVDTNRDCIPMLILGNKI 116

Query: 123 DL 124
           DL
Sbjct: 117 DL 118

>YPL051W (ARL3) [5389] chr16 (459958..460554) ADP-ribosylation
           factor-like protein, member of the arf-sar family in the
           ras superfamily [597 bp, 198 aa]
          Length = 198

 Score = 40.0 bits (92), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 46/186 (24%), Positives = 85/186 (45%), Gaps = 22/186 (11%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDSFDEFR-----ESTIGAAFLSQTIKLKDYNDTVVKF 57
           Q+ +++LG  + GK++ +    K+    F+     + T+G    +  +  K     ++KF
Sbjct: 17  QYSILILGLDNAGKTTFLETLKKEYSLAFKALEKIQPTVGQNVATIPVDSKQ----ILKF 72

Query: 58  EIWDTAGQERYKSLAPMYYRNANGALVVYDVTQPDSLVKAQNWVDELKSKVGDEDL---V 114
             WD  GQE  +S+   YY   +G + + D +  + L +       L+S V DE++    
Sbjct: 73  --WDVGGQESLRSMWSEYYSLCHGIIFIVDSSDRERLDECST---TLQSVVMDEEIEGVP 127

Query: 115 ICLVGNK---LDLCEEEGQERGVDKDDAQSYASDKGLLFHEVSAKTGKGVSNIFQEIGEK 171
           I ++ NK    D  E +  +   +K      A D  +L   +SA TG+GV +  + +  +
Sbjct: 128 ILMLANKQDRQDRMEVQDIKEVFNKIAEHISARDSRVL--PISALTGEGVKDAIEWMIVR 185

Query: 172 LYLQKK 177
           L   KK
Sbjct: 186 LERNKK 191

>KLLA0B02046g 178646..179218 highly similar to sp|P20606
           Saccharomyces cerevisiae YPL218w SAR1 GTP-binding
           protein of the ARF family, start by similarity
          Length = 190

 Score = 39.7 bits (91), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 29/119 (24%), Positives = 57/119 (47%), Gaps = 8/119 (6%)

Query: 5   KLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLKDYNDTVVKFEIWDTAG 64
           KL+ LG  + GK++++H    D     R +T+   +   + +L   N   +KF  +D  G
Sbjct: 25  KLLFLGLDNAGKTTLLHMLKND-----RLATLQPTWHPTSEELAIGN---IKFTTFDLGG 76

Query: 65  QERYKSLAPMYYRNANGALVVYDVTQPDSLVKAQNWVDELKSKVGDEDLVICLVGNKLD 123
             + + L   Y+   NG + + D   P+   +A+  +D L      +++   ++GNK+D
Sbjct: 77  HLQARRLWKDYFPEVNGIVFLVDAADPERFNEARIELDALFQIKELDNVPFAVLGNKID 135

>Sklu_2202.6 YBR164C, Contig c2202 5407-5958
          Length = 183

 Score = 38.5 bits (88), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 30/124 (24%), Positives = 53/124 (42%), Gaps = 14/124 (11%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLKDYNDTVVKFEIWDT 62
           + ++++LG    GK++I++R       E   +     F  +T+  K+     +K  +WD 
Sbjct: 18  ELRILILGLDGAGKTTILYRL---QIGEVVTTKPTIGFNVETLTYKN-----LKLNVWDL 69

Query: 63  AGQERYKSLAPMYYRNANGALVVYDVTQPDSLVKAQNWVDELKSKVGDEDL---VICLVG 119
            GQ   +     YY N    + V D T  D +  A     EL   + +E+L    + +  
Sbjct: 70  GGQTSIRPYWRCYYANTAAVIFVVDSTDKDRMSTASK---ELHMMLQEEELQDAALLVFA 126

Query: 120 NKLD 123
           NK D
Sbjct: 127 NKQD 130

>CAGL0L12826g complement(1370767..1371366) highly similar to
           tr|Q02804 Saccharomyces cerevisiae YPL051w
           ADP-ribosylation factor-like protein, start by
           similarity
          Length = 199

 Score = 38.1 bits (87), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 43/186 (23%), Positives = 82/186 (44%), Gaps = 19/186 (10%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKD------SFDEFRESTIGAAFLSQTIKLKDYNDTVVK 56
           Q+ +++LG  + GK++ +    K+        D+    T+G    +  +   D N +++K
Sbjct: 17  QYSILILGLDNAGKTTFLETLKKEYSMHSKPLDKI-APTVGQNVATIPV---DNNRSILK 72

Query: 57  FEIWDTAGQERYKSLAPMYYRNANGALVVYDVTQPDSLVKAQNWVDELKSKVGD---EDL 113
           F  WD  GQ   +++   YY   +G + V D T    + +     + L++ V D   E +
Sbjct: 73  F--WDVGGQASLRAMWSEYYPQCHGIIFVVDSTDRSRIDECS---ETLRTIVMDDEIEGI 127

Query: 114 VICLVGNKLDLCEE-EGQERGVDKDDAQSYASDKGLLFHEVSAKTGKGVSNIFQEIGEKL 172
            I ++ NK D  E  E Q+     +    + S +      V A TG+G+ +  + +  +L
Sbjct: 128 PILMLANKQDKPERMEVQDIKEIFNRIAEHMSARDSRVLPVCALTGEGIKDSIEWMILRL 187

Query: 173 YLQKKD 178
              K D
Sbjct: 188 QRNKND 193

>AGL261W [4051] [Homologous to ScYPL051W (ARL3) - SH]
           complement(218211..218807) [597 bp, 198 aa]
          Length = 198

 Score = 37.7 bits (86), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 35/117 (29%), Positives = 56/117 (47%), Gaps = 13/117 (11%)

Query: 53  TVVKFEIWDTAGQERYKSLAPMYYRNANGALVVYDVTQPDSLVKAQNWVDELKSKVGD-- 110
           T++KF  WD  GQE  +++   YY   +G + + D T  + L   Q   D L+S V D  
Sbjct: 68  TLLKF--WDVGGQEALRAMWSEYYVQTHGIIFIIDSTDRERL---QECCDSLRSIVTDDG 122

Query: 111 -EDLVICLVGNKLDL---CEEEGQERGVDKDDAQSYASDKGLLFHEVSAKTGKGVSN 163
            E + I ++ NK D     E    ++  +K      A D  +L   +SA TG+G+ +
Sbjct: 123 VEGVPILMLANKQDREDKMELHDIKQVFNKLALHLEARDSRVL--PISALTGEGIQS 177

>AGR221W [4532] [Homologous to ScYBR164C (ARL1) - SH]
           complement(1164831..1165382) [552 bp, 183 aa]
          Length = 183

 Score = 37.4 bits (85), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 29/124 (23%), Positives = 54/124 (43%), Gaps = 14/124 (11%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLKDYNDTVVKFEIWDT 62
           + ++++LG    GK++I++R       E   +     F  +T+  ++     +K  +WD 
Sbjct: 18  ELRILILGLDGAGKTTILYRL---QVGEVVTTKPTIGFNVETLTYRN-----LKLNVWDL 69

Query: 63  AGQERYKSLAPMYYRNANGALVVYDVTQPDSLVKAQNWVDELKSKVGDEDL---VICLVG 119
            GQ   +     YY N    + V D T  D +  A     EL + + +E+L    + +  
Sbjct: 70  GGQTSIRPYWRCYYANTAAVIFVVDSTDKDRMGVAAR---ELHTMLQEEELQDAALLVFA 126

Query: 120 NKLD 123
           NK D
Sbjct: 127 NKQD 130

>KLLA0E24805g 2194554..2195105 highly similar to sp|P38116
           Saccharomyces cerevisiae YBR164c ARL1 ADP-ribosylation
           factor, start by similarity
          Length = 183

 Score = 37.0 bits (84), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 22/92 (23%), Positives = 40/92 (43%), Gaps = 8/92 (8%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLKDYNDTVVKFEIWDT 62
           + ++++LG    GK++I++R       E   +     F  +T+  K+     +K  +WD 
Sbjct: 18  ELRILILGLDGAGKTTILYRL---QIGEVITTKPTIGFNVETLNYKN-----LKLNVWDL 69

Query: 63  AGQERYKSLAPMYYRNANGALVVYDVTQPDSL 94
            GQ   +     YY N    + V D T  D +
Sbjct: 70  GGQTSIRPYWRCYYANTAAVIFVVDSTDKDRM 101

>KLLA0F17072g complement(1566668..1567240) similar to sp|P39110
           Saccharomyces cerevisiae YMR138w CIN4 GTP-binding
           protein, start by similarity
          Length = 190

 Score = 37.0 bits (84), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 32/140 (22%), Positives = 73/140 (52%), Gaps = 18/140 (12%)

Query: 5   KLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLKDYNDTVVKFEIWDTAG 64
           +++LLG  + GK++++++ + +  D+  + TIG  F  +T+KL +        ++WD  G
Sbjct: 18  RVLLLGLDNSGKTTVLNQLLNEPIDKI-QPTIG--FQIKTLKLSNK-----VLQMWDIGG 69

Query: 65  QERYKSLAPMYYRNANGALVVYDVTQPDSLVKAQNWVDELKSKVGDEDLV-----ICLVG 119
           Q+  +     Y+   +  + V D+   + L+++   ++E+   V + D +     + ++ 
Sbjct: 70  QKTLRPFWFNYFEKTDYLIWVIDILD-NRLMESLTLLEEI---VQENDRINLQFEVFILL 125

Query: 120 NKLDLCEEEGQERGVDKDDA 139
           NK+DL   +G   G++ DD 
Sbjct: 126 NKIDLL-PKGNGNGLNDDDT 144

>Kwal_56.24149
          Length = 149

 Score = 35.8 bits (81), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 19/69 (27%), Positives = 36/69 (52%)

Query: 55  VKFEIWDTAGQERYKSLAPMYYRNANGALVVYDVTQPDSLVKAQNWVDELKSKVGDEDLV 114
           +KF  +D  G  + + L   Y+   NG + + D   P+ L +A+  +D L +    +D+ 
Sbjct: 26  IKFTTFDLGGHIQARRLWKDYFPEVNGIVFLVDAADPERLNEARVELDALFNIAELKDVP 85

Query: 115 ICLVGNKLD 123
             ++GNK+D
Sbjct: 86  FVILGNKID 94

>KLLA0C13387g complement(1142002..1142637) similar to sp|P01119
           Saccharomyces cerevisiae YOR101w RAS1 GTP-binding
           protein, start by similarity
          Length = 211

 Score = 36.2 bits (82), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 30/96 (31%), Positives = 44/96 (45%), Gaps = 6/96 (6%)

Query: 71  LAPMYYRNANGALVVYDVTQPDSLVKAQNWVDELKSKVGDEDLV-ICLVGNKLDLCEEEG 129
           +   Y R   G L+VY VT   S  +   +  ++  +V D D V + ++GNK DL +   
Sbjct: 1   MREQYMRTGEGFLLVYSVTSKTSFEELMTYYQQIL-RVKDSDYVPVFVIGNKSDLED--- 56

Query: 130 QERGVDKDDAQSYASDKGLLFHEVSAKTGKGVSNIF 165
            ER V  ++ Q+ A      F E SAK    V   F
Sbjct: 57  -ERQVSYEEGQTLAKQFDAPFLETSAKQNINVEESF 91

>YBR164C (ARL1) [350] chr2 complement(567832..568383) GTP-binding
           protein of the arf-sar family in the ras superfamily,
           possibly involved in signal transduction, and plays a
           role in membrane trafficking [552 bp, 183 aa]
          Length = 183

 Score = 35.8 bits (81), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 29/124 (23%), Positives = 53/124 (42%), Gaps = 14/124 (11%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLKDYNDTVVKFEIWDT 62
           + ++++LG    GK++I++R       E   +     F  +T+  K+     +K  +WD 
Sbjct: 18  ELRILILGLDGAGKTTILYRL---QIGEVVTTKPTIGFNVETLSYKN-----LKLNVWDL 69

Query: 63  AGQERYKSLAPMYYRNANGALVVYDVTQPDSLVKAQNWVDELKSKVGDEDL---VICLVG 119
            GQ   +     YY +    + V D T  D +  A     EL   + +E+L    + +  
Sbjct: 70  GGQTSIRPYWRCYYADTAAVIFVVDSTDKDRMSTASK---ELHLMLQEEELQDAALLVFA 126

Query: 120 NKLD 123
           NK D
Sbjct: 127 NKQD 130

>CAGL0I10835g 1060258..1060809 highly similar to sp|P38116
           Saccharomyces cerevisiae YBR164c ADP-ribosylation
           factor, start by similarity
          Length = 183

 Score = 35.8 bits (81), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 29/124 (23%), Positives = 53/124 (42%), Gaps = 14/124 (11%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLKDYNDTVVKFEIWDT 62
           + ++++LG    GK++I++R       E   +     F  +T+  K+     +K  +WD 
Sbjct: 18  ELRILILGLDGAGKTTILYRL---QIGEVVTTKPTIGFNVETLTYKN-----LKLNVWDL 69

Query: 63  AGQERYKSLAPMYYRNANGALVVYDVTQPDSLVKAQNWVDELKSKVGDEDL---VICLVG 119
            GQ   +     YY +    + V D T  D +  A     EL   + +E+L    + +  
Sbjct: 70  GGQTSIRPYWRCYYADTAAVIFVVDSTDKDRMSTASK---ELHLMLQEEELQDAALLVFA 126

Query: 120 NKLD 123
           NK D
Sbjct: 127 NKQD 130

>KLLA0F02662g 241804..242565 some similarities with sp|Q8VEH3 Mus
           musculus Hypothetical 21.4 kDa protein, hypothetical
           start
          Length = 253

 Score = 35.8 bits (81), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 28/137 (20%), Positives = 67/137 (48%), Gaps = 6/137 (4%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLKDYNDTVVKFEIWDT 62
           Q  + ++G  + GK++  +    + F      T+G     + +KL ++ +     +++D 
Sbjct: 23  QLSIAVVGLQNSGKTTFTNLIAGEEFVVDTIPTLGVNI--KDVKLPNHTN----LKVYDL 76

Query: 63  AGQERYKSLAPMYYRNANGALVVYDVTQPDSLVKAQNWVDELKSKVGDEDLVICLVGNKL 122
           AGQ R++ L    ++  +  + + D++   +  +A+N + ++      E + I ++GNK+
Sbjct: 77  AGQTRFQKLWDRCFQQVDLLVFMIDLSDLTNWEQAKNKLHDVIIATNLEHVPILILGNKV 136

Query: 123 DLCEEEGQERGVDKDDA 139
           DL  +  ++  V K D 
Sbjct: 137 DLIPKFHRDLYVAKSDV 153

>Scas_700.11
          Length = 183

 Score = 35.4 bits (80), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 29/124 (23%), Positives = 53/124 (42%), Gaps = 14/124 (11%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLKDYNDTVVKFEIWDT 62
           + ++++LG    GK++I++R       E   +     F  +T+  K+     +K  +WD 
Sbjct: 18  ELRILILGLDGAGKTTILYRL---QIGEVVTTKPTIGFNVETLTYKN-----LKLNVWDL 69

Query: 63  AGQERYKSLAPMYYRNANGALVVYDVTQPDSLVKAQNWVDELKSKVGDEDL---VICLVG 119
            GQ   +     YY +    + V D T  D +  A     EL   + +E+L    + +  
Sbjct: 70  GGQTSIRPYWRCYYADTAAVIFVVDSTDKDRMGTASK---ELHLMLQEEELQDAALLVFA 126

Query: 120 NKLD 123
           NK D
Sbjct: 127 NKQD 130

>ADR402W [2142] [Homologous to ScYAL048C - SH]
           complement(1426900..1428885) [1986 bp, 661 aa]
          Length = 661

 Score = 33.9 bits (76), Expect = 0.087,   Method: Compositional matrix adjust.
 Identities = 51/206 (24%), Positives = 84/206 (40%), Gaps = 35/206 (16%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLKDYNDTVVKFEIWDTA 63
           F   +LG  + GKSS++  F+   F E    TI       +++LK        + I    
Sbjct: 446 FNCYILGKPNSGKSSLLESFLGRPFSETYSPTIRPKIAVNSLELKGGKQY---YLILQEF 502

Query: 64  GQERYKSLAPMYYRNANGAL------VVYDVTQPDS---LVKAQNWVDELKSKVGDEDLV 114
           GQ+      P    N    +      + YD + P+S   LV   N    LK+      L 
Sbjct: 503 GQQE-----PAILENQQKVMECDVLCLAYDSSDPESFSYLVNLVNRYQHLKA------LP 551

Query: 115 ICLVGNKLDLCEEEGQERGVDKDDAQSYASDKGLLFHEVSAKTGKGVSNIFQEIGEKLYL 174
           +  V  K DL +++ Q   V  DD     +++ LL H +       +S ++     +L++
Sbjct: 552 MVFVALKADL-DKQQQRCNVQPDD----FTEQLLLEHPLH------ISCMWPSSLNELFI 600

Query: 175 QKKD-SLEAASQTRHVVNVELQRPTT 199
           +  D +LE A  T  +V   +Q  TT
Sbjct: 601 KLTDVALEPAKNTPELVPEPIQEDTT 626

 Score = 30.0 bits (66), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 19/68 (27%), Positives = 33/68 (48%), Gaps = 3/68 (4%)

Query: 3  QFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLKDY---NDTVVKFEI 59
          + ++V+ GD  VGKSS++   VKD F    +  + A  + +      Y   N  +V  + 
Sbjct: 5  RIRIVVCGDKGVGKSSLIACLVKDQFIPNLQDALPAVTIPRDFSASPYSPQNTILVDTKN 64

Query: 60 WDTAGQER 67
           D AG ++
Sbjct: 65 SDLAGLQK 72

>AFL114W [3081] [Homologous to ScYPL218W (SAR1) - SH]
           complement(222754..223326) [573 bp, 190 aa]
          Length = 190

 Score = 33.1 bits (74), Expect = 0.094,   Method: Compositional matrix adjust.
 Identities = 27/119 (22%), Positives = 55/119 (46%), Gaps = 8/119 (6%)

Query: 5   KLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLKDYNDTVVKFEIWDTAG 64
           KL+ LG  + GK++++H    D     R +T+   +   + +L   +   +KF  +D  G
Sbjct: 25  KLLFLGLDNAGKTTLLHMLKND-----RLATLQPTWHPTSEELAIGS---IKFTTFDLGG 76

Query: 65  QERYKSLAPMYYRNANGALVVYDVTQPDSLVKAQNWVDELKSKVGDEDLVICLVGNKLD 123
             + + L   Y+   NG + + D    +   +A+  +D L      + +   ++GNK+D
Sbjct: 77  HIQARRLWKDYFPEVNGIVFLVDAADSERFNEARVELDALFQIPELKTVPFVILGNKID 135

>KLLA0E12837g 1135181..1135780 similar to sgd|S0005972 Saccharomyces
           cerevisiae YPL051w ARL3 ADP-ribosylation factor-like
           protein, member of the arf-sar family in the ras
           superfamily, start by similarity
          Length = 199

 Score = 33.1 bits (74), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 41/78 (52%), Gaps = 5/78 (6%)

Query: 52  DTVVKFEIWDTAGQERYKSLAPMYYRNANGALVVYDVTQPDSLVKAQNWVDELKSKVGDE 111
           DT   ++I D +GQE ++ L   Y+   N   +VY V   DS  + Q  ++EL+++  + 
Sbjct: 65  DTHHIWKIIDVSGQESFRYLWDSYFNKDNIHGIVYMVDTSDS-DRLQESINELQARYVNT 123

Query: 112 ----DLVICLVGNKLDLC 125
               D+ I +V NK D C
Sbjct: 124 PAAVDIPIAVVLNKTDQC 141

>Sklu_2411.4 YMR023C, Contig c2411 8898-10388
          Length = 496

 Score = 33.5 bits (75), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 36/135 (26%), Positives = 63/135 (46%), Gaps = 23/135 (17%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLKDYNDTVV-----KFE 58
            KLVLLG  + GKSS+++    D      E++I ++    T   +D  D  +     K  
Sbjct: 248 IKLVLLGPPNAGKSSLLNSLTND------ETSIVSSIPGTT---RDSIDVPIDVNGYKVV 298

Query: 59  IWDTAG-------QERYKSLAPMYYRNANGALVVYDVTQPDSLVKAQNWVDELKSKVGDE 111
           + DTAG       Q   + +     +++   LVV  V   + L    +  D +KS++ D+
Sbjct: 299 LCDTAGIRKNSSDQIELQGIRRAKMKSSQSDLVVLLVDASNELYITDDLKDHIKSQLRDK 358

Query: 112 DLVICLVGNKLDLCE 126
           +++I +  NK DL +
Sbjct: 359 NIIIVV--NKSDLVD 371

>CAGL0E06292g 633135..634361 some similarities with sp|P01119
           Saccharomyces cerevisiae YOR101w RAS1, start by
           similarity
          Length = 408

 Score = 33.5 bits (75), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 29/161 (18%), Positives = 69/161 (42%), Gaps = 32/161 (19%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDSF----------DEFRESTIGAAF------------ 40
            F++++LGD  VGK+S++ +++ D++          D +R+     +F            
Sbjct: 20  NFRIMVLGDPKVGKTSMIMQWLTDNYRSGDEATYSDDIYRKKIPYYSFRLLNDKGLIAEK 79

Query: 41  ------LSQTIKLKDYNDTVVKFEIWDTAGQ---ERYKS-LAPMYYRNANGALVVYDVTQ 90
                 L  + + +  N  ++K EI D       E Y + L  +  + ++  ++ +D   
Sbjct: 80  DVIDFNLDNSHRFQYTNKDLIKLEILDANIHDISEYYSNELRSLQVKQSDAIVICFDGKS 139

Query: 91  PDSLVKAQNWVDELKSKVGDEDLVICLVGNKLDLCEEEGQE 131
             +    + + + +K  +G+E + + +   K+D   E+  E
Sbjct: 140 QTTFEHVREYYNTIKDALGEEQIPVVICNTKIDYLMEDKVE 180

>KLLA0E07634g 688734..690239 similar to sp|P32559 Saccharomyces
           cerevisiae YMR023c MSS1 mitochondrial GTPase involved in
           expression of COX1 singleton, start by similarity
          Length = 501

 Score = 32.3 bits (72), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 42/179 (23%), Positives = 80/179 (44%), Gaps = 32/179 (17%)

Query: 4   FKLVLLGDSSVGKSSIVHRF--------------VKDSFDEFRESTIGAAFLSQTIKLKD 49
            KL LLG+ + GKSS+V+                 +DS D   +       L+ T  ++ 
Sbjct: 257 IKLTLLGEPNSGKSSLVNEISQDDVAIVSDIPGTTRDSIDVMMDINGFKCILTDTAGIRQ 316

Query: 50  YNDTVVKFEIWDTAGQERYKSLAPMYYRNANGALVVYDVTQPDSLVKAQNWVDELKSKVG 109
                ++ +  D   + + KSL       ++  ++V DV+ P+    ++++ + +K  + 
Sbjct: 317 GTSDSIEIKGID---RSKKKSL------QSDLVVLVIDVSNPNI---SKHFEEFIKDNLS 364

Query: 110 DEDLVICLVGNKLDLCEEEGQERGVDKDDAQSYASDKGLLFHEVSAKTGKGVSNIFQEI 168
           D+ L++ L  NK DL  E   +  ++K DA+     K L  H VS  T  G+  + + +
Sbjct: 365 DKPLIVVL--NKSDLATETQLKYLIEKFDAEF----KALKIHTVSCLTKIGLEPLVKTL 417

>Sklu_1358.1 YMR138W, Contig c1358 536-1192
          Length = 218

 Score = 32.0 bits (71), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 32/130 (24%), Positives = 62/130 (47%), Gaps = 12/130 (9%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDSFDEFR-ESTIGAAFLSQTIKLKDYNDTVVKFEIWD 61
           + + ++LG  + GKS++V   ++      R   T+G  F   TI+   +N      ++WD
Sbjct: 42  ELRSLVLGLDNSGKSTVVDWLLERGEKRSRITPTVG--FRIHTIEYAGHN-----VQLWD 94

Query: 62  TAGQERYKSLAPMYYRNANGALVVYDVTQPDSLVKAQNWVDEL---KSKVGDEDLVICLV 118
             GQ   +     Y+   +  L V DVT      ++   +++L   + ++G    +I L+
Sbjct: 95  IGGQRTLRPFWDNYFDKTDVLLWVIDVTARSRFSESFAELEKLLQDRDRLGYRCKMIVLL 154

Query: 119 GNKLDLCEEE 128
            NK+DL +E+
Sbjct: 155 -NKMDLIDED 163

>Sklu_1689.1 YHR022C, Contig c1689 285-1358 reverse complement
          Length = 357

 Score = 32.0 bits (71), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 25/98 (25%), Positives = 44/98 (44%), Gaps = 1/98 (1%)

Query: 68  YKSLAPMYYRNANGALVVYDVTQPDSLVKAQNWVDELKSKVGDEDLVICLVGNKLDLCEE 127
           Y  +  +  + A+G ++ YD T  +SL   + +   +    G E + + L GNK D+  E
Sbjct: 136 YSEMRNIQTQQADGFILCYDSTNEESLDNLRMYQRRIWMLRG-EGVPLLLCGNKCDMGTE 194

Query: 128 EGQERGVDKDDAQSYASDKGLLFHEVSAKTGKGVSNIF 165
                G+ ++    +  D      E SAK   GV+ +F
Sbjct: 195 RKVNLGMVRELCDEFQVDFKTCHFETSAKDNFGVNELF 232

>Scas_680.21
          Length = 183

 Score = 31.6 bits (70), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 19/89 (21%), Positives = 38/89 (42%), Gaps = 5/89 (5%)

Query: 3  QFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLKDYNDTVVKFEIWDT 62
          + K ++LG  + GKS++V++ + +      E T    F     ++ ++N       +WD 
Sbjct: 16 ELKCLILGLDNSGKSTLVNKLLPEEERSQVEITPTIGF-----QIVNFNHGGYTISMWDI 70

Query: 63 AGQERYKSLAPMYYRNANGALVVYDVTQP 91
           GQ   +     Y+      +   DV+ P
Sbjct: 71 GGQTTLRPFWDNYFDKMEALVWCVDVSAP 99

>Kwal_26.6810
          Length = 664

 Score = 31.6 bits (70), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 22/70 (31%), Positives = 32/70 (45%), Gaps = 7/70 (10%)

Query: 3  QFKLVLLGDSSVGKSSIVHRFVKDSF-----DEFRESTIGAAFLSQTIKLKDYNDTVVKF 57
          Q K+V+ GD  VGK+S++   +KD F     D     TI   F S  +  K     +V  
Sbjct: 5  QIKIVVCGDDGVGKTSLIAALLKDQFILNLQDSLPPVTIPQYFSSSPVCPK--KSVLVDT 62

Query: 58 EIWDTAGQER 67
            +D  G +R
Sbjct: 63 TSYDLPGLQR 72

>YAL048C (YAL048C) [19] chr1 complement(52804..54792) Protein
           involved in the secretory pathway, has weak similarity
           to GTP-binding proteins of the RAS superfamily [1989 bp,
           662 aa]
          Length = 662

 Score = 31.2 bits (69), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 37/170 (21%), Positives = 74/170 (43%), Gaps = 14/170 (8%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLKDYNDTVVKFEIWDTA 63
           F   ++G    GKSS++  F+  SF E    TI       +++LK        + I    
Sbjct: 449 FNCFVIGKPCCGKSSLLEAFLGRSFSEEYSPTIKPRIAVNSLELKGGKQY---YLILQEL 505

Query: 64  GQERYKSLAPM-YYRNANGALVVYDVTQPDSLVKAQNWVDELKSKVGDEDLVICLVGNKL 122
           G++ Y  L      +  +   + YD + P+S     + +D+       +DL +  V +K 
Sbjct: 506 GEQEYAILENKDKLKECDVICLTYDSSDPESFSYLVSLLDKFTHL---QDLPLVFVASKA 562

Query: 123 DLCEEEGQERGVDKDDAQSYASDKGLLFH--EVSAKTGKGVSNIFQEIGE 170
           DL +++ Q   +  D+     +D+  + H   +S++    ++ +F +I E
Sbjct: 563 DL-DKQQQRCQIQPDE----LADELFVNHPLHISSRWLSSLNELFIKITE 607

>KLLA0E11638g 1028781..1029998 some similarities with sp|P01120
           Saccharomyces cerevisiae YNL098c RAS2 GTP-binding
           protein, hypothetical start
          Length = 405

 Score = 30.8 bits (68), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 20/83 (24%), Positives = 38/83 (45%), Gaps = 5/83 (6%)

Query: 68  YKSLAPMYYRNANGALVVYDVTQPDSLVKAQNWVDELKSKVGDEDLVICLVGNKLDLCEE 127
           Y  L  +    A+G ++ YD T P +L     +   + +++  +D+ I + G K+D    
Sbjct: 139 YSDLRHLQVNQADGFILCYDTTNPATLADMTLY-HRIITRIKGDDVPIIVCGTKIDCI-- 195

Query: 128 EGQERGVDKDDAQSYASDKGLLF 150
              ER V +D+      + G+ F
Sbjct: 196 --SERKVSEDEVIGLCEEMGVDF 216

>Scas_698.27
          Length = 701

 Score = 30.8 bits (68), Expect = 0.92,   Method: Compositional matrix adjust.
 Identities = 27/102 (26%), Positives = 47/102 (46%), Gaps = 18/102 (17%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDS----FDEFR-------ESTIGAA--FLSQTIKLK-- 48
              V+LG+ S GKS+I+ R ++DS     DE R       +S + A   +LS+ ++ K  
Sbjct: 271 LNFVMLGNESAGKSTIIGRLLEDSGLVRIDEIRSVKKELEKSKLNAEMLYLSKLMEKKMS 330

Query: 49  ---DYNDTVVKFEIWDTAGQERYKSLAPMYYRNANGALVVYD 87
                +  V +F  +D  G  ++ S +    R    A++  D
Sbjct: 331 STFSLDKNVSEFSAFDIPGDLKHLSSSIKAIRQCTTAILTID 372

>KLLA0A03465g complement(314573..316552) similar to sp|P39722
          Saccharomyces cerevisiae YAL048c vacuolar aspartic
          proteasse singleton, start by similarity
          Length = 659

 Score = 29.6 bits (65), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 12/26 (46%), Positives = 19/26 (73%)

Query: 3  QFKLVLLGDSSVGKSSIVHRFVKDSF 28
          + ++V+ GDS VGK+S++   VKD F
Sbjct: 5  RIRIVVCGDSGVGKTSLIACLVKDQF 30

>Scas_721.90
          Length = 397

 Score = 28.5 bits (62), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 11/45 (24%), Positives = 25/45 (55%)

Query: 2  LQFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIK 46
          +QF L+LLG++ +GK++ ++       +   ++ +    LS  I+
Sbjct: 27 IQFNLLLLGETGIGKTTFLNNLCNQVIENDNDTQVNVNPLSNNIE 71

>CAGL0G09977g 951295..955881 similar to sp|Q06625 Saccharomyces
           cerevisiae YPR184w GDB1, hypothetical start
          Length = 1528

 Score = 28.9 bits (63), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 25/85 (29%), Positives = 39/85 (45%), Gaps = 6/85 (7%)

Query: 78  NANGALVVYDVTQPDSLVKAQNWVDELKSKVGDEDLVICLVGNKLDLCEEEGQERGVDKD 137
           +A G++  YD   P  L    + V E ++    E+  I  V   L+   EE     VD +
Sbjct: 695 SAIGSVYGYDEVFPQLL----DLVQEKRTYSCAENTGISKVKTLLNNMREEIASEAVDIE 750

Query: 138 DAQSYASDKG--LLFHEVSAKTGKG 160
           D++ +    G  + FH  +AK GKG
Sbjct: 751 DSEMHVHHDGQYITFHRTNAKNGKG 775

>Kwal_55.21150
          Length = 454

 Score = 28.5 bits (62), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 14/36 (38%), Positives = 21/36 (58%), Gaps = 4/36 (11%)

Query: 114 VICLVGNKLDLCE----EEGQERGVDKDDAQSYASD 145
           +IC V NK+   +    EE +ERG+D+D    +A D
Sbjct: 385 IICFVINKIPGLQLRASEEAEERGLDEDQIGEFAYD 420

>Kwal_34.15979
          Length = 728

 Score = 28.5 bits (62), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 14/46 (30%), Positives = 26/46 (56%)

Query: 154 SAKTGKGVSNIFQEIGEKLYLQKKDSLEAASQTRHVVNVELQRPTT 199
           +AK    V+ + +EI  ++Y Q  +S++ + Q  +V  V+L  P T
Sbjct: 244 AAKYSCPVTPLLEEIRNEIYTQPFESIDFSKQKNNVCGVDLYYPHT 289

>Kwal_26.8439
          Length = 1146

 Score = 28.5 bits (62), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 22/69 (31%), Positives = 37/69 (53%), Gaps = 2/69 (2%)

Query: 132 RGVDKDDAQSYASDKGLLFHEVSAKTGKGVSNIFQEIGEKLYLQKKDSL--EAASQTRHV 189
           R +   DAQ  ASD   ++    A+      N+  E+ ++LYLQ K+S   ++ S T  +
Sbjct: 838 RPLAYSDAQLIASDHKPVYAAYRAQVNFIDENVKMELTKQLYLQYKESHPEDSDSATLAL 897

Query: 190 VNVELQRPT 198
           V+VE ++ T
Sbjct: 898 VDVEYEQKT 906

>YLL013C (PUF3) [3406] chr12 complement(122074..124713) Protein
           involved in metabolism of COX17 mRNA, has eight
           Pumilio-homology domains [2640 bp, 879 aa]
          Length = 879

 Score = 28.1 bits (61), Expect = 5.9,   Method: Composition-based stats.
 Identities = 11/37 (29%), Positives = 25/37 (67%)

Query: 117 LVGNKLDLCEEEGQERGVDKDDAQSYASDKGLLFHEV 153
           + G+ L+ C+++   R + ++ A S AS+K ++F+E+
Sbjct: 539 IFGHSLEFCKDQHGSRFIQRELATSPASEKEVIFNEI 575

>CAGL0D05544g complement(527482..530217) similar to tr|Q07807
           Saccharomyces cerevisiae YLL013c transcript-specific
           regulator of mRNA degradation, hypothetical start
          Length = 911

 Score = 28.1 bits (61), Expect = 6.3,   Method: Composition-based stats.
 Identities = 13/54 (24%), Positives = 33/54 (61%), Gaps = 1/54 (1%)

Query: 101 VDELKSKVGDEDLVI-CLVGNKLDLCEEEGQERGVDKDDAQSYASDKGLLFHEV 153
           ++EL++   + DL +  + G+ L+ C+++   R + K+ A +   ++ L+F+E+
Sbjct: 551 LEELRANPTNTDLTLKSIYGHALEFCKDQHGSRFIQKELATAPPPERELVFNEI 604

>YMR023C (MSS1) [3987] chr13 complement(319436..321016)
           Mitochondrial GTPase involved in expression of COX1/OXI3
           [1581 bp, 526 aa]
          Length = 526

 Score = 27.7 bits (60), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 13/23 (56%), Positives = 16/23 (69%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKD 26
            KLVLLG  +VGKSS+V+    D
Sbjct: 275 IKLVLLGAPNVGKSSLVNSLTND 297

>Scas_525.5
          Length = 252

 Score = 27.3 bits (59), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 24/81 (29%), Positives = 36/81 (44%), Gaps = 4/81 (4%)

Query: 6   LVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLKDYNDTVVKFEIWDTAGQ 65
           + + GD  VGKSS+V    K  F    +  I A  + +      Y  +V +  + DT+  
Sbjct: 26  IAICGDKGVGKSSLVLSLAKGRFLSNLQDVIPAVTIPRDFSSNPY--SVRRTILVDTSEA 83

Query: 66  ERYKSLAPMYYRNANGALVVY 86
           E  K    M  RNA+   +VY
Sbjct: 84  EPEK--LQMELRNADVIWLVY 102

>Sklu_1993.2 YIL130W, Contig c1993 2139-4610 reverse complement
          Length = 823

 Score = 27.7 bits (60), Expect = 9.0,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 34/62 (54%), Gaps = 7/62 (11%)

Query: 142 YASDKGLLF--HEVSAKTGKGVSNIFQ-----EIGEKLYLQKKDSLEAASQTRHVVNVEL 194
           + S  G++F  HEV+    +      Q     E+G+K+ LQ KD+  AA++T +++N   
Sbjct: 533 FFSVAGMIFYIHEVTPTDEESSREYEQVVKDTELGKKVLLQLKDASMAANRTYNILNQLF 592

Query: 195 QR 196
           +R
Sbjct: 593 ER 594

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.315    0.132    0.373 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 6,841,511
Number of extensions: 293471
Number of successful extensions: 1210
Number of sequences better than 10.0: 219
Number of HSP's gapped: 991
Number of HSP's successfully gapped: 221
Length of query: 207
Length of database: 16,596,109
Length adjustment: 97
Effective length of query: 110
Effective length of database: 13,238,163
Effective search space: 1456197930
Effective search space used: 1456197930
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 59 (27.3 bits)