Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Sklu_2225.679779740290.0
KLLA0E09790g74670216660.0
Kwal_14.205773375515000.0
YER001W (MNN1)76268514240.0
Kwal_23.29265684977502e-89
YIL014W (MNT3)6306346581e-75
Kwal_55.209846194906333e-72
KLLA0D13376g6636356268e-71
YGL257C (MNT2)5584366022e-68
Kwal_55.222385845125893e-66
Kwal_23.54545834995718e-64
CAGL0C04048g6206855721e-63
YNR059W (MNT4)5805115672e-63
AEL345W6456145704e-63
Scas_717.56396345512e-60
AAR183C6485465476e-60
ABR245C6414565362e-58
CAGL0H09240g6425095221e-56
Scas_643.196576575106e-55
AFL235W3813614901e-54
CAGL0C03960g6234974805e-51
CAGL0C03982g6295034781e-50
CAGL0C03938g6374994727e-50
CAGL0C03916g6285064673e-49
CAGL0C04004g6325904663e-49
CAGL0H09262g6255724267e-44
CAGL0C03894g6274954232e-43
ADR020C6046354081e-41
CAGL0G04279g6606413603e-35
CAGL0C04026g6364723353e-32
KLLA0A11880g4232513113e-30
KLLA0A11891g2022152575e-25
CAGL0B03003g3402882508e-23
Kwal_33.136935582631355e-08
Kwal_56.227796951921204e-06
AER018C6063021178e-06
CAGL0M02871g600273980.001
KLLA0C16467g607153940.004
AEL148W573277940.004
Scas_576.9507273850.049
CAGL0I04532g612286830.076
Scas_716.77608288810.15
KLLA0E17831g638145810.16
CAGL0G09867g64475760.62
Sklu_2306.4741218741.1
KLLA0F24574g711160731.2
Kwal_56.2311760765712.0
YJL186W (MNN5)586319712.3
AEL082W681146694.3
CAGL0A00869g85184684.8
ABR099C111930685.9
YBR015C (MNN2)597149667.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Sklu_2225.6
         (797 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Sklu_2225.6 YER001W, Contig c2225 7299-9692                          1556   0.0  
KLLA0E09790g 867899..870139 similar to sp|P39106 Saccharomyces c...   646   0.0  
Kwal_14.2057                                                          582   0.0  
YER001W (MNN1) [1423] chr5 (153519..155807) Alpha-1,3-mannosyltr...   553   0.0  
Kwal_23.2926                                                          293   2e-89
YIL014W (MNT3) [2651] chr9 (326101..327993) Mannosyltransferase ...   258   1e-75
Kwal_55.20984                                                         248   3e-72
KLLA0D13376g 1150858..1152849 some similarities with sp|P40549 S...   245   8e-71
YGL257C (MNT2) [1743] chr7 complement(12481..14157) Mannosyltran...   236   2e-68
Kwal_55.22238                                                         231   3e-66
Kwal_23.5454                                                          224   8e-64
CAGL0C04048g complement(399734..401596) similar to sp|P40549 Sac...   224   1e-63
YNR059W (MNT4) [4642] chr14 (736800..738542) Protein with strong...   223   2e-63
AEL345W [2160] [Homologous to ScYIL014W (MNT3) - NSH] complement...   224   4e-63
Scas_717.5                                                            216   2e-60
AAR183C [371] [Homologous to ScYIL014W (MNT3) - NSH] (672091..67...   215   6e-60
ABR245C [839] [Homologous to ScYIL014W (MNT3) - NSH] (854585..85...   211   2e-58
CAGL0H09240g complement(905670..907598) some similarities with s...   205   1e-56
Scas_643.19                                                           201   6e-55
AFL235W [2960] [Homologous to ScYIL014W (MNT3) - NSH; ScYER001W ...   193   1e-54
CAGL0C03960g complement(389250..391121) similar to sp|P40549 Sac...   189   5e-51
CAGL0C03982g complement(391909..393798) similar to sp|P40549 Sac...   188   1e-50
CAGL0C03938g complement(386673..388586) weakly similar to sp|P40...   186   7e-50
CAGL0C03916g complement(383989..385875) weakly similar to sp|P40...   184   3e-49
CAGL0C04004g complement(394614..396512) similar to sp|P40549 Sac...   184   3e-49
CAGL0H09262g complement(908258..910135) similar to sp|P40549 Sac...   168   7e-44
CAGL0C03894g complement(381514..383397) weakly similar to sp|P40...   167   2e-43
ADR020C [1761] [Homologous to ScYIL014W (MNT3) - SH] (740415..74...   161   1e-41
CAGL0G04279g complement(404144..406126) weakly similar to sp|P40...   143   3e-35
CAGL0C04026g complement(397303..399213) weakly similar to sp|P40...   133   3e-32
KLLA0A11880g 1026919..1028190 some similarities with ca|CA0854|I...   124   3e-30
KLLA0A11891g 1028064..1028672 similar to sp|P53059 Saccharomyces...   103   5e-25
CAGL0B03003g 295997..297019 some similarities with sp|P40549 Sac...   100   8e-23
Kwal_33.13693                                                          57   5e-08
Kwal_56.22779                                                          51   4e-06
AER018C [2523] [Homologous to ScYBR015C (MNN2) - SH] (661035..66...    50   8e-06
CAGL0M02871g 324009..325811 similar to sp|P46982 Saccharomyces c...    42   0.001
KLLA0C16467g 1442002..1443825 weakly similar to sp|P46982 Saccha...    41   0.004
AEL148W [2358] [Homologous to ScYJL186W (MNN5) - SH] complement(...    41   0.004
Scas_576.9                                                             37   0.049
CAGL0I04532g 404659..406497 similar to sp|P38069 Saccharomyces c...    37   0.076
Scas_716.77                                                            36   0.15 
KLLA0E17831g complement(1572985..1574901) some similarities with...    36   0.16 
CAGL0G09867g complement(942215..944149) similar to sp|Q06623 Sac...    34   0.62 
Sklu_2306.4 , Contig c2306 6263-8488 reverse complement                33   1.1  
KLLA0F24574g complement(2285387..2287522) weakly similar to sp|P...    33   1.2  
Kwal_56.23117                                                          32   2.0  
YJL186W (MNN5) [2738] chr10 (80153..81913) Mannosyltransferase r...    32   2.3  
AEL082W [2424] [Homologous to ScYBR015C - NSH] complement(474072...    31   4.3  
CAGL0A00869g 87841..90396 similar to sp|Q06163 Saccharomyces cer...    31   4.8  
ABR099C [690] [Homologous to ScYMR047C (NUP116) - SH; ScYKL068W ...    31   5.9  
YBR015C (MNN2) [208] chr2 complement(267672..269465) Mannosyltra...    30   7.8  

>Sklu_2225.6 YER001W, Contig c2225 7299-9692
          Length = 797

 Score = 1556 bits (4029), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 753/797 (94%), Positives = 753/797 (94%)

Query: 1   MVEKKECLAGHAHLVLNASPASYGFPRHNCCRYPMSAISRPLHFMRRNSQNKLAVFRSKR 60
           MVEKKECLAGHAHLVLNASPASYGFPRHNCCRYPMSAISRPLHFMRRNSQNKLAVFRSKR
Sbjct: 1   MVEKKECLAGHAHLVLNASPASYGFPRHNCCRYPMSAISRPLHFMRRNSQNKLAVFRSKR 60

Query: 61  VIQXXXXXXXXXXXXXPYLKQSGYGSHPILKNVPSYSELTESIKSSHHDDISKLRIKPID 120
           VIQ             PYLKQSGYGSHPILKNVPSYSELTESIKSSHHDDISKLRIKPID
Sbjct: 61  VIQLVVLLVLVVVAALPYLKQSGYGSHPILKNVPSYSELTESIKSSHHDDISKLRIKPID 120

Query: 121 QVPVSPLEVVPDYDLDVSRNRKASWNFINKNKKYKHFNELDLQTRCHFYFRTLYNMNAKW 180
           QVPVSPLEVVPDYDLDVSRNRKASWNFINKNKKYKHFNELDLQTRCHFYFRTLYNMNAKW
Sbjct: 121 QVPVSPLEVVPDYDLDVSRNRKASWNFINKNKKYKHFNELDLQTRCHFYFRTLYNMNAKW 180

Query: 181 SNDHHLYTFDINEEIEGEKLKDMSDKDGVSLVNKESLGLHKRLHDISLALERMRIYDECF 240
           SNDHHLYTFDINEEIEGEKLKDMSDKDGVSLVNKESLGLHKRLHDISLALERMRIYDECF
Sbjct: 181 SNDHHLYTFDINEEIEGEKLKDMSDKDGVSLVNKESLGLHKRLHDISLALERMRIYDECF 240

Query: 241 IQNDSVDFEGIFTNXXXXXXXXXXXXXXQKRXXXXXXXXXXXXXXXXXDQTEYYKNFDQW 300
           IQNDSVDFEGIFTN              QKR                 DQTEYYKNFDQW
Sbjct: 241 IQNDSVDFEGIFTNKKDDLGVDVDKVSKQKRSSINFNGGGGTNGELSGDQTEYYKNFDQW 300

Query: 301 DLENRMFPFLKYYTHENFTNMMPILTSPNGSQLATGWFPIHNRKTGVAESFEQHKYDKSK 360
           DLENRMFPFLKYYTHENFTNMMPILTSPNGSQLATGWFPIHNRKTGVAESFEQHKYDKSK
Sbjct: 301 DLENRMFPFLKYYTHENFTNMMPILTSPNGSQLATGWFPIHNRKTGVAESFEQHKYDKSK 360

Query: 361 SFWWNWNAISRKTAKRGIVISLGNGQVDYGIKLLATLRFQGNKLPIQVIHKGDLSEDSVR 420
           SFWWNWNAISRKTAKRGIVISLGNGQVDYGIKLLATLRFQGNKLPIQVIHKGDLSEDSVR
Sbjct: 361 SFWWNWNAISRKTAKRGIVISLGNGQVDYGIKLLATLRFQGNKLPIQVIHKGDLSEDSVR 420

Query: 421 KLTDVAQAAEFDIPPNSFDNTTDVKQELWFVDVSTTLNPSVINEFDRFKNKWLAVVFNLF 480
           KLTDVAQAAEFDIPPNSFDNTTDVKQELWFVDVSTTLNPSVINEFDRFKNKWLAVVFNLF
Sbjct: 421 KLTDVAQAAEFDIPPNSFDNTTDVKQELWFVDVSTTLNPSVINEFDRFKNKWLAVVFNLF 480

Query: 481 DEFVFIDVDAISYVSIEDYFETSEYKDSGTVFFKDRSLGYGSDAKCFAVFSTLMPKALES 540
           DEFVFIDVDAISYVSIEDYFETSEYKDSGTVFFKDRSLGYGSDAKCFAVFSTLMPKALES
Sbjct: 481 DEFVFIDVDAISYVSIEDYFETSEYKDSGTVFFKDRSLGYGSDAKCFAVFSTLMPKALES 540

Query: 541 KYFQSFSMIDDDYVFDQCHKYLTPEEKIFKNFFENNHQHQMESGLVAIDKSQHIMPLVIS 600
           KYFQSFSMIDDDYVFDQCHKYLTPEEKIFKNFFENNHQHQMESGLVAIDKSQHIMPLVIS
Sbjct: 541 KYFQSFSMIDDDYVFDQCHKYLTPEEKIFKNFFENNHQHQMESGLVAIDKSQHIMPLVIS 600

Query: 601 TILNMSKKIGGCGHGDKEFFWLGFMVSGHRYSFYDVEAAAVGKLIEKESEDKLRQEQRSE 660
           TILNMSKKIGGCGHGDKEFFWLGFMVSGHRYSFYDVEAAAVGKLIEKESEDKLRQEQRSE
Sbjct: 601 TILNMSKKIGGCGHGDKEFFWLGFMVSGHRYSFYDVEAAAVGKLIEKESEDKLRQEQRSE 660

Query: 661 ICNIQLAHMSYDDHLLWLNGGSQNCKFDVAEDDWNNEKFGFTKNYNNVEELKKEYASFLE 720
           ICNIQLAHMSYDDHLLWLNGGSQNCKFDVAEDDWNNEKFGFTKNYNNVEELKKEYASFLE
Sbjct: 661 ICNIQLAHMSYDDHLLWLNGGSQNCKFDVAEDDWNNEKFGFTKNYNNVEELKKEYASFLE 720

Query: 721 VEHAVIPTEKGGGWGKIDGRCKGYVWCARYSSYIKEYTYSNRVNIGKLVKFDEEEKKYID 780
           VEHAVIPTEKGGGWGKIDGRCKGYVWCARYSSYIKEYTYSNRVNIGKLVKFDEEEKKYID
Sbjct: 721 VEHAVIPTEKGGGWGKIDGRCKGYVWCARYSSYIKEYTYSNRVNIGKLVKFDEEEKKYID 780

Query: 781 SLNKIWWKASTDSILKR 797
           SLNKIWWKASTDSILKR
Sbjct: 781 SLNKIWWKASTDSILKR 797

>KLLA0E09790g 867899..870139 similar to sp|P39106 Saccharomyces
           cerevisiae YER001w MNN1 alpha-1, 3-mannosyltransferase,
           start by similarity
          Length = 746

 Score =  646 bits (1666), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 313/702 (44%), Positives = 449/702 (63%), Gaps = 28/702 (3%)

Query: 90  LKNVPSYSELTESIKSSHHDDISKLRIKPIDQVPVSPLEVVPDYDLDVSRNRKASWNFIN 149
           L   PS SEL           +S ++IKPI++ PVSPLE++PD ++   +   ASW+ + 
Sbjct: 59  LSQEPSLSEL-----------MSNVKIKPIEETPVSPLELIPDIEISTRKKYDASWDLLF 107

Query: 150 KNKKYKHFNELDLQTRCHFYFRTLYNMNAKWSNDHHLYTFDINEEIEGEKLKDMSDKDGV 209
           + +KYK FN+ DL T+C FYF+ LYN+N  W+N+   +TFDIN+     K+  + D DGV
Sbjct: 108 RGRKYKSFNDYDLHTKCEFYFQNLYNLNEDWTNNIRTFTFDINDVDTSTKIDALKDSDGV 167

Query: 210 SLVNKESLGLHKRLHDISLALERMRIYDECFIQ---NDSVDFEGIFTNXXXXXXXXXXXX 266
            LV+++++ L+KR H+++LA ER+R+YD+CF+    ++ +  + +F +            
Sbjct: 168 QLVDEKAIRLYKRTHNVALATERLRLYDKCFVNSPGSNPLKMDHLFRSNKKSKTTALDDE 227

Query: 267 XXQKRXXXXXXXXXXXXXXXXXDQTEYYKNFDQWDLENRMFPFLKYYTHENFTNMMPILT 326
               R                   T  ++ +DQWD E+RMFP + Y+   NFTN+MPI T
Sbjct: 228 VTGNRDTFTKTKKTSFLSDM---DTSSFQKYDQWDFEHRMFPMIPYFEEHNFTNVMPIFT 284

Query: 327 SPNGSQ-LATGWFPIHNRKTGVAESFEQHKYDKSKSFWWNWNAISRKTAKRGIVISLGNG 385
             NG + L  G FP+ + K+G     E  +YDKSKS W NWN +S  + KRGI+++ G+G
Sbjct: 285 GSNGGEPLPQGKFPVLDPKSGELLRVETFRYDKSKSLWKNWNDMSSASGKRGIILAAGDG 344

Query: 386 QVDYGIKLLATLRFQGNKLPIQVIHKGDLSEDSVRKLTDVAQAAEFDIPPNSFDNTTDVK 445
           QVD  I+L+ATLR QGN LPIQ+IH   L+E SV+ L++ A++ EF         ++   
Sbjct: 345 QVDQCIRLIATLRAQGNALPIQIIHNNQLNEKSVKLLSEAAKSTEF---------SSGRA 395

Query: 446 QELWFVDVSTTLNPSVINEFDRFKNKWLAVVFNLFDEFVFIDVDAISYVSIEDYFETSEY 505
           Q LW V+V  TL  S+ + F RFKNKWL+V+FN F+EF+FID DAISY+++ DYF   EY
Sbjct: 396 QSLWLVNVGPTLESSMKSNFGRFKNKWLSVIFNTFEEFIFIDTDAISYINMADYFNFKEY 455

Query: 506 KDSGTVFFKDRSLGYGSDAKCFAVFSTLMPKALESKYFQSFSMIDDDYVFDQCHKYLTPE 565
           K +GT+FFKDRSL  G++ KC  +F TL P+ LE  YF +  MI+ DYV  QC   LTPE
Sbjct: 456 KSTGTLFFKDRSLAIGTEQKCGPLFETLEPRILEMYYFNTLPMINGDYVEQQCMGMLTPE 515

Query: 566 EKIFKNFFENNHQHQMESGLVAIDKSQHIMPLVISTILNMSKKIGGCGHGDKEFFWLGFM 625
           EK++K FFE  HQH +ESGL+AI+K++HIM LV +T+LN++ K+GGCG GDKEFFWLG +
Sbjct: 516 EKVYKRFFEVGHQHNLESGLLAINKNEHIMGLVTATVLNIAPKVGGCGWGDKEFFWLGLL 575

Query: 626 VSGHRYSFYDVEAAAVGKLIEKESEDKLRQEQRSEICNIQLAHMSYDDHLLWLNGGSQNC 685
           V+G RYS YD++A+A+G   +K+S     +     IC++Q+AH SYD HLLW+NGGSQ C
Sbjct: 576 VAGQRYSIYDIDASAIGVPQQKQSIANGDEFDEYRICSLQVAHTSYDGHLLWINGGSQYC 635

Query: 686 -KFDVAEDDWNNEKFGFTKNYNNVEELKKEYASFLEVEHAVIPTEKGGGWGKIDGRCKGY 744
            K +  E DW N K       ++ E+  K Y+  ++VE A++P  +  GWG+ D RCKGY
Sbjct: 636 KKPETFEGDWTNIKELRESYSDDKEKALKAYSDTVKVEAAIVPDSRSNGWGRDDQRCKGY 695

Query: 745 VWCARYSSYIKEYTYSNRVNIGKLVKFDEEEKKYIDSLNKIW 786
            WC +++S +K YTY+  V  G L++F +EE + I  +NKIW
Sbjct: 696 FWCGKFTSKLKPYTYNTVVTKGDLIRFGDEEIESISKINKIW 737

>Kwal_14.2057
          Length = 733

 Score =  582 bits (1500), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 288/755 (38%), Positives = 448/755 (59%), Gaps = 43/755 (5%)

Query: 36  SAISRPLHFMRRNSQNKLAVFRSKRVIQXXXXXXXXXXXXXPYLKQSGYGS-HPILKNVP 94
           + + R LH  R      + +   + +++              Y++ + YG    I K  P
Sbjct: 10  ALVRRALHSARVTKLPAVRLPSVRLIVRIVGPIVVIAAFVMLYVESTKYGQLAKIAKVAP 69

Query: 95  SYSELTESIKSSHHDDISKLR--IKPIDQVPVSPLEVVPDYDLDVSRNRKASWNFINKNK 152
             +  T S  SS HD    L+  +  +  +  SPLE +  Y+ ++ + RKASW+F+ +N 
Sbjct: 70  ELNGATYSEPSSSHDAYGFLKGELPHVTGIAFSPLERIKTYNENMEKKRKASWDFLGRNN 129

Query: 153 KYKHFNELDLQTRCHFYFRTLYNMNAKWSNDHHLYTFDINEEIEGEKLKDMSDKDGVSLV 212
           ++K F++L  +++C+FYF  LY +N KW N++  + F +N+E E E+L  +++       
Sbjct: 130 RFKKFDDLSEESQCYFYFHNLYEINPKWENNYSKWGFIVNDE-EEERLSTVAED------ 182

Query: 213 NKESLGLHKRLHDISLALERMRIYDECFIQNDSVDFEGIFTNXXXXXXXXXXXXXXQKRX 272
            KE++   KR +DI+L LERMR+Y+ CF+     D   +F+N                  
Sbjct: 183 TKEAIRSRKRENDIALGLERMRMYETCFLDRKDADMSKMFSNIR---------------- 226

Query: 273 XXXXXXXXXXXXXXXXDQTEYYKNFDQWDLENRMFPFLKYYTHENFTNMMPILTSPNGSQ 332
                           +    + +F QWD E RM+PF++ +  ++F+ ++P  TSP+G  
Sbjct: 227 ----------------NSGNSFSSFTQWDFEKRMWPFIREFDKKSFSELIPHFTSPDGVA 270

Query: 333 LATGWFPIHNRKTGVAESFEQHKYDKSKSFWWNWNAISRKTAKRGIVISLGNGQVDYGIK 392
           L  G  P     +   +   +++Y++ +SF WNWN +S   A++GIV+S G+GQ+ +  +
Sbjct: 271 LEAGHLPPLGHSSDYIKKAIKYEYNEKRSFMWNWNHMSSLVAQKGIVLSFGDGQLKHASR 330

Query: 393 LLATLRFQGNKLPIQVIHKGDLSEDSVRKLTDVAQAAEFDIPPNSFDNTTDVKQELWFVD 452
           L+A LR+ GNKLP+QV+HKGDLSE S++ L  +AQ+ +   P   ++   +VKQELWFVD
Sbjct: 331 LIAHLRYIGNKLPLQVVHKGDLSEGSIKALQKIAQSDDITFPETDYEGGQNVKQELWFVD 390

Query: 453 VSTTLNPSVINEFDRFKNKWLAVVFNLFDEFVFIDVDAISYVSIEDYFETSEYKDSGTVF 512
           VS TL+P +   F RFKNKWLA  FNLF+EF+ IDVD + YV +E YF + EY+ +GT+F
Sbjct: 391 VSPTLDPVMAGSFTRFKNKWLATSFNLFEEFILIDVDTVHYVDLEQYFHSVEYQHTGTLF 450

Query: 513 FKDRSLGYGSDAKCFAVFSTLMPKALESKYFQSFSMIDDDYVFDQCHKYLTPEEKIFKNF 572
           F+DR      +  C A+  TL P  LES YF  + M+D DY+   C K L P  K+ K++
Sbjct: 451 FRDRYSSEKVEEICPAMIETLPPNILESYYFGHYRMVDLDYIERMCEKDLAPNTKVIKSY 510

Query: 573 FENNHQHQMESGLVAIDKSQHIMPLVISTILNMSKKIGGCGHGDKEFFWLGFMVSGHRYS 632
           F +N +HQM+SGLVA++K  HI+PL++S +L+M+ K+G C +GDKEFFWLGF   GH ++
Sbjct: 511 FIDNLRHQMDSGLVAVNKKSHIVPLMLSAMLHMTDKLGSCSYGDKEFFWLGFYAMGHNFA 570

Query: 633 FYDVEAAAVGKLIEKESEDKLRQEQRSEICNIQLAHMSYDDHLLWLNGGSQNCKF-DVAE 691
           F D+ A AVG   E+++ +   ++++SEIC I +AH+S + +LLW NGG++ CKF D AE
Sbjct: 571 FSDMPAGAVGIQKEEKNVNHHLKQKKSEICTIIIAHLSTEGNLLWANGGAEYCKFEDAAE 630

Query: 692 DDWNNEKFGFTKNYNNVEELKKEYASFLEVEHAVIPTEKGGGWGKIDGRCKGYVWCARYS 751
           DDW NEK      Y+++EELK  Y S + V+  ++P +K G WG  DGRC+GY +CARY 
Sbjct: 631 DDWKNEKLNMQSKYSSLEELKSLYKSSVSVKSGIVPMDKQGAWGSQDGRCRGYSYCARYE 690

Query: 752 SYIKEYTYSNRVNIGKLVKFDEEEKKYIDSLNKIW 786
            +IK Y+++     G L+ F  +     D++NK+W
Sbjct: 691 RHIKPYSFNKMYEKGFLIDFHPDLTTKYDAINKVW 725

>YER001W (MNN1) [1423] chr5 (153519..155807)
           Alpha-1,3-mannosyltransferase, required for complex
           glycosylation of both N- and O-oligosaccharides [2289
           bp, 762 aa]
          Length = 762

 Score =  553 bits (1424), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 279/685 (40%), Positives = 430/685 (62%), Gaps = 23/685 (3%)

Query: 116 IKPIDQVPVSPLEVVPDYDLDVSRNRKASWNFINKNKKYKHFNELDLQTRCHFYFRTLYN 175
           + P+D +PVSPLE+VP YD  +   R +SW  INK   YKHFNEL L  RC FYFRTLY 
Sbjct: 74  VDPVDTIPVSPLELVPFYDQSIDTKRSSSW-LINKKGYYKHFNELSLTDRCKFYFRTLYT 132

Query: 176 MNAKWSNDHHLYTFDINEEIEGEKLKDMSDKDGVSLVNKESLGLHKRLHDISLALERMRI 235
           ++ +W+N      + IN+    E + +  D +G + ++++S  L++R +D+  A ER+R 
Sbjct: 133 LDDEWTNSVKKLEYSIND---NEGVDEGKDANG-NPMDEKSERLYRRKYDMFQAFERIRA 188

Query: 236 YDECFIQNDSVDFEGIFTNXXXXXXXXXXXXXXQKRXXXXXXXXXXXXXXXXXDQTEYYK 295
           YD CF+Q + V+ + IF                 K                  D  + +K
Sbjct: 189 YDRCFMQANPVNIQEIFPKSDKM----------SKERVQSKLIKTLNATFPNYD-PDNFK 237

Query: 296 NFDQWDLENRMFPFLKYYTHENFTNMMPILTSPNGSQLATGWFPIHNRKTGVAESFEQHK 355
            +DQ++ E++MFPF+  +T E F  M+P +TSP G  L  G+ P  + KTG  + + +++
Sbjct: 238 KYDQFEFEHKMFPFINNFTTETFHEMVPKITSPFGKVLEQGFLPKFDHKTGKVQEYFKYE 297

Query: 356 YDKSKSFWWNWNAISRKTAKRGIVISLGNGQVDYGIKLLATLRFQGNKLPIQVIHKGD-L 414
           YD SK+FW NW  +S K A RGIV+SLG+ Q    +K +A+LRF+GN LPIQV+++GD L
Sbjct: 298 YDPSKTFWANWRDMSAKVAGRGIVLSLGSNQFPLAVKFIASLRFEGNTLPIQVVYRGDEL 357

Query: 415 SEDSVRKLTDVAQAAEFDIPPNSFDNTTDVKQELWFVDVSTTLNPSVINEFDRFKNKWLA 474
           S++ V KL   A++ +F    N++DN+T+V QE+WF+DVS T++P    +F  +K+KWL 
Sbjct: 358 SQELVDKLIYAARSPDFKPVENNYDNSTNVPQEIWFLDVSNTIHPKWRGDFGSYKSKWLV 417

Query: 475 VVFNLFDEFVFIDVDAISYVSIEDYFETSEYKDSGTVFFKDRSLGYGSDAKCFAVFSTLM 534
           V+ NL  EFVF+D+DAISY  I++YF+T+EY+ +GTVF+++R+L    + +C A + TL+
Sbjct: 418 VLLNLLQEFVFLDIDAISYEKIDNYFKTTEYQKTGTVFYRERALRENVNERCIARYETLL 477

Query: 535 PKALESKYFQSFSMIDDDYVFDQCHKYLTPEEKIFKNFFENNHQHQMESGLVAIDKSQHI 594
           P+ LESK FQ+  +ID D+  ++C   LT EE IFK FF +  QHQ+E+GL A+DKS+H 
Sbjct: 478 PRNLESKNFQNSLLIDPDHALNECDNTLTTEEYIFKAFFHHRRQHQLEAGLFAVDKSKHT 537

Query: 595 MPLVISTILNMSKKIGGCGHGDKEFFWLGFMVSGHRYSFYDVEAAAVGKLIEKESEDKLR 654
           +PLV++ +++++K    C HGDKE FWLGF+ +GH Y+   V + A+G  ++K   +  R
Sbjct: 538 IPLVLAAMIHLAKNTAHCTHGDKENFWLGFLAAGHTYALQGVYSGAIGDYVKKTDLNGKR 597

Query: 655 QEQRSEICNIQLAHMSYDDH-LLWLNGGSQNCKFD-VAEDDW--NNEKFGFTKNYNNVEE 710
           QE   EIC+ Q+AHMS D   LLW+NGG   CK D  A+DDW  + +   F   +   EE
Sbjct: 598 QEAAVEICSGQIAHMSTDKKTLLWVNGGGTFCKHDNAAKDDWKKDGDFKKFKDQFKTFEE 657

Query: 711 LKK-EYASFLEVEHAVIPTEKGGGWGKID-GRCKGYVWCARYSSYIKEYTYSNRVNIGKL 768
           ++K  Y + +  ++ ++P  K   W +   G C GY+WCA + + +K Y+Y++R   G+L
Sbjct: 658 MEKYYYITPISSKYVILPDPKSDDWHRASAGACGGYIWCATHKTLLKPYSYNHRTTHGEL 717

Query: 769 VKFDEEEKKYIDSLNKIWWKASTDS 793
           +  DEE++ +ID++N +W  A+ D+
Sbjct: 718 ITLDEEQRLHIDAVNTVWSHANKDN 742

>Kwal_23.2926
          Length = 568

 Score =  293 bits (750), Expect = 2e-89,   Method: Compositional matrix adjust.
 Identities = 177/497 (35%), Positives = 264/497 (53%), Gaps = 57/497 (11%)

Query: 300 WDLENRMFPFLKYYTHENFTNMMPILTSPNGSQLATGWFPIHNRKTGVAESFEQHKYDKS 359
           +DL+ RM+PFL+      F +   + T+  G  L +            + SF ++KYD S
Sbjct: 114 YDLDKRMYPFLRPGKTPKFQSG-DLKTTYEGGILPS---------MADSGSF-KYKYDYS 162

Query: 360 KSFWWNWNAISR--KTAKRGIVISLGNGQVDYGIKLLATLRFQGNKLPIQVIHKGDLSED 417
            ++  NW  +S   +   RGIV+S  +  V   I+LL  L  Q N+LPIQVIHKGDLSE 
Sbjct: 163 DTWTSNWYRLSSQGREPTRGIVLSFPDSHVSLVIRLLKVLHHQKNELPIQVIHKGDLSEA 222

Query: 418 SVRKLTDVAQAAEFDIPPNSFDNTTDVKQELWFVDVSTTLNPSVINEFDRFKNKWLAVVF 477
           S   +++    +                Q LWFVDVS+ LN   + +F  +KNKWLA++ 
Sbjct: 223 SKNLISEALSPS----------------QNLWFVDVSSMLNKRFVRDFSGYKNKWLAMIL 266

Query: 478 NLFDEFVFIDVDAISYVSIEDYFETSEYKDSGTVFFKDRSLGYGSDAK-CFAVFSTLMPK 536
           N F E VFID DA+S +S EDYFE   Y  +G +FFKDR+  +  D   C  +  +L P 
Sbjct: 267 NTFSEAVFIDADAVSMMSFEDYFEMGLYNQTGALFFKDRAFDHKFDYDFCVPMIKSLQPG 326

Query: 537 ALESKYFQSFSMIDDDYVFDQCHKYLTPEEKIFKNFFENNHQHQMESGLVAIDKSQHIMP 596
             E++YFQ    + D  + +      + E+ I K+FFE   +HQM+SGLV I+K +H+ P
Sbjct: 327 KHETRYFQHRKRLIDLQLRNTQDP--STEQTIIKDFFEGYQRHQMDSGLVLIEKGKHLTP 384

Query: 597 LVISTILNMSKKIGGCGHGDKEFFWLGFMVSGHRYSFYDVEAAAVGKLIEKESEDKLRQE 656
           L+ +  LN++ K+  C HGDKE FWL F++  H +SF+  EA+A+GK            +
Sbjct: 385 LLAAVFLNLAPKLSKCTHGDKETFWLAFLLMNHEFSFHPEEASAIGK-----------AD 433

Query: 657 QRSEICNIQLAHMSYDDHLLWLNGGSQNCKF-DVAEDDWNN-EKFGFTKNYNNVEELKKE 714
           +  EIC++QL H S +  LLW N G + CKF D  E DW+   K      ++++E+ +  
Sbjct: 434 ENGEICSVQLGHTSAEGDLLWFNSGFRTCKFADAIEFDWDGYPKEDLHSRFSSLEDARLF 493

Query: 715 YASFLEVEHAVIPTEKGGGW-GKIDGRCKGYVWCARYSSYIKEYTYSNRVNIGKLVKFDE 773
           Y S  E+E A +P +    W G     C GY +CA+  S             GKLV F+ 
Sbjct: 494 YESLAEIEAAALPNKHLNPWTGGFGDHCLGYRYCAKAGS-----------GYGKLVHFEP 542

Query: 774 EEKKYIDSLNKIWWKAS 790
           + +K +  + ++W  A+
Sbjct: 543 QIQKNLKEIGEVWMNAT 559

>YIL014W (MNT3) [2651] chr9 (326101..327993) Mannosyltransferase
           that adds the final mannose to O-linked oligosaccharide
           chains [1893 bp, 630 aa]
          Length = 630

 Score =  258 bits (658), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 175/634 (27%), Positives = 295/634 (46%), Gaps = 111/634 (17%)

Query: 158 NELDLQTRCHFYFRTLYNMNAKWSNDHHLYTFDINEEIEGEKLKDMSDKDGVSLVNKESL 217
           NE+    +C + F  LY ++  W N      +++               DGV       L
Sbjct: 100 NEIAKSDKCRYIFEVLYKIDPDWDNAQTAKFYNV---------------DGVDNTLASLL 144

Query: 218 GLHKRLHDISLALERMRIYDECFIQNDSVDFEGIFTNXXXXXXXXXXXXXXQKRXXXXXX 277
           G            ER+R YD CF+    +D   IF N                       
Sbjct: 145 G------------ERLRSYDYCFLSGQ-LDPTAIFAN----------------------- 168

Query: 278 XXXXXXXXXXXDQTEYYKNFDQWDLENRMFPFLKYYTHENFTNMMPILTSPNGSQLATGW 337
                               +  DL+NRMFPFLK    E+ T M PI+T      + TG 
Sbjct: 169 -----------------STVNPHDLQNRMFPFLKKINEESKTVMWPIIT-----DMTTG- 205

Query: 338 FPIHNRKTGVAESFEQHKYDKSKSFWWNWNAISRKTAKRGIVISLGNGQVDYGIKLLATL 397
                 +   A   +    + + +FW NWN +S+    RG V+++    V   +K L  +
Sbjct: 206 ------EAVPAPEVDMESSNFNGNFWSNWNRLSKG---RGFVLTIAEKDVPLFLKQLKVM 256

Query: 398 RFQGNKLPIQVIHKG-DLSEDSVRKLTDVAQAAEFDIPPNSFDNTTDVKQELWFVDVSTT 456
            F  N+LP Q++  G +LS +S+ K+++ A+  E               Q ++ VD ST 
Sbjct: 257 EFSKNELPFQIVSTGNELSAESIAKISETAKETE---------------QRVYLVDCSTV 301

Query: 457 LNPSVINEF-DRFKNKWLAVVFNLFDEFVFIDVDAISYVSIEDYFETSEYKDSGTVFFKD 515
           L+ +  N +   F+NKW+A +FN F+E++ +D D + +V  + +F++  Y++SG + FKD
Sbjct: 302 LDTNFANTYISFFQNKWVATLFNTFEEYILLDADVVPFVGSDYFFDSPSYRESGILLFKD 361

Query: 516 RSLGYGSDAK-CFAVFSTLMPKALESKYFQSFSMIDDDYVFDQCHKYLTPEEKIFKNFFE 574
           R +      + C  + + + P A E ++  S  + D    F       + E  ++ NFF+
Sbjct: 362 RVMENEQTFQYCIEMLNEVEPSAQERRFIGSRLVFDSSLPFSS---ETSEEASVYYNFFK 418

Query: 575 NNHQHQMESGLVAIDKSQHIMPLVISTILNMSKKIGGCGHGDKEFFWLGFMVSGHRYSFY 634
               H ++SGLV ++K + +  L++S +LN+  K+  C +GDKE FWLG + +G  YS  
Sbjct: 419 KLRLHHVDSGLVVVNKLEKLNGLLMSFMLNLDGKLQRCVYGDKEIFWLGQLYAGQDYSIN 478

Query: 635 DVEAAAVGKLIEKESEDKLRQEQRSEICNIQLAHMSYDDHLLWLNGGSQNCKF-DVAEDD 693
            V+ + +G + E+   D   +     IC+ Q+AH    + LLW+NGG + CK  + AEDD
Sbjct: 479 PVDGSIIGPVNEEPENDDGHKSGMYYICSTQIAHSDSKNRLLWVNGGLKTCKISNSAEDD 538

Query: 694 WNNEKFGFTKNYNNVEELKKEYASFLEVEHAVIPTEKGGGWGKIDGRCKGYVWCARYSSY 753
           +  E   F   Y ++ +LK+ Y + L VE  ++P      W +I   C  Y++CA    Y
Sbjct: 539 FGREPEYFKSRYGDISKLKRIYDASLNVEGLIVPDVSVHPWMQIK-ECSNYMYCA----Y 593

Query: 754 IKEYTYSN-RVNIGKLVKFDEEEKKYIDSLNKIW 786
                ++N  ++ G+L+ F E+E +YI+ +++ W
Sbjct: 594 ATGDGHTNSELDEGRLITFTEKELRYINDISRTW 627

>Kwal_55.20984
          Length = 619

 Score =  248 bits (633), Expect = 3e-72,   Method: Compositional matrix adjust.
 Identities = 157/490 (32%), Positives = 252/490 (51%), Gaps = 37/490 (7%)

Query: 301 DLENRMFPFLKYYTHENFTNMMPILTSPNGSQL-ATGWFPIHNRKTGVAESFEQHKYDKS 359
           D  +RMFPFLK    E+ T++ P +T  N  Q+ A G  P +++   V  S      D S
Sbjct: 157 DFHHRMFPFLK--VAEDATDLWPTITHLNSGQVVARGVRPHYSKDDDVPFS-----ADNS 209

Query: 360 KSFWWNWNAISRKTAKRGIVISLGNGQVDYGIKLLATLRFQGNKLPIQVIHKG-DLSEDS 418
           KSFW NWN+ S+    +G+V SLG   +D  ++LL  L  Q N LPIQ++ +  +LS+  
Sbjct: 210 KSFWQNWNSFSKG---KGLVFSLGERHLDPFLRLLKILDQQNNSLPIQIVQQPHELSDAF 266

Query: 419 VRKLTDVAQAAEFDIPPNSFDNTTDVKQELWFVDVSTTLNPSVINEFDRFKNKWLAVVFN 478
           +  LT+  Q++                QE++++D    L+ +       F NKWLA +FN
Sbjct: 267 LGNLTEFLQSSH---------------QEVYYIDCEALLDTTYKAYMTYFVNKWLASIFN 311

Query: 479 LFDEFVFIDVDAISYVSIEDYFETSEYKDSGTVFFKDRSLGYGSDAK-CFAVFSTLMPKA 537
            F E V +D D + +V +E +F+  +YK +G + +KDR +   +    C   F  L P +
Sbjct: 312 TFSEVVLMDADVVPFVPVESFFQEEQYKATGVLLYKDRDMPQETTFDYCITTFKLLEPSS 371

Query: 538 LESKYFQSFSMIDDDYVFDQCHKYLTPEEKIFKNFFENNHQHQMESGLVAIDKSQHIMPL 597
            E          +   V    H +   ++K++  FF N   H ++SGLV + K++ +  L
Sbjct: 372 QEVVLMNHRMKTNSSVVDPGAHIFANEKDKVYHRFFYNETLHNVDSGLVVLHKTERLSGL 431

Query: 598 VISTILNMSKKIGGCGHGDKEFFWLGFMVSGHRYSFYDVEAAAVGKLIEKESEDKLRQEQ 657
           +IS I+N+ +K   C +GDKE FWLG + SG+ Y+   ++ AAVG++    + DK+   Q
Sbjct: 432 LISFIMNLDQKASNCIYGDKELFWLGQLFSGNDYAIDPLDGAAVGRV--NLTHDKVSGHQ 489

Query: 658 RSEICNIQLAHMSYDDHLLWLNGGSQNCKF-DVAEDDWNNEKFGFTKNYNNVEELKKEYA 716
           + EIC  Q+ H S D  LLW NGG + CK    A  D+  +   F +++   E+L+  Y 
Sbjct: 490 KYEICATQMGHGSSDGRLLWTNGGLKACKIKGAAHIDFERKPEHFEQHFGTEEKLQALYD 549

Query: 717 SFLEVEHAVIPTEKGGGWGKIDGRCKGYVWCARYSSYIKEYTYSNRVNIGKLVKFDEEEK 776
             L +E  +IP      W K    C  Y +CA  S  +++        +G +V FD++  
Sbjct: 550 LPLSIEGYIIPNISRNAWLK-GQDCLEYSYCA--SLLVED---QKEPPLGTVVVFDDDYS 603

Query: 777 KYIDSLNKIW 786
           + ++ L+KIW
Sbjct: 604 QQLNELSKIW 613

>KLLA0D13376g 1150858..1152849 some similarities with sp|P40549
           Saccharomyces cerevisiae YIL014w MNT3 alpha-1,
           3-mannosyltransferases responsible for adding the
           terminal mannose residues of O-linked oligosaccharides,
           hypothetical start
          Length = 663

 Score =  245 bits (626), Expect = 8e-71,   Method: Compositional matrix adjust.
 Identities = 185/635 (29%), Positives = 300/635 (47%), Gaps = 121/635 (19%)

Query: 160 LDLQTRCHFYFRTLYNMNAKWSNDHHLYTFDINEEIEGEKLKDMSDKDGVSLVNKESLGL 219
           L L+ +C FYF +   +N  W+NDH               +KD  + + +     E    
Sbjct: 130 LPLEQKCRFYFESTLEINPTWNNDH---------------IKDFHNDNNLDDPLAE---- 170

Query: 220 HKRLHDISLALERMRIYDECFIQNDSVDFEGIFTNXXXXXXXXXXXXXXQKRXXXXXXXX 279
                   L LER+R+YD CFI        G+ T+               KR        
Sbjct: 171 --------LMLERIRMYDSCFISG------GLSTSKVF------------KRSVVKPN-- 202

Query: 280 XXXXXXXXXDQTEYYKNFDQWDLENRMFPFLKYYTHENFTNMMPILTSPNGSQLATGWFP 339
                                DLE+R+FPFL   T   F ++ P +   N       W  
Sbjct: 203 ---------------------DLESRLFPFLSKKT--PFRHLWPKMIHVNP------WTL 233

Query: 340 IHNRKTGVAESFEQHKYDKSKSFWWNWNAISRKTAKRGIVISLGNGQVDYGIKLLATLRF 399
           I +    + E  +  K D + SF++NWN  +     +GIV++LG    D   KLL TL  
Sbjct: 234 IPSFSNPLLEGKDTWKMDDNYSFFYNWNNFAEG---KGIVLTLGLRHGDQFKKLLLTLEN 290

Query: 400 QGNKLPIQVIHKGDLSEDSVRKLTDVAQAAEFDIPPNSFDNTTDVKQELWFVDVSTTLNP 459
             N LPIQVIH G          +++ +A  +DI  +SF N   + Q+++FV++   ++ 
Sbjct: 291 LNNTLPIQVIHNG----------SELTEAFIYDI--HSFLNAKKLSQQVYFVNIEPLIDA 338

Query: 460 SVINEFDR-FKNKWLAVVFNLFDEFVFIDVDAISYVSIEDYFETSEYKDSGTVFFKDRSL 518
           S + ++   F NKW+A++FN F E + +D D++S+ S+E YF+   Y+D+G + F+DR++
Sbjct: 339 SFVGQYVHYFINKWMALLFNTFSECILLDADSVSFASLESYFDFKGYQDTGMLLFRDRNI 398

Query: 519 -GYGSDAKCFAVFSTLMPKALESKYFQ-----SFSMIDDDYVFDQCHKYLTPEEKIFKNF 572
            G  +   C      L P   E+ +          ++++D +       L+ EE+I+  F
Sbjct: 399 IGEKTFIYCTDTLKKLFPSVEETHFMSHRSTFPLELVENDNINIDT---LSMEEQIYYKF 455

Query: 573 FENNHQHQMESGLVAIDKSQHIMPLVISTILNMSKKIGGCGHGDKEFFWLGFMVSGHRYS 632
           F N   H ++SGLV +D+ + +  L+IST++N+  K+  C +GDKE FWLG +++G +YS
Sbjct: 456 FHNLQLHHIDSGLVVVDRVKKLSSLLISTMMNIDGKLQRCVYGDKEIFWLGQLLAGEKYS 515

Query: 633 FYDVEAAAVGKLIEKESEDKLRQEQRSEICNIQLAHMSYDDHLLWLNGGSQNCKF-DVAE 691
            Y  E + +G +       K + +   EIC  Q+AH+S +  LLW NGG + CK  D A 
Sbjct: 516 IYPTEGSIMGTV-------KNKPDDTFEICGTQMAHVSTEGTLLWSNGGLKKCKVQDCAV 568

Query: 692 DDWNNEKFGFTKNYNNVEELKKEYASFLEVEHAVIPTEKGGGWGKIDGRCKGYVWCARYS 751
            D++++   F + Y N   L++ Y S L +   + P      W KI   C  Y +CA   
Sbjct: 569 ADFDHDPDYFQEKYGNPVALQQMYDSSLSISGYITPNVGQYPWEKIK-ECHQYTYCA--- 624

Query: 752 SYIKEYTYSNRVNIGKLVKFDEEEKKYIDSLNKIW 786
                   + + N+G +VKFD +    + S++ IW
Sbjct: 625 --------TAKENVGTIVKFDTDTISRLQSVSDIW 651

>YGL257C (MNT2) [1743] chr7 complement(12481..14157)
           Mannosyltransferase required for addition of terminal
           mannose residues to O-linked oligosaccharides [1677 bp,
           558 aa]
          Length = 558

 Score =  236 bits (602), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 146/436 (33%), Positives = 234/436 (53%), Gaps = 41/436 (9%)

Query: 356 YDKSKSFWWNWNAISRKTAKRGIVISLGNGQVDYGIKLLATLRFQGNKLPIQVIHKGDLS 415
           +D   SFW NW     ++  +GIVIS  + Q++  I+LL  LRF  N  PIQ++H  DLS
Sbjct: 155 FDTGLSFWENWLHTVTQSGSKGIVISASDVQLNETIRLLKVLRFIKNDYPIQIVHNADLS 214

Query: 416 EDSVRKLTDVAQAAEFDIPPNSFDNTTDVKQELWFVDVSTTLNPSVINEFDRFKNKWLAV 475
           +DS++ +   A+         S D      QELWF++V + LNP    +F  + NKWLA+
Sbjct: 215 QDSMKSIIKYAR---------SLDTAEYPAQELWFLNVHSLLNPKYSKKFTTYSNKWLAL 265

Query: 476 VFNLFDEFVFIDVDAISYVSIEDYFETSEYKDSGTVFFKDRSLGYGSDAKCFAVFSTLMP 535
            F+ F+  + +D D + +VSIE ++E  E++ +G +FFKDR +   SD     +F +   
Sbjct: 266 TFSSFEIPILMDSDTVPFVSIEKFYELEEFQKTGVLFFKDRVI---SD----DLFESSEL 318

Query: 536 KALESKYFQ--SFSMIDDDYVFDQCHKYLTPEEKIFKNFFENNHQHQMESGLVAIDKSQH 593
           K L    +      + D+  + +Q    +  +  + +N F   ++H +ESGLV + K +H
Sbjct: 319 KILREIVYGCIGLDLEDESKIHEQVEDPVVAQ--VLENMFIKKYKHHLESGLVILHKGKH 376

Query: 594 IMPLVISTILNMSKKIGGCGHGDKEFFWLGFMVSGHRYSFYDVEAAAVGKL---IEKESE 650
           +  ++ S  L  S  I    HGDK+FFWLG ++S +R++F+ V+A+ +G+L   + KES 
Sbjct: 377 LFSMLTSIALQFS-PIAEYFHGDKDFFWLGELLSNNRFTFHPVDASNIGQLGNVVSKEST 435

Query: 651 DKLRQEQRSEICNIQLAHMSYDDHLLWLNGGSQNCKFDVAEDDWNNEKFGFTKNYNNVEE 710
            +  Q     IC++QL+H   D  LLWLNGG   CK    E D+ + +      + N +E
Sbjct: 436 GEFYQ-----ICSVQLSHTDRDGSLLWLNGGLNICKKTSWEYDYEHRQ-RLNDMFQNADE 489

Query: 711 LKKEYASFLEVEHAVIPTEKGGGWGKIDGRCKGYVWCARYSSYIKEYTYSNRVNIGKLVK 770
           L++ YAS +++E  +IP     GW    G C  + +C  +    KE  +      GKL+K
Sbjct: 490 LREYYASPVKLEGIIIPDTSISGWIN-SGECFLFNYCTLF----KEGEF------GKLIK 538

Query: 771 FDEEEKKYIDSLNKIW 786
           F E+EK  +  +  IW
Sbjct: 539 FKEDEKLRLSQIVDIW 554

>Kwal_55.22238
          Length = 584

 Score =  231 bits (589), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 159/512 (31%), Positives = 251/512 (49%), Gaps = 70/512 (13%)

Query: 294 YKNFDQWDLENRMFPFLK--YYTHENFTNMM----PILTSPNGSQLATGWFPIHNRKTGV 347
           Y + D   LE+++FP     + T + +  ++    P L + +G    T      N + G 
Sbjct: 121 YGDLDVKKLEHKLFPMFSGDFPTFQRWDGLLVEGYPKLVASSGKMTTT------NVEKGP 174

Query: 348 AESFEQHKYDKSKSFWWNWNAISRKTAKRGIVISLGNGQVDYGIKLLATLRFQGNKLPIQ 407
             SF              W  +      RGIVISLG G V    +LL  LR  GN+LPIQ
Sbjct: 175 KASF--------------WKHLKESMNGRGIVISLGEGGVSDVKRLLRVLRTVGNRLPIQ 220

Query: 408 VIHKGDLSEDSVRKLTDVAQAAEFDIPPNSFDNTTDVKQELWFVDVSTTLNPSVINEFDR 467
           ++HKGDLS  +++++ ++ +  +  +       +    Q++WFVD   ++N S  + F R
Sbjct: 221 LVHKGDLSRAAMQEIINIGRG-DVIVEIGDVSQSIGNPQDIWFVDAGKSVNSSSAHLFKR 279

Query: 468 FKNKWLAVVFNLFDEFVFIDVDAISYVSIEDYFETSEYKDSGTVFFKDRSLGYGSDAKCF 527
           F NKW+A +FN F+E + +D DA+ +V  E  F T+EYK+SG +FF DR +         
Sbjct: 280 FSNKWIASLFNSFEEIILMDCDAVPFVDPELLFNTTEYKESGALFFVDRLIDEYIKTNDL 339

Query: 528 AVFSTLMPKALESKYFQSFSMIDDDYVFDQCHKYLTPEEKIFKNFFENNHQHQMESGLVA 587
            ++  L P            + ++  +F   H      +   + F+E  ++H MESG+V 
Sbjct: 340 KLYQKLFP------------LENEKSLFGLQHTLGGAVD--LRGFYEFGYKHTMESGMVV 385

Query: 588 IDKSQHIMPLVISTILNMSKKIGGCGHGDKEFFWLGFMVSGH-RYSFYDVEAAAVGKLIE 646
           + +  H+  L+IST L   K+     +GDKE FWLG  +SG+  Y F    A A+G L+ 
Sbjct: 386 MKREDHLPGLLISTCLQFWKETSEPFYGDKELFWLGQSISGNGEYRFNAYPAGAIG-LLN 444

Query: 647 KESEDKLRQEQRSEICNIQLAHMSYDDHLLWLNGGSQNCKFDVAEDDWNNEKFGFTKNYN 706
           +++++ L     + IC+ Q AH S D  LLWLNGG++ CK    + D++ +KF   + YN
Sbjct: 445 QDTDENL-----NYICSTQPAHFSKDLQLLWLNGGARRCKIPSWDMDFSKQKF-LRQKYN 498

Query: 707 NVEELKKEYASFLEVEHAVIPTEKG-----------GGWGKIDGR-CKGYVWCARYSSYI 754
           + E+L+  Y S + V  A+IP                G+ K     C GY WCA    Y 
Sbjct: 499 SAEKLRDVYKSPINVNGAIIPPRSALSVLQKLKKVKSGFQKCKRLGCAGYTWCA----YD 554

Query: 755 KEYTYSNRVNIGKLVKFDEEEKKYIDSLNKIW 786
           +E       N GK + F + E K I+ +  +W
Sbjct: 555 RELD-----NKGKTIHFAKNEIKDIEFIISVW 581

>Kwal_23.5454
          Length = 583

 Score =  224 bits (571), Expect = 8e-64,   Method: Compositional matrix adjust.
 Identities = 150/499 (30%), Positives = 249/499 (49%), Gaps = 60/499 (12%)

Query: 301 DLENRMFPFLKYYTHENFTNMMPILTSPNGSQLATGWFPIHNRKTGVAESFEQHKYDKSK 360
           D+E+R+FP         FT  +PI +  +GS   T  FP         + +E  +   SK
Sbjct: 129 DVESRLFPV--------FTREVPIFSRWDGS--ITEGFP---EAKLSKKDYEVKEEIASK 175

Query: 361 SFWWNWNAISRKTAKRGIVISLGNGQVDYGIKLLATLRFQGNKLPIQVIHKGDLSEDSVR 420
             +W    +  + + +GIVIS+G G VD  I+LL  LR   N LPIQ++HKGD+S  S+ 
Sbjct: 176 DAYWK--QVKERYSGKGIVISIGEGGVDEVIRLLRVLRALKNTLPIQLVHKGDVSASSMN 233

Query: 421 KLTDVAQAAEFDIPPNSFDNTTDVKQELWFVDVSTTLNPSVINEFDRFKNKWLAVVFNLF 480
            +    +  + +     + + ++  QE+WFV+ + ++    ++ F RF NKW+A +FN F
Sbjct: 234 MIIQAGRG-KIEDKQGIYSDISEHPQEIWFVNAARSIKKGNLDLFQRFSNKWIASLFNSF 292

Query: 481 DEFVFIDVDAISYVSIEDYFETSEYKDSGTVFFKDRSLGYGSDAKCFAVFSTLMPKALES 540
           +E + +D D + +++ ++ F+ +EY+++G  FFKDR +     +   + +  L+P   E 
Sbjct: 293 EEMILMDSDVVPFLNPKELFDATEYRETGAYFFKDRPIDEFLRSSDLSFYRKLLPSEWEY 352

Query: 541 KYFQSFSMIDDDYVFDQCHKYLTPEEKIFKNFFENNHQHQMESGLVAIDKSQHIMPLVIS 600
             F+   + D  Y                  F ++ ++H MESG+V +++  H+  L+IS
Sbjct: 353 TAFEMQPLTDHTYG---------------NGFLKHGYKHFMESGVVVLNRRNHMPGLLIS 397

Query: 601 TILNMSKKIGGCGHGDKEFFWLGFMVSGHR-YSFYDVEAAAVGKLIEKESEDKLRQEQRS 659
             + + K+     +GDKE FWLG  ++G+  Y F   EA A+GK      +         
Sbjct: 398 ATMQLWKETSQPIYGDKELFWLGQSIAGNENYRFNKNEAGAIGK------KGVYNSNNIE 451

Query: 660 EICNIQLAHMSYDDHLLWLNGGSQNCKFDVAEDDWNNEKFGFTKNYNNVEELKKEYASFL 719
            +C++Q AH   + +LLW NGG +NCK      D+   K+   + Y+NVEELKK Y S L
Sbjct: 452 YVCSVQPAHFDNELNLLWTNGGLRNCKKGSWNRDFAENKY-LRRKYHNVEELKKYYQSPL 510

Query: 720 EVEHAVI-PTEKGGGWGKIDGR-----------CKGYVWCARYSSYIKEYTYSNRVNIGK 767
           E++ A+I P      + +I G+           C GYVWCA        Y   + V   K
Sbjct: 511 ELDGAMIAPRSHLNFFERIQGKKVGFQKCPHMGCMGYVWCA--------YDNPDEVR-AK 561

Query: 768 LVKFDEEEKKYIDSLNKIW 786
            + F+E     I ++  +W
Sbjct: 562 KINFNENSLSRIRTIVALW 580

>CAGL0C04048g complement(399734..401596) similar to sp|P40549
           Saccharomyces cerevisiae YIL014w MNT3, hypothetical
           start
          Length = 620

 Score =  224 bits (572), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 182/685 (26%), Positives = 292/685 (42%), Gaps = 139/685 (20%)

Query: 123 PVSPLEVVPDYDLDVSRNRKASWN----FINKNKK-YKHFNELDLQTRCHFYFRTLYNMN 177
           PVSP   V +Y L+  + R ++      F+NK K     +N      +C    +++Y  +
Sbjct: 55  PVSPFSYVNNYLLNSEKTRSSTVKKLLPFLNKPKDGLVDWNSSSKYQKCLLLVKSMYKAH 114

Query: 178 AKWSNDHHLYTFDINEEIEGEKLKDMSDKDGVSLVNKESLGLHKRLHDISLALERMRIYD 237
             WSN   +  +D NE +E   L+                          LA ER++IY 
Sbjct: 115 PHWSNRDIMTAYD-NESVEDLNLQ--------------------------LAGERIKIYK 147

Query: 238 ECFIQNDSVDFEGIFTNXXXXXXXXXXXXXXQKRXXXXXXXXXXXXXXXXXDQTEYYK-- 295
           +CF+ ND                                            +  E++K  
Sbjct: 148 QCFLDND-------------------------------------------IEPIEFFKRL 164

Query: 296 ---NFDQWDLENRMFPFLKYYTHENFTNMMPILTSPNGSQLATGWFPIHNRKTGVAESFE 352
              + D +D + RMF F +  T  N     P                I N K+G   S  
Sbjct: 165 SIPDVDAYDFQKRMFYFFRDITASNTDYFHP---------------AIKNVKSGEVVSKP 209

Query: 353 QHKY---DKSKSFWWNWNAISRKTAKRGIVISLGNGQVDYGIKLLATLRFQGNKLPIQVI 409
           + K    + + +   NW  +SR    +GIV+++    V    +     +  GNKLPIQV+
Sbjct: 210 KTKLTPQEYNANIIGNWRKLSRG---KGIVLTVSQSDVPLLRQQFRVWKELGNKLPIQVV 266

Query: 410 HKGDLSEDSVRKLTDVAQAAEFDIPPNSFDNTTDVKQELWFVDVSTTLNPSVI-NEFDRF 468
           HKG          T++    E  I     +   +++Q+++ VD+S  ++P    N    F
Sbjct: 267 HKG----------TEINAELEQKIK----EYAIEMEQDVYVVDLSPVIDPDFAENSIQNF 312

Query: 469 KNKWLAVVFNLFDEFVFIDVDAISYVSIEDYFETSEYKDSGTVFFKDRSLGYGSDAKCFA 528
            NKW A +FN F+E + ID DAI YV  ED+ ++  YK +G   ++DR + +        
Sbjct: 313 HNKWYAAIFNTFEELILIDADAIPYVPAEDFLKSKSYKKTGLRLWRDRDITHERTLHFCV 372

Query: 529 VFSTLMPKALESKYFQSFSM---IDDDYVFDQCHKYLTPEEKIFKNFFENNHQHQMESGL 585
             +      LE       ++   + D  + D        E +    FF+  + H ++SGL
Sbjct: 373 EMAPYFEPTLEEHNLIGTTLSYRLTDSGLKDAKDS----EGRALYEFFQKMYLHHVDSGL 428

Query: 586 VAIDKSQHIMPLVISTILNMSKKIGGCGHGDKEFFWLGFMVSGHRYSFYDVEAAAVGKL- 644
           V IDK   I  L++S IL+   + G C +GDKE F LG  + G  Y+     AA +G + 
Sbjct: 429 VVIDKKDKIHSLIMSEILHSHTRFGRCTYGDKELFMLGAYMVGESYTLEAQSAAIIGTVG 488

Query: 645 IEKESEDKLRQEQRSEICNIQLAHMSYDDHLLWLNGGSQNCKFDVAEDDWNNEKFGFTKN 704
            EKE         R  IC  Q+ H   D+ LLW NGG + CKFD AE+D+N ++  + K 
Sbjct: 489 YEKEF-------SRHYICATQMGHSDEDNRLLWSNGGLRTCKFDCAEEDFNKDEEYYKKR 541

Query: 705 YNNVEELKKEYASFLEVEHAVIPTEKGGGWGKIDGRCKGYVWCARYSSYIKEYTYSNRVN 764
           Y NV+ LK  Y+S L ++  +IP      W ++   C+ Y++CA           +   +
Sbjct: 542 YQNVDNLKAVYSSRLNIDGFIIPDTTVNKWLQL-SECRQYMYCAHVDD-------NREKD 593

Query: 765 IGKLVKFDEEEKKYIDSLNKIWWKA 789
            G LV+  +EEK+ ++ +++ W  A
Sbjct: 594 KGTLVRLTDEEKQKVNRISEFWNSA 618

>YNR059W (MNT4) [4642] chr14 (736800..738542) Protein with strong
           similarity to mannosyltransferases Mnn1p, Mnt2p and
           Mnt3p [1743 bp, 580 aa]
          Length = 580

 Score =  223 bits (567), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 155/511 (30%), Positives = 244/511 (47%), Gaps = 77/511 (15%)

Query: 302 LENRMFPFLKYYTHENFTNMMPILTSPNGSQLATGWFPIHNRKTGVA------------E 349
           +E ++FP++      NFT +         S+ +  ++P+H R  G               
Sbjct: 123 IETKLFPYI------NFTAL--------NSEQSHNFWPVHTRFDGTKYRGQVLQFSSENN 168

Query: 350 SF---EQHKYDKSKSFWWNWNAISRKTAKRGIVISLGNGQVDYGIKLLATLRFQGNKLPI 406
           SF      ++  S+ FW NW   + +   +G+V+S+    V   I+L+  LR   N LPI
Sbjct: 169 SFIGTSPIEFKASEPFWENWLNSALQRNSKGVVMSVSEYLVADTIRLIRVLRLLNNSLPI 228

Query: 407 QVIHKGDLSEDSVRKLTDVA-QAAEFDIPPNSFDNTTDVKQELWFVDVSTTLNPSVINEF 465
           +++HK DL E S + L   A ++   + PP          QELWF+DV   LN   +  F
Sbjct: 229 EIVHKSDLHESSQQLLIAAARESGSLNYPP----------QELWFLDVKDMLNDEYLARF 278

Query: 466 DRFKNKWLAVVFNLFDEFVFIDVDAISYVSIEDYFETSEYKDSGTVFFKDRSLGYGSDAK 525
            RF NKWLA+ F  F   +F+D D + +V ++  +E   +K +GT+FFKDRS      + 
Sbjct: 279 KRFSNKWLAITFCSFQIPIFLDSDTVPFVPLDTLYEIDGFKRTGTLFFKDRSFPTSKLSP 338

Query: 526 C-FAVFSTLMPKALE--SKYFQSFSM----IDDDYVFDQCHKYLTPEEKIFKNFFENNHQ 578
               V   ++  +L+  S   Q F +    ++D+   D        E  IFK       +
Sbjct: 339 LQVKVLKQIINNSLDVSSDSEQGFEILKHNLNDEMAIDAI------EALIFK-----KQK 387

Query: 579 HQMESGLVAIDKSQHIMPLVISTILNMSKKIGGCGHGDKEFFWLGFMVSGHRYSFYDVEA 638
           H M+SGLV  DK +H   L I+ +L  S  I    HGDKE+FWL   +S   ++FY +EA
Sbjct: 388 HYMDSGLVIFDKQKHFFCLPIAIMLQFS-PIQEFFHGDKEWFWLSLFISKKEFTFYPIEA 446

Query: 639 AAVGKLIEKESEDKLRQEQRSEICNIQLAHMSYDDHLLWLNGGSQNCKFDVAEDDWNNEK 698
           + VG+L + E+ +       S IC+ QL+H     +LLWLNGG   CK +    D+   K
Sbjct: 447 SNVGRLEKPETLES------STICSTQLSHTDVYGNLLWLNGGLSVCKKNCWNYDFTKRK 500

Query: 699 FGFTKNYNNVEELKKEYASFLEVEHAVIPTEKGGGWGKIDGRCKGYVWCARYSSYIKEYT 758
                 Y +V+EL+  Y S +++E  +IP      W +    C  Y +C  Y        
Sbjct: 501 -EIAAKYKSVDELRNYYQSPVKLEAVIIPDVSKSPWSQ-QSECVMYSYCTHY-------- 550

Query: 759 YSNRVNIGKLVKFDEEEKKYIDSLNKIWWKA 789
              +   GKL++F + +KKY + + ++W K 
Sbjct: 551 --RKGQYGKLIEFTDSQKKYYEKVVELWNKV 579

>AEL345W [2160] [Homologous to ScYIL014W (MNT3) - NSH]
           complement(1961..3898) [1938 bp, 645 aa]
          Length = 645

 Score =  224 bits (570), Expect = 4e-63,   Method: Compositional matrix adjust.
 Identities = 177/614 (28%), Positives = 253/614 (41%), Gaps = 130/614 (21%)

Query: 161 DLQTRCHFYFRTLYNMNAKWSNDHHLYTFDINEEIEGEKLKDMSDKDGVSLVNKESLGLH 220
           DLQ RC  YF   Y     WSN     + DI           +SD    + +        
Sbjct: 114 DLQERCKRYFELTYRKEPAWSNQVPFLSRDI-----------ISDASYSAKL-------- 154

Query: 221 KRLHDISLALERMRIYDECFIQND---SVDFEGIFTNXXXXXXXXXXXXXXQKRXXXXXX 277
                    +ER RI+ +CFI+ +   S   +G                           
Sbjct: 155 ---------MERWRIFADCFIEGNEPLSTTLDG--------------------------- 178

Query: 278 XXXXXXXXXXXDQTEYYKNFDQWDLENRMFPFLKYYTHENFTNMMPILTSPN-GSQLATG 336
                               D +D + RM+PFL       +  + P++T  N G Q   G
Sbjct: 179 ------------------RVDIFDFQQRMYPFLTKV--RRWEEIWPMITDLNTGEQYQPG 218

Query: 337 WFPIHNRKTGVAESFEQHKYDKSKSFWWNWNAISRKTAKRGIVISLGNGQVDYGIKLLAT 396
                 R T           D + SFW NW   S+    RGI I+ G   V+   +LL  
Sbjct: 219 HLKDGQRLT----------IDDNLSFWKNWQLFSKG---RGITITAGAEHVEMLPRLLNV 265

Query: 397 LRFQGNKLPIQVIHKGDLSEDSVRKLTDVAQAAEFDIPPNSFDNTTDVKQELWFVDVSTT 456
           L   GN LPI++I+  DL   ++ K+    Q                  Q +  VD   T
Sbjct: 266 LDHIGNTLPIELINAADLPPTTIDKIAKYVQMKS--------------NQTVRLVDCGKT 311

Query: 457 LNPSVINEFDRFKNKWLAVVFNLFDEFVFIDVDAISYVSIEDYFETSEYKDSGTVFFKDR 516
           L  S  +    F++KWLA +FN F+E VFID+DA+ +V +E  FE   YK  G + F+DR
Sbjct: 312 LEHSYRSLITGFRHKWLAYIFNTFEEAVFIDLDAVPFVDLEKLFEVEGYKSEGILMFRDR 371

Query: 517 SLGYGSDAKCFAVFSTLMPKALESKYFQSFSMIDDDYVFDQCHKYLTPEEKIFKNFF--- 573
           S        C      +MP   E   +Q  S  D     D+  K   P +     F+   
Sbjct: 372 SYDGEKPDDCPKAMRIMMPSPKEHTMWQHGSNYDKQVAEDELTK--KPRDAGAATFYIKY 429

Query: 574 -ENNHQHQMESGLVAIDKSQHIMPLVISTILNMSKKIGGCGHGDKEFFWLGFMVSGHRYS 632
            E    H  ESGL+ + K++ +  L+IS +L+M+ +   C HGDKE+ WLG +VSG  Y 
Sbjct: 430 MEGKSFHMAESGLIVMHKNKKLPSLLISLMLHMTFETHLCSHGDKEYLWLGQLVSGENYY 489

Query: 633 FYDVEAAAVG--KLIEKESEDKLRQEQRSEICNIQLAHMSYDDHLLWLNGGSQNCKFDVA 690
                 A +G  +L+         Q    +IC+ Q+AHM  D  +LW+NGG +NCKFD  
Sbjct: 490 VDPRPPAIIGVPQLVSNHG-----QVDEYKICSAQIAHMDDDGSILWVNGGLKNCKFDAV 544

Query: 691 EDDWNNEKFGFTKNYNNVEELKKEYASFLEVEHAVIPTEKGGGWGKIDGRCKGYVWC--- 747
           E D+ +    F+K Y N E L+K Y   ++++ A IP      W K    C+ + WC   
Sbjct: 545 ERDFEDYTEYFSKKYINKENLQKFYDLEVDMQMAFIPDFVDSDWVKAP-ECRAFTWCSTI 603

Query: 748 -------ARYSSYI 754
                  A Y SYI
Sbjct: 604 KADSMEGAEYQSYI 617

>Scas_717.5
          Length = 639

 Score =  216 bits (551), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 167/634 (26%), Positives = 301/634 (47%), Gaps = 107/634 (16%)

Query: 165 RCHFYFRTLYNMNAKWSNDHHLYTFDINEEIEGEKLKDMSDKDGVSLVNKESLGLHKRLH 224
           +C +   ++Y  +A WSN+  + T+  N+E++                  +SL       
Sbjct: 109 QCRYLVYSIYQQDANWSNEG-MCTYHSNDELD------------------DSL------- 142

Query: 225 DISLALERMRIYDECFIQNDSVDFEGIFTNXXXXXXXXXXXXXXQKRXXXXXXXXXXXXX 284
            ++L  ER+RIYD CFI    ++ + +F                                
Sbjct: 143 -LALMGERLRIYDYCFITG-KLNVKDVFN------------------------------- 169

Query: 285 XXXXDQTEYYKNFDQWDLENRMFPFLKYYTHENFTNMMPILTSPNGSQLATGWFPIHNRK 344
               D      +    D + RMFPFL+  + E+     PI+T+     L TG      + 
Sbjct: 170 ----DYLTENNSITASDFQKRMFPFLRSDSEESNELFWPIVTN-----LKTGEVQPRPKV 220

Query: 345 TGVAESFEQHKYDKSKSFWWNWNAISRKTAKRGIVISLGNGQVDYGIKLLATLRFQGNKL 404
           +   + F          FW  W   S     +GIV+++G   VD   K L  L   GNKL
Sbjct: 221 SVSPKEFNSQ-------FWKYWKQSSHG---KGIVLTMGERDVDMFKKQLRVLDHLGNKL 270

Query: 405 PIQVIHKG-DLSEDSVRKLTDVAQAAEFDIPPNSFDNTTDVKQELWFVDVSTTLNPSVIN 463
           PIQ++  G + S + ++ LTD             F  TT+  QE++ V+ S  L+P  ++
Sbjct: 271 PIQLVTAGSEYSPEFLKDLTD-------------FLKTTN--QEVYLVEASPILDPEFVS 315

Query: 464 EFDRFK-NKWLAVVFNLFDEFVFIDVDAISYVSIEDYFETSEYKDSGTVFFKDRSL-GYG 521
           ++  F  +KW+A++ N F+E V ID D + +V ++ +F++  YK +G + FKDR++ G  
Sbjct: 316 KYIVFFFHKWIAILLNTFEELVLIDADVVPFVPLKSFFKSEGYKTTGLLLFKDRNMKGEH 375

Query: 522 SDAKCFAVFSTLMPKALESKYFQSFSMIDDDYVFDQCHKYLTPEEKIFKNFFENNHQHQM 581
           +   C      + P   E++Y Q+  +ID            + E  ++ +FF++   H +
Sbjct: 376 TFTYCMESLKYMEPSRQETEYIQTNLLIDSTKELPSPTS--SEEAAVYNHFFKDLRLHHV 433

Query: 582 ESGLVAIDKSQHIMPLVISTILNMSKKIGGCGHGDKEFFWLGFMVSGHRYSFYDVEAAAV 641
           +SGLV ++K++ +  L++S +L+++ KI  C +GDKEFFWLG + +G  YS + ++A   
Sbjct: 434 DSGLVTVNKNEKMNGLLMSFMLHLNGKIQRCVYGDKEFFWLGQLFAGQDYSIHPMDAGVA 493

Query: 642 GKLIEKESEDKLRQEQRSEICNIQLAHMSYDDHLLWLNGGSQNCKF-DVAEDDWNNEKFG 700
           G  I++ + +   +E    IC+ Q++H+  +  LLW NGGS  C+  + A  D+  +   
Sbjct: 494 GG-IDRSNPNSSPKEYF--ICSAQISHIDENQKLLWQNGGSNFCEVSNSATSDFEKDPSY 550

Query: 701 FTKNYNNVEELKKEYASFLEVEHAVIPTEKGGGWGKIDGRCKGYVWCARYSSYIKEYTYS 760
           F   Y ++E LK  Y S ++ +  +IP      W ++   C  Y++CA    +  E   +
Sbjct: 551 FRGRYQSMESLKTLYDSPVKFDGVIIPDASANPWLQLK-ECSNYMYCA----FNVEDHQN 605

Query: 761 NRVNIGKLVKFDEEEKKYIDSLNKIWWKASTDSI 794
           ++++ G + +FD+     ++ +++IW +  T  I
Sbjct: 606 SKLDSGFMKRFDKGTMDELNKISEIWNQGLTAKI 639

>AAR183C [371] [Homologous to ScYIL014W (MNT3) - NSH]
           (672091..674037) [1947 bp, 648 aa]
          Length = 648

 Score =  215 bits (547), Expect = 6e-60,   Method: Compositional matrix adjust.
 Identities = 153/546 (28%), Positives = 256/546 (46%), Gaps = 106/546 (19%)

Query: 222 RLHDISLA---LERMRIYDECFIQNDSVDFEGIFTNXXXXXXXXXXXXXXQKRXXXXXXX 278
           R+ D S+    LER+R++D CF+Q D +    +F                          
Sbjct: 157 RMKDASVTAAMLERLRVFDTCFMQGD-IGLREVFG------------------------- 190

Query: 279 XXXXXXXXXXDQTEYYKNFDQWDLENRMFPFLKYYTHENFTNMMP-ILTSPNGSQLATGW 337
                           ++ + + L + +FPFLK     +++ ++P +L   +GS+   G 
Sbjct: 191 ----------------EDINLYSLHHELFPFLKKV--RDWSELLPQVLDLNDGSRYLLG- 231

Query: 338 FPIHNRKTGVAESFEQHKYDKSKSFWWNWNAISRKTAKRGIVISLGNGQVDYGIKLLATL 397
                    + E  +  K D    FW N   + R ++ RGIV ++ +  +D   +LL  L
Sbjct: 232 -------NKLPE--QAFKVDNDLPFWEN---LRRSSSGRGIVATVADIHLDQLKRLLHVL 279

Query: 398 RFQGNKLPIQVIHKG-DLSEDSVRKLTDVAQAAEFDIPPNSFDNTTDVKQELWFVDVSTT 456
              GNKLPI++++KG D S   +++L    +                 KQ +  VD S  
Sbjct: 280 DELGNKLPIELVYKGNDFSRLPIKRLKRYVRQ--------------HTKQRVRLVDCSRV 325

Query: 457 LNPSVINEFDRFKNKWLAVVFNLFDEFVFIDVDAISYVSIEDYFETSEYKDSGTVFFKDR 516
           L  + I +  RF NKWLA +FN F+E + +DVD +  V I+ YF+   Y  +G +FFKDR
Sbjct: 326 LRSTHIPKIKRFMNKWLATIFNSFEEIILLDVDVVPLVPIDSYFKLPGYTKTGALFFKDR 385

Query: 517 SLGYGSDAKCFAVFSTLMPKALESKYFQSFSMIDDDYVFDQCHKYLTP------------ 564
           +L       C      L P + E+K            ++    +Y TP            
Sbjct: 386 TLPEYLPVSCTKAILLLPPSSEENK------------LWGHSMRYRTPMTKAGALDRTNS 433

Query: 565 -EEKIFKNFFENNHQHQMESGLVAIDKSQHIMPLVISTILNMSKKIGGCGHGDKEFFWLG 623
            E ++  N+F   ++HQ+E+GLV +++ Q +  LV S +++++ +   C HGDKE FWLG
Sbjct: 434 AETEVMYNYFIERYRHQVETGLVVLNRKQRLFSLVTSFMIHLNLRFSECFHGDKEVFWLG 493

Query: 624 FMVSGHRYSFYDVEAAAVGKLIEKESEDKLRQEQRSEICNIQLAHMSYDDHLLWLNGGSQ 683
            +++G+ YS + + AA +G+L  ++ E KL   +   IC+ Q+AH   D  +LW+NGG  
Sbjct: 494 QLLTGNEYSIHPMPAAIIGEL--QQGERKLAATE-YRICSTQIAHPDTDGTVLWINGGMW 550

Query: 684 NCKFD-VAEDDWNNEKFGFTKNYNNVEELKKEYASFLEVEHAVIPTEKGGGWGKIDGRCK 742
           NCK +  AE+D+++    FT+ + + ++L   Y   L+V     P  K   W      CK
Sbjct: 551 NCKDNKAAEEDFSDYNRYFTRKFGSQQKLADWYKQTLKVTGVFSPELKNSKWIPAK-ECK 609

Query: 743 GYVWCA 748
              +C+
Sbjct: 610 QSAFCS 615

>ABR245C [839] [Homologous to ScYIL014W (MNT3) - NSH]
           (854585..856510) [1926 bp, 641 aa]
          Length = 641

 Score =  211 bits (536), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 131/456 (28%), Positives = 219/456 (48%), Gaps = 36/456 (7%)

Query: 297 FDQWDLENRMFPFLKYYTHENFTNMMPILTSPNGSQLATGWFPIHNRKTGVAESFEQHKY 356
            D  D   RMFPFL       + +M P++T  N      G         G      Q + 
Sbjct: 180 IDMHDFHQRMFPFLA--KKREWRDMWPVITDINTGMTFEG---------GAVWEGRQSEI 228

Query: 357 DKSKSFWWNWNAISRKTAKRGIVISLGNGQVDYGIKLLATLRFQGNKLPIQVIHKG-DLS 415
           D   SFW NW + S     +GI +S+G+G ++  +++L  L + GN+LPI+++ KG +LS
Sbjct: 229 DDGASFWKNWRSFSHG---KGITMSVGDGHLEMLLRMLTVLDYLGNELPIEIVEKGGELS 285

Query: 416 EDSVRKLTDVAQAAEFDIPPNSFDNTTDVKQELWFVDVSTTLNPSVINEFDRFKNKWLAV 475
           +    KLT+  +                 KQ++  +  + TL+ +       F  KW+A+
Sbjct: 286 QQFRDKLTEFVR--------------NKSKQKVRIISCARTLDETHARLIFGFSCKWVAL 331

Query: 476 VFNLFDEFVFIDVDAISYVSIEDYFETSEYKDSGTVFFKDRSLGYGSDAKCFAVFSTLMP 535
           +FN F+E +F+DVDA+ Y+  E +F+   YK +G + F+DR +      +C      ++P
Sbjct: 332 MFNTFEEAIFLDVDAVPYILPEQFFDMEGYKSTGIMLFRDRLIDQHVSKECPDAVRQMIP 391

Query: 536 KALESKYFQSFSMIDDDYVFDQCHKYLTPE--EKIFKNFFENNHQHQMESGLVAIDKSQH 593
              E+  +   +         + +     E    ++  FF +++ H +ESG+V  +K   
Sbjct: 392 TQEETSIWNHKAKFSGPAANKEAYDNTKDEGAAAVYDRFFRDHYYHVVESGVVVFNKKNK 451

Query: 594 IMPLVISTILNMSKKIGGCGHGDKEFFWLGFMVSGHRYSFYDVEAAAVGKLIEKESEDKL 653
           +  +V S +LN++    GC +GDKE  W+G ++S   Y  +    A +G   E E E   
Sbjct: 452 LQSIVNSFMLNLNFYYVGCFYGDKELMWVGQLLSAEDYYIHPAPPAILGSAEEFEREGNT 511

Query: 654 RQEQRSEICNIQLAHMSYDDHLLWLNGGSQNCKF-DVAEDDWNNEKFGFTKNYNNVEELK 712
              +   +C  Q+ HM  D  LLW NGG + CKF D AE D++     F   Y++ ++L+
Sbjct: 512 VSYR---VCGAQIGHMELDGSLLWTNGGLRTCKFTDTAEQDFSKSPEYFNPKYSSPQQLQ 568

Query: 713 KEYASFLEVEHAVIPTEKGGGWGKIDGRCKGYVWCA 748
           + Y+  LE++   IP      W K    C+GY WC+
Sbjct: 569 EHYSKPLEIQLIFIPELTYSVWEK-SVECQGYTWCS 603

>CAGL0H09240g complement(905670..907598) some similarities with
           sp|P40549 Saccharomyces cerevisiae YIL014w MNT3,
           hypothetical start
          Length = 642

 Score =  205 bits (522), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 150/509 (29%), Positives = 245/509 (48%), Gaps = 69/509 (13%)

Query: 298 DQWDLENRMFPFLKYYTHENFTNMMPILTSPNGSQLATGWFPIHNRKTGVAES---FEQH 354
           D +D + RMF FLK  T E+   + P                I N +TG   S    +Q 
Sbjct: 181 DAYDFQKRMFFFLKNVTQEDSDYLYPT---------------IKNVRTGEVVSKPKTKQS 225

Query: 355 KYDKSKSFWWNWNAISRKTAKRGIVISLGNGQVDYGIKLLATLRFQGNKLPIQVIHKG-D 413
             + + +F+ NW  I+   + RGIV+S     +D   + L+  +  GNK PIQV+HKG +
Sbjct: 226 PQEFNSNFFANWRKIA---SGRGIVLSAKPDDIDMLRQQLSVWKELGNKYPIQVVHKGGE 282

Query: 414 LSEDSVRKLTDVAQAAEFDIPPNSFDNTTDVKQELWFVDVSTTLNPSVINE-FDRFKNKW 472
           L+ D+             +I    F   TD  Q ++ VD    L+ +  +E   +F NKW
Sbjct: 283 LTRDN-------------EISLKQFAEETD--QNIYIVDAGPVLDKNFADEHITKFHNKW 327

Query: 473 LAVVFNLFDEFVFIDVDAISYVSIEDYFETSEYKDSGTVFFKDRSL-GYGSDAKCFAVFS 531
           + V+FN F+E++ +D D + ++S ED+FE+  +K SG   ++DR+L        C  +  
Sbjct: 328 VGVLFNTFEEYIMVDADTVPFISAEDFFESENFKKSGMRMWRDRTLTNRHIREHCPDLAL 387

Query: 532 TLMPKALESKYFQS---FSMIDDDYVFDQCHKYLTPEEKIFKNFFENNHQHQMESGLVAI 588
            L P   E +   +   F ++D D   ++     T EE+ F     N   H ++SGLV I
Sbjct: 388 KLEPSLEEHRILGTTLRFKLLDPDLKQEK-----TSEERAFNQMRTNLALHHVDSGLVVI 442

Query: 589 DKSQHIMPLVISTILNMSKKIGGCGHGDKEFFWLGFMVSGHRYSFYDVEAAAVGKLIEKE 648
           +K + +  L++S           C +GDKE FW     +   Y     +AA +GKL   E
Sbjct: 443 NKKEKLHSLLLSEFFQNHALFRRCSYGDKELFWYAAFSANTDYVIEPEDAATIGKLEYSE 502

Query: 649 SEDKLRQEQRSEICNIQLAHMSYDDHLLWLNGGSQNCKF-DVAEDDWNNEKFGFTKNYNN 707
                 +++R  IC IQ+AH   +D LLW N G +NCK  +VA+ D++      T+ Y +
Sbjct: 503 ------KDRRYSICAIQMAHTDSNDQLLWTNTGLRNCKIPEVAKKDFDENPKMMTEKYGS 556

Query: 708 VEELKKEYASFLEVEHAVIPTEKGGGWGKIDGRCKGYVWCARYSSYIKEYTYSNRVNIG- 766
           +E +K  Y + L+++  +IP  +   W +    C  Y +C           + + +NIG 
Sbjct: 557 LEVMKISYHAPLQIDGYLIPDPEEHEWQQTHV-CADYTYCG----------FVDELNIGY 605

Query: 767 ---KLVKFDEEEKKYIDSLNKIWWKASTD 792
              K+ +F +EEKK ++ ++KIW  A  +
Sbjct: 606 SKAKVHEFSDEEKKRLNKISKIWNNADVN 634

>Scas_643.19
          Length = 657

 Score =  201 bits (510), Expect = 6e-55,   Method: Compositional matrix adjust.
 Identities = 167/657 (25%), Positives = 287/657 (43%), Gaps = 126/657 (19%)

Query: 154 YKHFNELDLQTRCHFYFRTLYNMNAKWSNDHHLYTFDINEEIEGEKLKDMSDKDGVSLVN 213
           +KH + LD   +C F  R++YN +  W+N + L            + KD    D  ++V 
Sbjct: 113 WKHADRLD---QCRFLIRSMYNADMDWNNSNIL------------EFKDDEKADNTAIV- 156

Query: 214 KESLGLHKRLHDISLALERMRIYDECFIQNDSVDFEGIFTNXXXXXXXXXXXXXXQKRXX 273
                         L  ER+R+YD CFI    ++ + +F                     
Sbjct: 157 --------------LMSERIRLYDYCFISG-KLNLKQVFNEKLGVNVA------------ 189

Query: 274 XXXXXXXXXXXXXXXDQTEYYKNFDQWDLENRMFPFLKYYTHENFTNMMPILTSPNGSQL 333
                                   D  D ++RMFPF+K    +     +P +T+ N  + 
Sbjct: 190 ------------------------DVADFQHRMFPFMKKLNIDEM-GTIPKITNLNNGKD 224

Query: 334 ATGWFPIHNRKTGVAESFEQHKYDKSKSFWWNWNAISRKTAKRGIVISLGNGQVDYGIKL 393
            T   PI      V E+F  H           WN +S+    +GIVI++   + D  + L
Sbjct: 225 ET---PIFKDVKTVNENFFAH-----------WNEVSKG---KGIVINMKETEKDLFMSL 267

Query: 394 LATLRFQGNKLPIQVIHKG-DLSEDSVRKLTDVAQAAEFDIPPNSFDNTTDVKQELWFVD 452
           +ATL+   N LPIQ+I  G D  +++   +             N F  TTD  Q++  +D
Sbjct: 268 IATLQEVKNTLPIQIITTGQDFEKETFESM-------------NRFLQTTD--QQVSLID 312

Query: 453 VSTTLNPSVINE-FDRFKNKWLAVVFNLFDEFVFIDVDAISYVSIEDYFETSEYKDSGTV 511
            S+ L+   + E      +KW   +FN F+E V +D D++ +V+ E +F+  EYKD+G+ 
Sbjct: 313 CSSILDADFVKEHIASHLHKWFGTLFNTFEEVVILDADSVPFVAPETFFKNKEYKDAGSF 372

Query: 512 FFKDRSLGYGSDAK-CFAVFSTLMPKALESKYFQSFSMIDDDYVF---DQCHKYLTPEEK 567
           FF+D++LG     + C  +   + P   ES       +I+    F   +      +P   
Sbjct: 373 FFRDKTLGNERTYQYCIEMIEAMEPSKAES------GLINTKLKFTSNNPPEDNSSPAAS 426

Query: 568 IFKNFFENNHQHQMESGLVAIDKSQHIMPLVISTILNMSKKIGGCGHGDKEFFWLGFMVS 627
           ++  FF       ++SG+V + K + +  L++  ++N+  K+  C  G+KE FWLG +++
Sbjct: 427 VYNTFFGKYKHKNLDSGVVVLKKKEKLTSLLMGFMMNLDAKMKQCVSGEKELFWLGHLIA 486

Query: 628 GHRYSF---YDVEAAAVGKLIEKESEDKLRQEQRSEICNIQLAHMSYDDHLLWLNGGSQN 684
           G  Y+    +   A  VG +    ++ K   E    IC+ Q+AH++ DD +LW+NGG   
Sbjct: 487 GQDYAIDQWFGTIAGTVGSM----NDGKDGAESTLYICSTQVAHVNKDDDILWINGGLNT 542

Query: 685 CKF-DVAEDDWNNEKFGFTKNYNNVEELKKEYASFLEVEHAVIPTEKGGGWGKIDGRCKG 743
           CKF ++A  ++      F + Y     L+  Y S ++++  + P  +   W +ID  C+ 
Sbjct: 543 CKFKNIASKEFERSPSYFKQRYQVERNLQSVYDSAVKIDGLIKPDGRLNKWIQID-ECQR 601

Query: 744 YVWCARYSSYIKEYTYSNRVNIGK-LVKFDEEEKKYIDSLNKIW--WKASTDSILKR 797
            ++CA       E      V+  K L   D++ K  +  L  +W   KAS +   K+
Sbjct: 602 RMYCAFIGG--PEAAKPGAVDDSKTLYMLDKDGKSKLAGLTNVWRSMKASVNQPQKQ 656

>AFL235W [2960] [Homologous to ScYIL014W (MNT3) - NSH; ScYER001W
           (MNN1) - NSH] complement(2..1147) [1146 bp, 381 aa]
          Length = 381

 Score =  193 bits (490), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 115/361 (31%), Positives = 186/361 (51%), Gaps = 28/361 (7%)

Query: 393 LLATLRFQGNKLPIQVIHKGDLSEDSVRKLTDVAQAAEFDIPPNSFDNTTDVKQELWFVD 452
           LLA L   GN LPI+++     S + ++K+    +           D T   KQ L  VD
Sbjct: 1   LLAVLDHHGNTLPIELVLTESPSHERIQKIAHYLR-----------DKT---KQSLRIVD 46

Query: 453 VSTTLNPSVINEFDRFKNKWLAVVFNLFDEFVFIDVDAISYVSIEDYFETSEYKDSGTVF 512
               L PS       F+ KWLA + N  +E VFID+D + +VSI+ +FE   YK +G + 
Sbjct: 47  CKKILEPSYRPLIFDFRYKWLAYLLNSSEEVVFIDLDVVPFVSIDKFFEMEGYKSTGILM 106

Query: 513 FKDRSLGYGSDAKCFAVFSTLMPKALESKYFQSFSMIDDDYVFDQCHKYLTPEE----KI 568
           F+DR      ++KC      ++P   E   ++  +    +    +   +  P++     +
Sbjct: 107 FQDRVFNSIKNSKCRTAIHHILPSHAEQTLWKHQAKYTKEKAKHRLKNF--PDDAGAASV 164

Query: 569 FKNFFENNHQHQMESGLVAIDKSQHIMPLVISTILNMSKKIGGCGHGDKEFFWLGFMVSG 628
           +  + E +  H +ESGLV +DK + I  L+IS +L+M+  I  C +GDKE+ WLG +VSG
Sbjct: 165 YDRYLEGDRMHMVESGLVVVDKRKKISSLIISLMLHMN--IAECSYGDKEYLWLGQLVSG 222

Query: 629 HRYSFYDVEAAAVGKLIEKESEDKLRQEQRSEICNIQLAHMSYDDHLLWLNGGSQNCKF- 687
             Y  + +  A +G   E + ++K    ++ E+C+ Q+AHM +D  +LW+NGG QNCKF 
Sbjct: 223 EDYYIHPLPPAILGMPQEVKHDNK----KKYEVCSTQIAHMDHDGSILWVNGGMQNCKFP 278

Query: 688 DVAEDDWNNEKFGFTKNYNNVEELKKEYASFLEVEHAVIPTEKGGGWGKIDGRCKGYVWC 747
           + A+ +  +    F+  +++ E L+K Y S + ++ A IP      W  I   C  Y WC
Sbjct: 279 EFADSEVESNNEYFSSQHSDKEVLRKFYESPINIQMAFIPNLVDSNWHAI-ATCNSYTWC 337

Query: 748 A 748
           A
Sbjct: 338 A 338

>CAGL0C03960g complement(389250..391121) similar to sp|P40549
           Saccharomyces cerevisiae YIL014w MNT3, hypothetical
           start
          Length = 623

 Score =  189 bits (480), Expect = 5e-51,   Method: Compositional matrix adjust.
 Identities = 139/497 (27%), Positives = 232/497 (46%), Gaps = 50/497 (10%)

Query: 298 DQWDLENRMFPFLKYYTHENFTNMMPILTS-PNGSQLATGWFPIHNRKTGVAESFEQHKY 356
           D +D ++RMF FLK     +   M P++ +  NG  +A        R    A+ +     
Sbjct: 172 DPYDFQSRMFMFLKKVNRNDKAYMYPLIKNVRNGDIIAKP------RTKMSAKEY----- 220

Query: 357 DKSKSFWWNWNAISRKTAKRGIVISLGNGQVDYGIKLLATLRFQGNKLPIQVIHKGDLSE 416
             + +F  +W A +R    RGI +++    +     L   L   GN+ P++V+HKG    
Sbjct: 221 --NANFMGHWKAEARG---RGITLTVAPDDIKLLRSLFKVLEKLGNEYPVEVVHKGGEMT 275

Query: 417 DSVRKLTDVAQAAEFDIPPNSFDNTTDVKQELWFVDVSTTLNPSVINE-FDRFKNKWLAV 475
             +  L  + Q AE            +  QE++ +++S  L+P    E   RF NKWLA 
Sbjct: 276 PKMEDL--IRQYAE------------ETNQEVYVINLSPILDPDFAEENIKRFSNKWLAA 321

Query: 476 VFNLFDEFVFIDVDAISYVSIEDYFETSEYKDSGTVFFKDRSLGYGSDA--KCFAVFSTL 533
           +FN F+E + +D D + Y   + +FE   Y+D+G + +KDR +   +D   KC A+    
Sbjct: 322 MFNTFEEVMLLDADVVLYNHPDHFFELKGYQDTGLMLWKDREIT-DTDVYDKCTAMAPFF 380

Query: 534 MPKALESKYFQSFSMIDDDYVFDQCHKYLTPEEKIFKNFFENNHQHQMESGLVAIDKSQH 593
            P   E K   +           + H     E     ++F     + ++SG+V  +K Q 
Sbjct: 381 EPSLEEHKLLGTTQKYRLTGPSLEAHN--ESEATTLIDYFRKKRLNVIDSGVVIFNKKQK 438

Query: 594 IMPLVISTILNMSKKIGGCGHGDKEFFWLGFMVSGHRYSFYDVEAAAVGKLIEKESEDKL 653
           +  LV+S   ++++K  GC HGDKEFF  G + +G  Y      AAA+G +         
Sbjct: 439 LHALVLSNYYHINRKFLGCVHGDKEFFEFGVLAAGEDYHIAPQRAAALGPIGFHPGR--- 495

Query: 654 RQEQRSEICNIQLAHMSYDDHLLWLNGGSQNCKFDVAEDDWNNEKFGFTKNYNNVEELKK 713
              Q+  +C+ Q+ H   ++++LW NGG +NCK D AE D+      F   Y NV   K 
Sbjct: 496 ---QKYYVCSTQMGHPDENNNILWSNGGLKNCKLDKAEADFKRHPEYFKAKYGNVATAKV 552

Query: 714 EYASFLEVEHAVIPTEKGGGWGKIDGRCKGYVWCARYSSYIKEYTYSNRVNIGKLVKFDE 773
            Y   +E++  +IP  K   W +    C  Y +CA    ++++    + ++ GKLVKF E
Sbjct: 553 YYTYRVEIQGFIIPDVKKQEWFQYPD-CAHYWYCA----FLED--TPDSLSTGKLVKFTE 605

Query: 774 EEKKYIDSLNKIWWKAS 790
           +E +  + + K W+  +
Sbjct: 606 KEIERYNDIGKAWYHGT 622

>CAGL0C03982g complement(391909..393798) similar to sp|P40549
           Saccharomyces cerevisiae YIL014w MNT3, hypothetical
           start
          Length = 629

 Score =  188 bits (478), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 125/503 (24%), Positives = 237/503 (47%), Gaps = 56/503 (11%)

Query: 298 DQWDLENRMFPFLKYYTHENFTNMMPILTS-PNGSQLATGWFPIHNRKTGVAESFEQHKY 356
           D +D + RM  FL+  + ++   + P++ +  NG  +A     +  R             
Sbjct: 176 DAYDFQKRMVIFLRKTSSDDEAYLYPLIKNVRNGEIIAKPPTKLSPR------------- 222

Query: 357 DKSKSFWWNWNAISRKTAKRGIVISLGNGQVDYGIKLLATLRFQGNKLPIQVIHKGDLSE 416
           + + +F  +W    R++  +GI +++  G +     L   L+ QGN+ P+Q+I KG    
Sbjct: 223 EYNSNFMGHWK---RESKGKGITLTIAPGDIKLLRSLFKVLQRQGNEYPVQIIQKGGEMT 279

Query: 417 DSVRKLTDVAQAAEFDIPPNSFDNTTDVKQELWFVDVSTTLNPS-VINEFDRFKNKWLAV 475
             +  L                    + +Q+++ +D++  L+P+  I    +F+NKW A 
Sbjct: 280 PKMESLIK--------------KYALETEQDVYIIDLAPILDPAFAIQRITKFQNKWFAS 325

Query: 476 VFNLFDEFVFIDVDAISYVSIEDYFETSEYKDSGTVFFKDRSL-GYGSDAKCFAVFSTLM 534
           +FN F+E + +D D + Y   E +F+   Y+D+G + ++DR L    +  +C A+   L 
Sbjct: 326 MFNTFEEALLLDADVVLYTEPEHFFKMKGYQDTGLLLWRDRELTALETPDRCAALAPHLE 385

Query: 535 PKALESKYFQSFSMIDDDYVFDQCHKYLT----PEEKIFKNFFENNHQHQMESGLVAIDK 590
           P   E      +S++     +      L     PE +    +F       ++SG+V  +K
Sbjct: 386 PSVEE------YSLLGTRQKYRLTESSLKIHNEPEARTLYEYFHKKIVTIIDSGVVVYNK 439

Query: 591 SQHIMPLVISTILNMSKKIGGCGHGDKEFFWLGFMVSGHRYSFYDVEAAAVGKLIEKESE 650
            Q +  L+ +   ++S+K  GC +GDKE+F  G   +G  Y     +A+A+G +    ++
Sbjct: 440 RQKLHALMTAEYFHISRKFAGCVYGDKEYFEFGAFAAGEDYHIEKDKASAIGSIEYHSAK 499

Query: 651 DKLRQEQRSEICNIQLAHMSYDDHLLWLNGGSQNCKFDVAEDDWNNEKFGFTKNYNNVEE 710
           DK        IC+ Q+ H   +++LLW NGG  NCK + A DD+N     F   Y +V+ 
Sbjct: 500 DKYY------ICSAQMGHADENNNLLWSNGGLMNCKANSAADDFNENPKYFKAKYGDVKT 553

Query: 711 LKKEYASFLEVEHAVIPTEKGGGWGKIDGRCKGYVWCARYSSYIKEYTYSNRVNIGKLVK 770
           L+  Y+  ++++  +IP      W +    CK YV+CA    ++ +    +  N GKLV+
Sbjct: 554 LEAHYSKPIDIQGFIIPDISKHNWIQYP-ECKRYVYCA----FVADPPVDS--NTGKLVR 606

Query: 771 FDEEEKKYIDSLNKIWWKASTDS 793
           F  + ++    +  +W++ ++ S
Sbjct: 607 FSRKNRQIYKDIASVWFEGTSYS 629

>CAGL0C03938g complement(386673..388586) weakly similar to sp|P40549
           Saccharomyces cerevisiae YIL014w MNT3, hypothetical
           start
          Length = 637

 Score =  186 bits (472), Expect = 7e-50,   Method: Compositional matrix adjust.
 Identities = 136/499 (27%), Positives = 234/499 (46%), Gaps = 54/499 (10%)

Query: 298 DQWDLENRMFPFLKYYTHENFTNMMPILTSP-NGSQLATGWFPIHNRKTGVAESFEQHKY 356
           D +D ++RMF FLK     +   M P++ +  NG  +A        R    A+ +     
Sbjct: 185 DPYDFQSRMFMFLKKVNRNDKAYMYPLIKNVRNGDIIAKP------RTKMSAKEY----- 233

Query: 357 DKSKSFWWNWNAISRKTAKRGIVISLGNGQVDYGIKLLATLRFQGNKLPIQVIHKGDLSE 416
             + +F  +W A +R    RGI +++    +     L   L   GN+ P++V+HKG    
Sbjct: 234 --NANFMGHWKAEARG---RGITLTVAPDDIKLLRSLFKVLEKLGNEYPVEVVHKGGEMT 288

Query: 417 DSVRKLTDVAQAAEFDIPPNSFDNTTDVKQELWFVDVSTTLNPSVINE-FDRFKNKWLAV 475
             +  L  + Q AE            +  QE++ +++S  L+P   ++    FKNKW A 
Sbjct: 289 PKMEDL--IRQYAE------------ETNQEVYVINLSPILDPDFASQNIKSFKNKWFAA 334

Query: 476 VFNLFDEFVFIDVDAISYVSIEDYFETSEYKDSGTVFFKDRSLG-YGSDAKCFAVFSTLM 534
           +FN F+E + +DVD + Y S E +FE   YK +G + +KDR      +  +C ++     
Sbjct: 335 MFNTFEEAILLDVDVVLYASPEYFFELDGYKKTGLMLWKDREYTEVETSDRCASMAPYFE 394

Query: 535 PKALESKYF---QSFSMIDDDYVFDQCHKYLTPEEKIFKNFFENNHQHQMESGLVAIDKS 591
           P   E +     Q + +   D    + H     E     +FF N     ++SG+V I+K 
Sbjct: 395 PSEEEHELLGTIQKYRLTGPDL---ETHN--ESEATTLNDFFNNKLATIIDSGVVLINKK 449

Query: 592 QHIMPLVISTILNMSKKIGGCGHGDKEFFWLGFMVSGHRYSFYDVEAAAVGKLIEKESED 651
           Q +  L+++   +MSK  GGC +GDKE F +  + +G  Y     +A A+G +      +
Sbjct: 450 QKLNALLLAAYYHMSKYFGGCTYGDKELFEIAALAAGEDYYVDPNKAGAIGPIGYHPPRE 509

Query: 652 KLRQEQRSEICNIQLAHMSYDDHLLWLNGGSQNCKFDVAEDDWNNEKFGFTKNYNNVEEL 711
           K        +C+ Q+ H   +++LLW NGG +NCK D AE D+      F   Y +++ +
Sbjct: 510 KYY------VCSAQMGHPDENNNLLWSNGGLKNCKLDSAEADFKKLPKYFKAKYGSLDTV 563

Query: 712 KKEYASFLEVEHAVIPTEKGGGWGKIDGRCKGYVWCARYSSYIKEYTYSNRVNIGKLVKF 771
           K  Y    E++  ++P      W +    C+ Y++CA    +I +    +  N GKLV+F
Sbjct: 564 KLYYKGRSEIQGFIVPDIVKQKWIQYPD-CQHYLYCA----FITDPPEDD--NTGKLVRF 616

Query: 772 DEEEKKYIDSLNKIWWKAS 790
            EEE +  + + + W+  +
Sbjct: 617 SEEEMEKYNEIGRAWYAGT 635

>CAGL0C03916g complement(383989..385875) weakly similar to sp|P40549
           Saccharomyces cerevisiae YIL014w MNT3, hypothetical
           start
          Length = 628

 Score =  184 bits (467), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 131/506 (25%), Positives = 234/506 (46%), Gaps = 64/506 (12%)

Query: 298 DQWDLENRMFPFLKYYTHENFTNMMPILTSPNGSQLATGWFPIHNRKTGVAESFEQHKYD 357
           D +D + RMF FL+  T  +   + PI+ +    Q+ T     H + + +       +Y+
Sbjct: 176 DAYDFQGRMFMFLRNVTSTDEAYIYPIIKNVRNGQVTT---KPHTKLSPM-------QYN 225

Query: 358 KSKSFWWNWNAISRKTAKRGIVISLGNGQVDYGIKLLATLRFQGNKLPIQVIHKGDLSED 417
            +   +W      +++  RGI ++     V     L       GN  PIQ++ KG     
Sbjct: 226 SNFMAYW-----KQESKGRGIALTAAPKDVKLLRSLFKVFEKLGNTYPIQIVQKGGEMSP 280

Query: 418 SVRKLTDVAQAAEFDIPPNSFDNTTDVKQELWFVDVSTTLNPS-VINEFDRFKNKWLAVV 476
           ++  L                D   +  Q ++ VD+S  L+P    +   +F+NKW A +
Sbjct: 281 TMESLIK--------------DYAIETNQNVFIVDLSPVLDPDFATDHIRKFQNKWFASI 326

Query: 477 FNLFDEFVFIDVDAISYVSIEDYFETSEYKDSGTVFFKDRSLGYGSDAKCFAVFSTLMPK 536
           FN F+E + ID D + Y   E +F    YK++G + ++DR +    DAK     + + P 
Sbjct: 327 FNTFEEVMLIDADVVIYTEPESFFNLDGYKNTGLLLWRDREI---VDAKTHERCTDMAP- 382

Query: 537 ALESKYFQSFSMIDDDYVFDQCHKY-LT---------PEEKIFKNFFENNHQHQMESGLV 586
                YF+    +++  +     KY LT         PE +   +FF       ++SG+V
Sbjct: 383 -----YFEP--ALEEHRLLGTVQKYRLTGPSLETHDEPEAETLFDFFHRRIVTIIDSGVV 435

Query: 587 AIDKSQHIMPLVISTILNMSKKIGGCGHGDKEFFWLGFMVSGHRYSFYDVEAAAVGKLIE 646
             +K Q +  L+++   + SK+  GC +GDKE+F  G +V+G  Y     +A A+G +  
Sbjct: 436 IYNKKQKLHGLILAEYFHNSKQFAGCVYGDKEYFEFGALVAGEDYHVEAEKAVAIGAVGY 495

Query: 647 KESEDKLRQEQRSEICNIQLAHMSYDDHLLWLNGGSQNCKFDVAEDDWNNEKFGFTKNYN 706
               +K        +C+ Q+ H+  +++LLW NGG +NCK D AE D+      F   Y 
Sbjct: 496 HPPREKYY------VCSGQMGHVDRNNNLLWSNGGLKNCKSDCAEADFEKMPKYFKAKYG 549

Query: 707 NVEELKKEYASFLEVEHAVIPTEKGGGWGKIDGRCKGYVWCARYSSYIKEYTYSNRVNIG 766
            ++ +K+ Y   ++++  V+P  +   W +    C+ +++CA    +I +    +  N G
Sbjct: 550 TLKAVKEYYNGLMDIQGFVLPDVQKQKWVQYPD-CQQFLYCA----FITDPPEPD--NKG 602

Query: 767 KLVKFDEEEKKYIDSLNKIWWKASTD 792
           KLV+F +EEK   + + K W+  + D
Sbjct: 603 KLVRFSDEEKMRYNEIGKAWYSGAND 628

>CAGL0C04004g complement(394614..396512) similar to sp|P40549
           Saccharomyces cerevisiae YIL014w MNT3, hypothetical
           start
          Length = 632

 Score =  184 bits (466), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 142/590 (24%), Positives = 265/590 (44%), Gaps = 110/590 (18%)

Query: 213 NKESLGLHKRLH----DISLALERMRIYDECFIQNDSVDFEGIFTNXXXXXXXXXXXXXX 268
           N E +  HK++     ++ +++ER+RIY+ CF++                          
Sbjct: 133 NNEIVAAHKKVRVDEINMQVSVERIRIYNYCFLEGG------------------------ 168

Query: 269 QKRXXXXXXXXXXXXXXXXXDQTEYYKN-----FDQWDLENRMFPFLKYYTHENFTNMMP 323
                               D TE  K+     +D +D ++RMF FLK  T  +   + P
Sbjct: 169 -------------------LDVTEVLKDAGLSSYDAFDFQSRMFIFLKQVTKTDAKYLYP 209

Query: 324 ILTSPNGSQLATGWFPIHNRKTGVAESFEQHKYDKSKSFWWNWNAISRKTAKRGIVISLG 383
           I+ + N  ++ +              +  +   D + +F  NW  ++     +GI I++ 
Sbjct: 210 IIQNLNTEEIIS------------EPTTTKSPQDFNANFMANWRQLANG---KGIAITVN 254

Query: 384 NGQVDYGIKLLATLRFQGNKLPIQVIHKG-DLSEDSVRKLTDVAQAAEFDIPPNSFDNTT 442
              V++ I+L   L+  GN  PIQVI KG +L+   + ++   A                
Sbjct: 255 PDDVEFMIRLFRVLKELGNTYPIQVIQKGGELTSPLIEQIKKTA---------------I 299

Query: 443 DVKQELWFVDVSTTLNPSVINE-FDRFKNKWLAVVFNLFDEFVFIDVDAISYVSIEDYFE 501
           +  Q +  VD+S  L+     E    F NK+ A +FN F+E + +D D + YVS++++F 
Sbjct: 300 ETNQAVSIVDLSPILDEKFAREQITSFHNKFFAAMFNTFEEVLLLDADVVPYVSLDEFFN 359

Query: 502 TSEYKDSGTVFFKDRSLGYGSDAKCFAVFSTLMPKALESKYFQSFSMIDDDYVFDQCHKY 561
              YKD+G  F++DR+ G  +   C  +   L P   E     +      + +  +  K 
Sbjct: 360 LKGYKDTGLQFWRDRNRGSDTHKFCSNLGVYLEPSLEEHNLLGTELKFRINSLAKK--KV 417

Query: 562 LTPEEKIFKNFFENNHQHQMESGLVAIDKSQHIMPLVISTILNMSKKIGGCGHGDKEFFW 621
            + EE+ F  FF     H ++SG++ ++K Q +  L++  I   + + G C +GDKE F 
Sbjct: 418 RSSEERAFHRFFNELKVHNIDSGIIVLNKKQKLHSLIMGEIFYTNGRFGRCAYGDKEMFM 477

Query: 622 LGFMVSGHRYSFYDVEAAAVGKLIEKESEDKLRQEQRSE-ICNIQLAHMSYDDHLLWLNG 680
           +G   +G  +     +A  +G +           +QR   IC+ Q+ H+  ++ +LW NG
Sbjct: 478 MGAFATGADFIIDPRDAGIIGPI-------GYNIDQRVNFICSAQMGHLDENNRVLWSNG 530

Query: 681 GSQNCKF-DVAEDDWN--NEKFGFTKNYNNVEELKKEYASFLEVEHAVIPTEKGGGWGKI 737
           G + CKF D A+ D+   N+ + F + Y + + + + Y + +E+   +IP  +   W +I
Sbjct: 531 GLRFCKFPDFAKKDYTPKNQDY-FIQKYQSYDNMARIYKTKVEITGFIIPEVEKNEWMQI 589

Query: 738 DGRCKGYVWCARYSSYIKEYTYSNRVNIGKLV-KFDEEEKKYIDSLNKIW 786
              C+ Y++C            + +V+   L+ KF+ EEK+ ++ ++ +W
Sbjct: 590 PD-CQSYMYCG----------LAKKVDTKALILKFEGEEKERLNRISDVW 628

>CAGL0H09262g complement(908258..910135) similar to sp|P40549
           Saccharomyces cerevisiae YIL014w MNT3, hypothetical
           start
          Length = 625

 Score =  168 bits (426), Expect = 7e-44,   Method: Compositional matrix adjust.
 Identities = 143/572 (25%), Positives = 251/572 (43%), Gaps = 107/572 (18%)

Query: 228 LALERMRIYDECFIQNDSVDFEGIFTNXXXXXXXXXXXXXXQKRXXXXXXXXXXXXXXXX 287
           ++ ER+R+Y+ CF+QN S D   +F                                   
Sbjct: 141 MSAERVRLYNHCFLQN-SYDINEMFEKYRM------------------------------ 169

Query: 288 XDQTEYYKNFDQWDLENRMFPFLKYYTHENFTNMMPILTSPNGSQLATGWFPIHNRKTGV 347
                YY +    D + RMFPFL+  T  +   + P +T+    ++ TG  PI +     
Sbjct: 170 -----YYTS--PHDYQRRMFPFLRKVTAMDGYYIYPTITNLRTGEVQTG--PIADM---- 216

Query: 348 AESFEQHKYDKSKSFWWNWNAISRKTAKRGIVISLGNGQVDYGIKLLATLRFQGNKLPIQ 407
             S+++     + +F  +W     +   RGIV++       +        +  GN  PIQ
Sbjct: 217 --SYQEF----NSNFIAHW---KNEAKGRGIVVTASVNDCRFLRSQFFVWKELGNTYPIQ 267

Query: 408 VIHKG-DLSEDSVRKLTDVAQAAEFDIPPNSFDNTTDVKQELWFVDVSTTLNPSVINEF- 465
           V+ KG ++  + + K+ + A               T+  QE++ VD+   L+P+   ++ 
Sbjct: 268 VVTKGKEMPPELIAKIKEYA---------------TEADQEVYIVDLQNVLDPNYAEKYI 312

Query: 466 DRFKNKWLAVVFNLFDEFVFIDVDAISYVSIEDYFETSEYKDSGTVFFKDRSLGYGSDAK 525
           + F NKW A +FN F+E + +D D +SYV  ++YFE++++K +G   ++DR +    D  
Sbjct: 313 ENFHNKWYAAMFNTFEEAILVDADVVSYVHPDEYFESADFKKTGLKLWRDRDI---PDIH 369

Query: 526 CFAVFSTLMPKALESKYFQSFSMIDDDYVFDQCHKYLTPEEKI----------FKNFFEN 575
                  + P  L SK        ++        KY   EE +             FF  
Sbjct: 370 VHIYCLNMAPYFLPSK--------EEHRTLGTTLKYRLEEESLKDAGTSEADGLHKFFFE 421

Query: 576 NHQHQMESGLVAIDKSQHIMPLVISTILNMSKKIGGCGHGDKEFFWLGFMVSGHRYSFYD 635
                ++SGLV  +K + +  L+IS   +   K   C +GDKE F LG   +G  YS  D
Sbjct: 422 KSGSIVDSGLVVFNKKKKLHSLIISEFFHTDAKFKPCTYGDKEIFMLGAYSAGVDYSL-D 480

Query: 636 VEAAAVGKLIEKESEDKLRQEQRSEICNIQLAHMSYDDHLLWLNGGSQNCK-FDVAEDDW 694
            EAA +   I + +  K      + IC+ Q+ H +    LLW NGG Q CK  + A+DD+
Sbjct: 481 PEAAVIIGPIRESTNKKF-----NSICSAQMGHTNGRGKLLWSNGGLQVCKNPNFAKDDF 535

Query: 695 NNEKFGFTKNYNNVEELKKEYASFLEVEHAVIPTEKGGGWGKIDGRCKGYVWCARYSSYI 754
             +    + NY  +E+ +K Y S L ++  + P      + +    C  Y++C       
Sbjct: 536 EKDVKFMSNNYGTLEDTEKYYKSNLSIDGFISPNVPNLKFQQ-QPACHHYMYCVHMP--- 591

Query: 755 KEYTYSNRVNIGKLVKFDEEEKKYIDSLNKIW 786
                 +  ++G+LV+FD+E+++ ++ ++ +W
Sbjct: 592 -----VDGEDMGELVRFDQEQRERVNKISNVW 618

>CAGL0C03894g complement(381514..383397) weakly similar to sp|P40549
           Saccharomyces cerevisiae YIL014w MNT3, hypothetical
           start
          Length = 627

 Score =  167 bits (423), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 131/495 (26%), Positives = 226/495 (45%), Gaps = 46/495 (9%)

Query: 302 LENRMFPFLKYYTHENFTNMMPILTSPNGSQLATGWFPIHNRKTGVAESFEQHKYDK-SK 360
           L N  FPFLK   H +  +M P +T  N  ++             +  +F+    D  + 
Sbjct: 166 LLNDFFPFLK--AHTDGEHMWPEVTHLNKDKI-------------ILPNFDLEAVDTFNA 210

Query: 361 SFWWNWNAISRKTAKRGIVISLGNGQVDYGIKLLATLRFQGNKLPIQVIHKGD-LSEDSV 419
           +FW NW   +R    RGIV++    + +  +KL+A L    N+LPIQ++ +G+     ++
Sbjct: 211 NFWINWKKHARG---RGIVVTFKEEEANMMMKLIAVLGHLKNRLPIQIVIQGNKFGSRTI 267

Query: 420 RKLTDVAQAAEFDIPPNSFDNTTDVKQELWFVDVSTTLNPSVIN-EFDRFKNKWLAVVFN 478
             L + A                + KQ+++ VD +  L           + NKW+A +FN
Sbjct: 268 EMLKEKA---------------IEKKQQIYIVDATKLLMEKYAEVHIQGYTNKWIASIFN 312

Query: 479 LFDEFVFIDVDAISYVSIEDYFETSEYKDSGTVFFKDRSL-GYGSDAKCFAVFSTLMPKA 537
            F+EF+ +DVD + +++ + +FE   Y+ +G   ++DR+L       KC  + S      
Sbjct: 313 TFEEFILLDVDTVPFINPKKFFEKKGYRTTGFYMYQDRNLVNEKLGRKCVDIISGAQLSG 372

Query: 538 LESKYFQSFSMIDDDYVFDQCHKYLTPEEKIFKNFFENNHQHQMESGLVAIDKSQHIMPL 597
            E++   +   +   Y F +   Y T   + +   F N   HQ ES LV I+K Q +  L
Sbjct: 373 YEARVLNT-GFLYSPY-FAREDDYTTASARAYYKLFNNWTLHQAESVLVVINKKQKLGGL 430

Query: 598 VISTILNMSKKIGGCGHGDKEFFWLGFMVSGHRYSFYDVEAAAVGKLIEKESEDKLRQEQ 657
           ++S +LN    +  C  GDKEFFW+G +++   Y   +  A  VG L     E    Q  
Sbjct: 431 LMSFMLNTQIALKQCFLGDKEFFWIGQLMNNSPYYIDERPATIVGPLSSPTDE----QSN 486

Query: 658 RSEICNIQLAHMSYDDHLLWLNGGSQNCKF-DVAEDDWNNEKFGFTKNYNNVEELKKEYA 716
             +IC+ QL H+  D  L W+NGG Q CKF + A  D+ ++   F   + +   L+  Y 
Sbjct: 487 YYKICSAQLGHLGEDGKLDWVNGGMQVCKFKNAAMKDFTDDPEFFKSRHKDAAVLQNFYD 546

Query: 717 SFLEVEHAVIPTEKGGGWGKIDGRCKGYVWCARYSSYIKEYTYSNRVNIGKLVKFDEEEK 776
           S + ++  +        W  I   C+ Y++C          T +   ++   V+F ++  
Sbjct: 547 STVTLDGYMTADPPSCQWMNIR-ECQKYMYCIICDKKPSLGTAAPG-DMTPSVQFTDKYH 604

Query: 777 KYIDSLNKIWWKAST 791
             ++ + +IW + ST
Sbjct: 605 AQVNDIARIWSEEST 619

>ADR020C [1761] [Homologous to ScYIL014W (MNT3) - SH]
           (740415..742229) [1815 bp, 604 aa]
          Length = 604

 Score =  161 bits (408), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 142/635 (22%), Positives = 234/635 (36%), Gaps = 111/635 (17%)

Query: 154 YKHFNELDLQTRCHFYFRTLYNMNAKWSNDHHLYTFDINEEIEGEKLKDMSDKDGVSLVN 213
           +  + E  L+ RC  YFR  Y ++  W N   L         E +  KD+          
Sbjct: 68  FGGWGERSLRMRCKTYFRQTYEVHNAWENRLLLRN-------EDQYFKDIV--------- 111

Query: 214 KESLGLHKRLHDISLALERMRIYDECFIQNDSVDFEGIFTNXXXXXXXXXXXXXXQKRXX 273
                        SLA+ER+R+YDECFI       + +                      
Sbjct: 112 ------------ASLAMERLRVYDECFISGGLAVHDSML--------------------- 138

Query: 274 XXXXXXXXXXXXXXXDQTEYYKNFDQWDLENRMFPFLKYYTHENFTNMMPILTSPNGSQL 333
                                +   + +L  RMFPFL     ++   + P + +    + 
Sbjct: 139 ---------------------EPLTRIELRTRMFPFLAPSHRQDL--IWPTVINATSGR- 174

Query: 334 ATGWFPIHNRKTGVAESFEQHKYDKSKSFWWNWNAISRKTAKRGIVISLGNGQVDYGIKL 393
                  H R+     + E H+    +SFW+NW   +     RGI +++ +   D    L
Sbjct: 175 -------HIRRLLKISTGELHRIRPDRSFWYNWREFANG---RGIAVAVNDELADSFQAL 224

Query: 394 LATLRFQGNKLPIQVIHKGDLSEDSVRKLTDVAQAAEFDIPPNSFDNTTDVKQELWFVDV 453
           LA L   GN LP+Q  H G   E S R+  ++A   +              +Q+++FVD 
Sbjct: 225 LAVLDHLGNTLPVQAAHNG--GELSQRRFDELAAHIQ-----------AHSRQQVFFVDC 271

Query: 454 STTLNPSVINEFDRFKNKWLAVVFNLFDEFVFIDVDAISYVSIEDYFETSEYKDSGTVFF 513
           + TL    + +F R     LA +FN FDEFV +D  A+ +V         E+ D+  +FF
Sbjct: 272 TPTLRNMWLRKFARVPPSRLAALFNSFDEFVLLDASAVPFVPPAQLLALPEFADTAALFF 331

Query: 514 KDRSLGYGSDAKCFAVFSTLMPKALESKYFQS--FSMIDDDYVFDQCHKYLTPEEKIFKN 571
           K R+        C    + L+P A E++ ++                       +     
Sbjct: 332 KGRAYTTQPQRSCLHSMARLLPSAEEARLWRGAAAFNASGAAAAFNASGAAAARDGAAAA 391

Query: 572 FFENNHQHQMESGLVAIDKSQHIMPLVISTILNMSKKIGGCGHGDKEFFWLGFMVSGHRY 631
                    ++  LV + K + +  L+ + +L++  +  GC    +  F L        Y
Sbjct: 392 LVRAGLVDGLDHALVLVRKPRALAALLAALLLDLQPRAPGCRPHARSLFPLALHAMALPY 451

Query: 632 SFYDVEAAAVGKLIEKESEDKLRQEQRSEICNIQLAHMSYDDHLLWLNGGSQNCKFDVAE 691
           + +   A A+G+L      D         +C+ QLAH+     LLW +GG + C    A 
Sbjct: 452 AVHPGAAGALGELDPAAPADC------PVLCSAQLAHLDAAGRLLWASGGLRRCHTSDAR 505

Query: 692 DDWNNEKFGFTKNYNNVEELKKEYASFLEVEHAVIPTEKGGGWGKIDGRCKGYVWCARYS 751
            D+ +    F     + + L +  A  L V HA +      GW      C     CA   
Sbjct: 506 RDFRDNDAHFRPAPASPDGLAEARARPLSV-HAFLAPASPAGWTP-HPDCAHTTHCAALC 563

Query: 752 SYIKEYTYSNRVNIGKLVKFDEEEKKYIDSLNKIW 786
                   S  V +G L++F + E++    L +IW
Sbjct: 564 R-----QPSADVMLGTLLRFGQAERRRHADLTRIW 593

>CAGL0G04279g complement(404144..406126) weakly similar to sp|P40549
           Saccharomyces cerevisiae YIL014w MNT3, hypothetical
           start
          Length = 660

 Score =  143 bits (360), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 159/641 (24%), Positives = 273/641 (42%), Gaps = 132/641 (20%)

Query: 165 RCHFYFRTLYNMNAKWSNDHHLYTFDINEEIEGEKLKDMSDKDGVSLVNKESLGLHKRLH 224
           RC    + LY+ + KW+N   L              KDM+ K       K SL     LH
Sbjct: 125 RCSLLVKALYDGDPKWNNSEILVWN-----------KDMAMK-------KYSL-----LH 161

Query: 225 DISLALERMRIYDECFIQNDSVDFEGIFTNXXXXXXXXXXXXXXQKRXXXXXXXXXXXXX 284
            +    ER+R+Y+ CF+ +  VD   +F                                
Sbjct: 162 PV----ERIRMYNHCFL-DKGVDVIQVFKKLGLDEH------------------------ 192

Query: 285 XXXXDQTEYYKNFDQWDLENRMFPFLKYYTHENFTNMMPILTSPNGSQLATGWFPIHNRK 344
               + TE+          +RMFP  ++    +   + P LT      L TG       K
Sbjct: 193 ----NATEF---------NHRMFPMFQFVNVTSDQYLYPKLTD-----LRTG-------K 227

Query: 345 TGVAESFEQHKYDKSKSFWWNWNAISRKTAK-RGIVISLGNGQVDYGIKLLATLRFQGNK 403
                  +Q   + + +F  NW    R  AK +G+VI++ +  +    KL   L+  GN 
Sbjct: 228 VITKPKTKQRALEYNLNFLRNW----RNEAKGKGLVITIESNNLHILRKLFKFLKENGNT 283

Query: 404 LPIQVIHKGDLSEDSVRKLTDVAQAAEFDIPPNSFDNTTDVKQELWFVDVSTTLNPSV-I 462
           LPIQ++ K +++             A F     S+   +D  Q +  +++   ++ S   
Sbjct: 284 LPIQLVFKRNVT------------LARFKDAIISYAEESD--QHVTIIEIEALIDDSFNK 329

Query: 463 NEFDRFKNKWLAVVFNLFDEFVFIDVDAISYVSIEDYFETSEYKDSGTVFFKDRSLGYGS 522
             F  + +K+LA +FN F++ V +D++ I YV+ E+  E  EYK+SG   ++D+ LG   
Sbjct: 330 GTFVGYDDKFLASIFNTFEDVVMMDIEVIPYVNPEELLENEEYKNSGLYMWRDKYLGALL 389

Query: 523 DAK-CFAVFSTLMPKALESKYFQS-FSM-IDDDYVFDQCHKYLTPEEKIFKNFFENNHQH 579
            A  C  V  +L P   E K   S F + ++D  + D       P   I   ++     H
Sbjct: 390 HAYICTDVMKSLEPSMDEYKTIGSKFPLRMNDPRLTDTSD----PMGAILHGYYNLYLMH 445

Query: 580 QMESGLVAIDKSQHIMPLVISTILNMSKKIGGCGHGDKEFFWLGFMVSGHRYSFYDVEAA 639
           Q++ G++ ++K Q +  L++  ++NM +    C  G KE FW G  V+G  ++   ++A 
Sbjct: 446 QVDGGVILLNKKQKLGGLIMGMVMNMHRDYAHCSTGTKEAFWFGPYVAGMEFAVGTIDAG 505

Query: 640 AVGKLIEKESEDKLRQEQRSEICNIQLAHMSYDDHLLWLNGGSQNCKFDVAEDDWNNEKF 699
            +G +     ED+L      EIC+ Q+ H+ ++D LLW  G    C+ D  ++     + 
Sbjct: 506 IIGPIRRSTIEDRL---GVPEICSNQVIHVDHEDKLLWGKGTFYECESDKLQEIDIESEV 562

Query: 700 GFTK------NYNNVEELKKEYAS------FLEVEHAVIPTEKGGGWGKIDGRCKGYVWC 747
           G  K      + N V   ++++AS      FL +   +IP+     W    G    Y +C
Sbjct: 563 GIRKRSLPSTDVNVVRRDEQQFASKEPKRGFLAITGFIIPSRVVKKWKYRIGSSVEY-YC 621

Query: 748 ARYSSYIKEYTYSNRVNIG--KLVKFDEEEKKYIDSLNKIW 786
                     T+ +R+     KLV+FD++ K++++ L +IW
Sbjct: 622 ----------TFVDRIGDADSKLVRFDKKTKRFVNHLAQIW 652

>CAGL0C04026g complement(397303..399213) weakly similar to sp|P40549
           Saccharomyces cerevisiae YIL014w MNT3, hypothetical
           start
          Length = 636

 Score =  133 bits (335), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 115/472 (24%), Positives = 201/472 (42%), Gaps = 42/472 (8%)

Query: 325 LTSPNGSQLATGWFPIHNRKTGVAESFEQHKYDKSKS-----FWWNWNAISRKTAKRGIV 379
           L   +GS     +  I N +TGV    E+   D S S     F   W  +++    +GI 
Sbjct: 199 LKQTDGSTTEYLYPRIENLRTGVIT--EEPTTDLSVSEYNAKFIPTWRNMAKG---KGIA 253

Query: 380 ISLGNGQVDYGIKLLATLRFQGNKLPIQVIHKGDLSEDSVRKLTDVAQAAEFDIPPNSFD 439
           +S+   ++     L A L  QGNKLPIQ+I KG+        L D      + +  N   
Sbjct: 254 VSVSPKEIRMLHSLFAVLNQQGNKLPIQIIDKGE-----TLTLADKELIKSYAVKTN--- 305

Query: 440 NTTDVKQELWFVDVSTTLNPSVINE-FDRFKNKWLAVVFNLFDEFVFIDVDAISYVSIED 498
                 Q++  VD+S  ++    +E      NKW A +FN F+E + +DVD I +V  E 
Sbjct: 306 ------QDVSVVDLSPIIDAEYADENIIGMHNKWFAAMFNTFEEVLLLDVDVIPFVGTEK 359

Query: 499 YFETSEYKDSGTVFFKDRSLGYGSDAKCFAVFSTLMPKALESKYFQSFSMIDDDYVFDQC 558
           +F+   Y     +F+++R +   +   C      L P   E +  +  + +       Q 
Sbjct: 360 FFQLEPYTSRHILFWRNRDIKKKNPKYCPEAAIFLEPTTEEHQVLK--TDLHHKLFTKQV 417

Query: 559 HKYLTPEEKIFKNFFENNHQHQMESGLVAIDKSQHIMPLVISTILNMSKKIGGCGHGDKE 618
               T E+K    F      + ++ GL+  +K        I+ +L+       C     +
Sbjct: 418 RNPATSEDKALSEFCFQRKSNHVDPGLIVFNKKLRFQTFAITELLHQHDTFRACVGTGAD 477

Query: 619 FFWLGFMVSGHRYSFYDVEAAAVGKLIEKESEDKLRQEQRSEICNIQLAHMSYDDHLLWL 678
              LG   +G  +     +A  VG +   E+ DK+     + +C  Q+AH    D+LLW+
Sbjct: 478 ALILGAFAAGETFRLDPRDAGIVGSISYSEA-DKM-----NFVCGTQIAHNDDKDNLLWI 531

Query: 679 NGGSQNCK-FDVAEDDWNNEKFGFTKNYNNVEELKKEYASFLEVEHAVIPTEKGGGWGKI 737
           +GG + CK  D+  +D+  ++  +   Y N    +  Y S + ++  + P      W  I
Sbjct: 532 SGGGRTCKNPDLLVEDFAADEEYYEVRYGNYGNAETIYKSKIRIDGYLAPKVSQKEWVVI 591

Query: 738 DGRCKGYVWCARYSSYIKEYTYSNRVNIGKLVKFDEEEKKYIDSLNKIWWKA 789
              C   + CA   S +K+++       G+ +K+++E K  + +L  IW+ A
Sbjct: 592 PD-CGNTMRCAFVDSNVKDFS-------GRSIKYNDETKSRVTNLIDIWYNA 635

>KLLA0A11880g 1026919..1028190 some similarities with
           ca|CA0854|IPF8854 Candida albicans, hypothetical start
          Length = 423

 Score =  124 bits (311), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 86/251 (34%), Positives = 127/251 (50%), Gaps = 26/251 (10%)

Query: 301 DLENRMFPFLKYYTHENFTNMMPILTSPNGSQLATGWFPI-HNRKTGVAESFEQHKYDKS 359
           D+E R+FP         FT  +P+ T  +G   +   FPI  N      E   + +   +
Sbjct: 130 DIETRLFPM--------FTKKIPVFTRWDG--FSPDEFPILSNLPKDNIEHASRIEGSPT 179

Query: 360 KSFWWNWNAISRKTAK-----RGIVISLGNG-QVDYGIKLLATLRFQGNKLPIQVIHKGD 413
            SFW        +TAK     RGIVIS+ +G +V+    L+ TLR   N+LPIQV+HKGD
Sbjct: 180 GSFW--------RTAKERYNGRGIVISVSDGIRVNEVKSLMRTLRLLKNRLPIQVVHKGD 231

Query: 414 LSEDSVRKLTDVAQAAEFDIPPNSFDNTTDVKQELWFVDVSTTLNPSVINEFDRFKNKWL 473
           LS+ S+ ++ + A  A+  I     D   +  QE+WFV+    +    +  F RF NKW+
Sbjct: 232 LSDYSIGEIVN-AGRAKLTIEIGGEDLDVEYPQEVWFVNAGNCITQESLRLFQRFNNKWI 290

Query: 474 AVVFNLFDEFVFIDVDAISYVSIEDYFETSEYKDSGTVFFKDRSLGYGSDAKCFAVFSTL 533
           A +FN F+E + +D D    V+  + FET EY D+G  FF+DR L   +      +F  L
Sbjct: 291 ASLFNSFEEMILMDTDVAPVVNPAELFETKEYLDNGAHFFRDRLLNEYTKRSSVHLFKNL 350

Query: 534 MPKALESKYFQ 544
           M    E + F+
Sbjct: 351 MVSDKEYELFR 361

>KLLA0A11891g 1028064..1028672 similar to sp|P53059 Saccharomyces
           cerevisiae YGL257c MNT2 alpha-1, 3-mannosyltransferases
           responsible for adding the terminal mannose residues of
           O-linked oligosaccharides, hypothetical start
          Length = 202

 Score =  103 bits (257), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 66/215 (30%), Positives = 110/215 (51%), Gaps = 25/215 (11%)

Query: 581 MESGLVAIDKSQHIMPLVISTILNMSKKIGGCGHGDKEFFWLGFMVSGHR-YSFYDVEAA 639
           MESG+V I++S+++  L+I+T+L + +      HGDKE FWLG  +SG+  Y F     +
Sbjct: 1   MESGVVTINRSKNLPGLLIATVLQLWQPTSEPFHGDKELFWLGQSISGNEDYQFNRYAGS 60

Query: 640 AVGKLIEKESEDKLRQEQRSEICNIQLAHMSYDDHLLWLNGGSQNCKFDVAEDDWNNEKF 699
            +G L   + ED +       +C+ Q+ H   +  LLW+NGG + CKF  +  D++  K 
Sbjct: 61  DIGTLEHNDHEDSVH------VCSTQIGHFDENFRLLWINGGLKTCKFPSSGYDYSKNK- 113

Query: 700 GFTKNYNNVEELKKEYASFLEVEHAVIPT-------EKGGGWGK-IDGRCKGYVWCARYS 751
              + + + ++LKK Y S + ++ A++P         +G  + +  D  C GYVWCA  S
Sbjct: 114 ALRRVFQSADDLKKHYESAIVIDGALVPMYPLDIKKVQGSMFKQNYDLGCLGYVWCASNS 173

Query: 752 SYIKEYTYSNRVNIGKLVKFDEEEKKYIDSLNKIW 786
                          K V F+EE+   +  + K+W
Sbjct: 174 PGTPNV---------KTVSFNEEQIGSMRRIIKVW 199

>CAGL0B03003g 295997..297019 some similarities with sp|P40549
           Saccharomyces cerevisiae YIL014w MNT3, hypothetical
           start
          Length = 340

 Score =  100 bits (250), Expect = 8e-23,   Method: Compositional matrix adjust.
 Identities = 77/288 (26%), Positives = 137/288 (47%), Gaps = 15/288 (5%)

Query: 476 VFNLFDEFVFIDVDAISYVSIEDYFETSEYKDSGTVFFKDRSLGYGSDAKCFAVFSTLMP 535
           +FN F+E + ++ D   ++S    F++ +YK+SG  F+K R+    +      VF+  + 
Sbjct: 1   MFNTFEEALVMEPDVSFFLSANTVFDSEDYKNSGFKFWKGRNTRKDAQFPHCKVFTQALE 60

Query: 536 KALESKYFQSFSMIDDDYVFDQCHKYL----TPEEKIFKNFFENNHQHQMESGLVAIDKS 591
            +LE      F+MI  + V    +  L    T +EK   +++     H  ++G+  I+K 
Sbjct: 61  PSLEE-----FNMIHSELVVRLDNPSLESPNTEQEKALSSYYTYGGLHYADNGVYVINKK 115

Query: 592 QHIMPLVISTILNMSKKIGGCGHGDKEFFWLGFMVSGHRYSFYDVEAAAVGKLIEKESED 651
           Q    L+ +  L   KK   C  G+ EF WLG    G+ +    ++A  +G+ I+ ESE 
Sbjct: 116 QAFEGLLGAATLLSHKKYRRCSDGENEFMWLGMFTVGNNFVSDSIDAGILGE-IKLESEG 174

Query: 652 KLRQEQRSEICNIQLAHMSYDDHLLWLNGGSQNCKFD-VAEDDWNNEKFGFTKNYNNVEE 710
             R    + +C  Q++H      L+W   G   CKF+  A +D++ +   FT  Y +   
Sbjct: 175 PRR--GYAYVCGTQVSHSDDVGRLVWSKDGLVTCKFENAAHEDFSRDSQYFTDRYLDEHN 232

Query: 711 LKKEYASFLEVEHAVIPTEKGGGWGKIDGRCKGYVWCARYSSYIKEYT 758
           L + Y S L +   ++P  +   W +I   C+  ++CA Y  ++K  T
Sbjct: 233 LDEIYKSKLNINGFIVPDTRKNPWKQI-SECRATMYCA-YIPHLKSNT 278

>Kwal_33.13693
          Length = 558

 Score = 56.6 bits (135), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 62/263 (23%), Positives = 106/263 (40%), Gaps = 54/263 (20%)

Query: 380 ISLGNGQVDY-GIKLLATLRFQGNKLPIQVIHKGDLSEDSVRKLTDVAQAAEFDIPPNSF 438
           +++G G+       ++ T+R +G+ LPI+V+                       IPP   
Sbjct: 138 VTVGGGRFSLLSYTMIRTMRERGSTLPIEVV-----------------------IPPQDE 174

Query: 439 DNTTDVKQELW------FVDVSTTLNPSVINE--FDRFKNKWLAVVFNLFDEFVFIDVDA 490
                  QE+        V    TL PS++ +  F  ++ K +A++ + F + VFID D 
Sbjct: 175 KGEEHFCQEILPKLNGRCVFFGDTLPPSIVEDWKFKSYQIKVMALLLSSFKKIVFIDADD 234

Query: 491 ISYVSIEDYFETSEYKDSGTVFFKDRSLGYGSDAKCFAVFSTLMPKALESKYFQSFSMID 550
           +   +++D FE+  +K +G V + D  L     A  F   +      +++   +    + 
Sbjct: 235 LPLKNLDDVFESKVFKKNGLVLWPD--LWRRMTAPVFYRLAN-----IDTDLTKRVRNLG 287

Query: 551 DDYVFDQCHKYLTPEEK-----IFKNFFENNHQHQMESGLVAIDKSQHIMPLVISTILNM 605
           DD       +YL P  K      F +F         ESG + IDK +H   L+++   N+
Sbjct: 288 DD--ISPVSRYLNPNAKEQKPIPFHDFAGTIPDPTTESGQMVIDKVRHFQTLLLALYYNV 345

Query: 606 SKK--------IGGCGHGDKEFF 620
                       G  G GDKE F
Sbjct: 346 YGPDWYYALFSQGTAGEGDKETF 368

>Kwal_56.22779
          Length = 695

 Score = 50.8 bits (120), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 48/192 (25%), Positives = 87/192 (45%), Gaps = 21/192 (10%)

Query: 457 LNPSVINEFDRFKNKWLAVVFNLFDEFVFIDVDAISYVSIEDYFETSEYKDSGTVFFKD- 515
           L+P  ++  + ++ K +A+  + F+  + +D D     S+++YF   + K+ G + + D 
Sbjct: 271 LSPETLSHIEGYQIKAVALFVSQFERVLMLDADNYVVNSLDEYFTHQKLKEKGLILWPDY 330

Query: 516 -RSLGYGSDAKCFAVFSTLMPKALESKYFQSFSMIDDDYVFDQCHKYLTPEEKIFKNFFE 574
            R L +    K + + + L       +Y  S      D+V+ +  K     E  F +FF+
Sbjct: 331 WRRLHH---PKTYDIVN-LGVSTKSQRY--SIDNATPDFVYKKDAK-----ETPFHDFFD 379

Query: 575 NNHQHQMESGLVAIDKSQHIMPLVISTILNMSKKI--------GGCGHGDKEFFWLGFMV 626
                  ESG V IDK +H+  L+++   N + K         G  G GDK+ F LG  V
Sbjct: 380 ALPDGSTESGQVLIDKKKHLDSLLMTLYYNFNGKSYFYPLLGQGFAGEGDKDTFALGCRV 439

Query: 627 SGHRYSFYDVEA 638
                ++Y V+ 
Sbjct: 440 MHGPEAYYQVKT 451

>AER018C [2523] [Homologous to ScYBR015C (MNN2) - SH]
           (661035..662855) [1821 bp, 606 aa]
          Length = 606

 Score = 49.7 bits (117), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 65/302 (21%), Positives = 122/302 (40%), Gaps = 74/302 (24%)

Query: 369 ISRKTAKRGIVISLGNGQVD-YGIKLLATLRFQGNKLPIQVIHKGDLSEDSVRKLTDVAQ 427
           +S++      ++++G G+     + L+ +LR  G  LP++V+                  
Sbjct: 181 LSKRAYSGAGIVTVGGGKFSMLALLLIKSLRKVGTSLPVEVL------------------ 222

Query: 428 AAEFDIPPNS---FDNTTDVKQELWF--VDVSTTLNPSVINE--FDRFKNKWLAVVFNLF 480
                IPP     +D  + +  E+    + +   L P+VIN   F+ ++ K  A++ + F
Sbjct: 223 -----IPPGEEEEYDYCSKLLPEVGAKCIYLKDVLPPAVINNHYFEGYQLKSAAIIASSF 277

Query: 481 DEFVFIDVDAISYVSIEDYFETSEYKDSGTVFFKDRSLGYGSDAKCFAVFSTLMPKALES 540
            + + +D D I  ++++D F++  Y + G V + D           F   ST       S
Sbjct: 278 KDLLLLDADNIPILNLDDIFQSKPYVEHGLVLWPD-----------FWRRST-------S 319

Query: 541 KYFQSFSMIDDDY---VFDQCHKYLTPEEKIFKNF--FENNHQHQM---------ESGLV 586
             +   + +  DY   V +     LTP     +N     +   H M         ESG +
Sbjct: 320 PDYYEIARVQVDYNRRVRNHIDN-LTPASVYTQNMKDLSSIPMHDMEGTLPDPSTESGQL 378

Query: 587 AIDKSQHIMPLVISTILNMSKKI--------GGCGHGDKEFFWLGFMVSGHRYSFYDVEA 638
            IDK +H+  +++S   N++ +         G  G GDKE F      + +R  +Y V  
Sbjct: 379 LIDKERHLSTVLLSLYYNVNGETWYYPLFSQGAPGEGDKETFIAA--ANFYRKPYYQVRT 436

Query: 639 AA 640
           + 
Sbjct: 437 ST 438

>CAGL0M02871g 324009..325811 similar to sp|P46982 Saccharomyces
           cerevisiae YJL186w MNN5 or sp|P38069 Saccharomyces
           cerevisiae YBR015c TTP1, hypothetical start
          Length = 600

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 61/273 (22%), Positives = 107/273 (39%), Gaps = 55/273 (20%)

Query: 379 VISLGNGQVD-YGIKLLATLRFQGNKLPIQVIHKGDLSEDSVRKLTDVAQAAEFDIP--- 434
           +++LG G+     + ++ T+R  G+ LP++V+      ED            EFD     
Sbjct: 167 IVTLGGGRYTILAMLMIETVRRHGSTLPVEVMFP---PEDE----------GEFDFCNNW 213

Query: 435 -PNSFDNTTDVKQELWFVDVSTTLNPSVINEFDRFKNKWLAVVFNLFDEFVFIDVDAISY 493
            P        + QE+ F      L       F  ++ K LA++   F +FVFID D  + 
Sbjct: 214 LPKHNGRCVMMSQEVPF----EILQKDKEVRFKSYQIKSLALLLTSFKQFVFIDADNNAM 269

Query: 494 VSIEDYFETSEYKDSGTVFFKDRSLGYGSDAKCFAVFSTLMPKALESKYFQSFSMIDDDY 553
            +I+  F+T  +K  G + + D         K F          ++    +    ++DD 
Sbjct: 270 KNIDHIFDTEAFKTHGLILWPDL-------WKRFTNPGFYDIAGVKYDLGKRVRNVNDDA 322

Query: 554 ----VFDQCHKYLTP-----EEKIFKNFFENNHQHQM---------ESGLVAIDKSQHIM 595
                +D  H   T       E+I K+ +E+     +         ESG + +D  +H+ 
Sbjct: 323 SPPETYDPNHSIYTTHDLKQREEIAKHLYEDVSLADLDGTIADTTTESGQMMVDNKKHLS 382

Query: 596 PLVISTILNM--------SKKIGGCGHGDKEFF 620
            L+++   N+           +G  G GDKE F
Sbjct: 383 TLLLALYYNIYGPDLYYYMMSMGTAGEGDKETF 415

>KLLA0C16467g 1442002..1443825 weakly similar to sp|P46982
           Saccharomyces cerevisiae YJL186w MNN5 putative
           mannosyltransferase, start by similarity
          Length = 607

 Score = 40.8 bits (94), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 38/153 (24%), Positives = 63/153 (41%), Gaps = 37/153 (24%)

Query: 373 TAKRGIVISLGNGQVDYGIKLLATLRFQGNKLPIQVIHKGDLSEDSVRKLTDVAQAAEFD 432
             KRGIV   G         ++  +R  G+KLPI+V+                       
Sbjct: 160 ATKRGIVTVGGRRYSLLSYLMINMVRRSGSKLPIEVV----------------------- 196

Query: 433 IPPNSFDNTTDVKQELWF----------VDVSTTLNPSVINEFDRFKNKWLAVVFNLFDE 482
           IPP+    T   +  L F          +  S   N SV +    ++ K +A++ + F E
Sbjct: 197 IPPDDEPETEFCESILQFNARCIYFKDRLPTSLLANLSVKS----YQVKGIALLLSSFQE 252

Query: 483 FVFIDVDAISYVSIEDYFETSEYKDSGTVFFKD 515
           FV ID D +   +I++ F+ + ++D G V + D
Sbjct: 253 FVLIDSDNMPLKNIDEVFDYNVFRDHGMVIWPD 285

>AEL148W [2358] [Homologous to ScYJL186W (MNN5) - SH]
           complement(351089..352810) [1722 bp, 573 aa]
          Length = 573

 Score = 40.8 bits (94), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 61/277 (22%), Positives = 110/277 (39%), Gaps = 56/277 (20%)

Query: 379 VISLGNGQVD-YGIKLLATLRFQGNKLPIQVIHKGDLSEDSVRKLTDVAQAAEFDIPPNS 437
           ++++G G+     + ++  LR +G  LP++V    D ++D                   S
Sbjct: 153 IVTVGGGRYSILAMVMIRALRKRGTTLPVEVFLTDDDADDEAF---------------CS 197

Query: 438 FDNTTDVKQELWFVDVSTTLNPSVI--NEFDRFKNKWLAVVFNLFDEFVFIDVDAISYVS 495
           +    + K  L+    S  L  SV+   +   F+ K +A++ + + + +FID D +    
Sbjct: 198 YIEHFNAKCVLF----SDRLPKSVLASQKLSGFELKAVALLLSSYQQVIFIDADNVPLKP 253

Query: 496 IEDYFETSEYKDSGTVFFKD-----------RSLGYGSDAKCFAVFST--LMPKALESKY 542
           ++D F++    + G V + D              G   D K    FS   + P    S+Y
Sbjct: 254 LDDVFKSKPLAEYGLVLWPDIWKRVTAPAFYDIAGIPVDFKRRVRFSADDVSPP---SRY 310

Query: 543 FQSFSMIDDDYVFDQCHKYLTPEEKIFKNFFENNHQHQMESGLVAIDKSQHIMPLVISTI 602
            +   +   D  F++ H  L        +F     +   ESG + IDK++H+  L++   
Sbjct: 311 TKPGEV---DESFNRAHVPL-------HDFAGTMPELSSESGQLLIDKARHMDTLLLILY 360

Query: 603 LNMSKK--------IGGCGHGDKEFFWLGFMVSGHRY 631
            N+  K         G  G GDKE F +     G  Y
Sbjct: 361 YNVHGKHLFYRLSTQGTSGEGDKETFAMAAQALGKPY 397

>Scas_576.9
          Length = 507

 Score = 37.4 bits (85), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 57/273 (20%), Positives = 112/273 (41%), Gaps = 37/273 (13%)

Query: 377 GIVISLGNGQVDYGIKLLATLRFQGNKLPIQVIHKGDLSEDSVRKLTDVAQAAEF-DIPP 435
           GIV+  G         ++ T+R  G  LP++V    D          +V + AEF     
Sbjct: 191 GIVLVAGGKFSLLSYLVVKTIRKFGTTLPVEVFIPPD----------EVEEEAEFCKTML 240

Query: 436 NSFDNTTDVKQELWFVDVSTTLNPSVINEFD--RFKNKWLAVVFNLFDEFVFIDVDAISY 493
           N FD           V +S  L  S+I+ FD   ++ K LA++ + F+  + +D D    
Sbjct: 241 NEFDAKC--------VYISDILPESMISHFDFKGYQFKSLAIIASSFENLLLLDADNFPV 292

Query: 494 VSIEDYFETSEYKDSGTVFFKDRSLGYGSDAKCFAVFSTLMPKALESKYFQSFSMIDDDY 553
            ++++ F+   Y  +G + + D      +    F   + +    L+ +   +   +    
Sbjct: 293 KNLDNIFQQEPYTTTGLILWPD--FWRRTTQPMFYEIAGISVN-LQKRVRNAIDNLTPVQ 349

Query: 554 VFDQCHKYLTPEEKIFKNFFENNHQHQMESGLVAIDKSQHIMPLVISTILNMSK------ 607
           V+D+  + +   +  + +F         ESG + ++K +H+  ++++   N++       
Sbjct: 350 VYDKSDQEM---DVPYHDFEGAMPDVSTESGELMVNKVEHLKTVLLALYYNVNGPNWYYP 406

Query: 608 --KIGGCGHGDKEFFWLGFMVSGHRYSFYDVEA 638
               G  G GDKE F  G   + +   FY V+ 
Sbjct: 407 IFSQGLAGEGDKETFIAG--ATFYNLPFYQVKT 437

>CAGL0I04532g 404659..406497 similar to sp|P38069 Saccharomyces
           cerevisiae YBR015c TTP1 type II membrane protein, start
           by similarity
          Length = 612

 Score = 36.6 bits (83), Expect = 0.076,   Method: Compositional matrix adjust.
 Identities = 55/286 (19%), Positives = 107/286 (37%), Gaps = 63/286 (22%)

Query: 379 VISLGNGQVDY-GIKLLATLRFQGNKLPIQVIHKGDLSEDSVRKLTDVAQAAEFDIPPNS 437
           ++++G G+     + ++  LR  G  LP++V    D  E                   ++
Sbjct: 178 IVTVGGGKFTLMALTMIKALRTLGTTLPVEVFIPPDEGE-------------------ST 218

Query: 438 FDNTTDVKQELWFVDVSTTLNPSVINEFD--RFKNKWLAVVFNLFDEFVFIDVDAISYVS 495
           F  +   +     + +S  L   +I +F    ++ K LA++ + F+  + +D D I    
Sbjct: 219 FCESVLPQYNAKCIYISDILPDDMIQKFTFKGYQFKSLAMITSSFENLLLLDADNIPVKK 278

Query: 496 IEDYFETSEYKDSGTVFFKD-------------RSLGYGSDAKCFAVFSTLMPKALESKY 542
           I+  FE+  ++ +G + + D              +L Y  + +    F  + P  + +K 
Sbjct: 279 IDHIFESQIFRSAGLILWPDFWRRTTMPAYYEIANLPYNQNKRVRNAFDDITPPEVYTK- 337

Query: 543 FQSFSMIDDDYVFDQCHKYLTPEEKIFKNFFENNHQHQMESGLVAIDKSQHIMPLVISTI 602
                  D D             E  F +          ESG + I K++H+  L++S  
Sbjct: 338 ------PDGDL-----------SEVPFHDMEGTLPDPSTESGQLLISKAKHLPTLLLSLY 380

Query: 603 LNMSK--------KIGGCGHGDKEFFWLGFMVSGHRYSFYDVEAAA 640
            N++              G GDKE F      S +  S+Y V+ + 
Sbjct: 381 YNVNGPNWYYPIFSQRTAGEGDKETFISA--ASFYSLSYYQVKTSV 424

>Scas_716.77
          Length = 608

 Score = 35.8 bits (81), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 62/288 (21%), Positives = 109/288 (37%), Gaps = 61/288 (21%)

Query: 361 SFWWNWN--AISRKTAKRGIVISLGNGQVDY-GIKLLATLRFQGNKLPIQVIHKGDLSED 417
           SF  N N   + + T K   ++ +G G+       ++ T+R  G  LPI+V         
Sbjct: 171 SFTENLNKLVLPKGTYKGDGIVLVGGGKFSLLSYLVIKTIRNLGTTLPIEVF-------- 222

Query: 418 SVRKLTDVAQAAEFDIPPNSFDNTTD-VKQELWFVD-----VSTTLNPSVIN--EFDRFK 469
                          IPPN  +  ++   Q +  +D     +S  L   +++  EF  ++
Sbjct: 223 ---------------IPPNEVEGESEFCSQTISDLDAKCIYISDILPKDMVSKFEFKGYQ 267

Query: 470 NKWLAVVFNLFDEFVFIDVDAISYVSIEDYFETSEYKDSGTVFFKD--RSLGYGSDAKCF 527
            K LA++ + F+  + +D D     ++   F+   Y   G V + D  R        K  
Sbjct: 268 FKSLAIIASSFENLLLLDADNTPIKNLNTIFKQEPYASRGLVLWPDFWRRTTQPIYYKIA 327

Query: 528 AVFSTLMPKALESKYFQSFSMIDDDYVFDQCHKYLTPE--EKIFKNFFENNHQHQMESGL 585
            +   L  +            IDD         Y  P+  +  F +F         ESG 
Sbjct: 328 GIPVNLQKRVRND--------IDD---LTPVGVYTKPDMVDIPFHDFEGTMPDVSTESGQ 376

Query: 586 VAIDKSQHIMPLVISTILNM----------SKKIGGCGHGDKEFFWLG 623
           + ++KS+H+  ++++   N+          S+K    G GDKE F  G
Sbjct: 377 LMVNKSKHLATVLLALYYNVNGPNWYYPIFSQK--AAGEGDKETFIAG 422

>KLLA0E17831g complement(1572985..1574901) some similarities with
           sp|P38069 Saccharomyces cerevisiae YBR015c TTP1 type II
           membrane protein, hypothetical start
          Length = 638

 Score = 35.8 bits (81), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 30/145 (20%), Positives = 59/145 (40%), Gaps = 31/145 (21%)

Query: 379 VISLGNGQVDY-GIKLLATLRFQGNKLPIQVIHKGDLSEDSVRKLTDVAQAAEFDIPP-- 435
           ++++G G+       ++ T+R  G  LP++V                        IPP  
Sbjct: 222 IVTVGGGKFSMMAFLIIKTVRNFGTTLPVEVF-----------------------IPPSD 258

Query: 436 ---NSFDNTTDVKQELWFVDVSTTLNPSVI--NEFDRFKNKWLAVVFNLFDEFVFIDVDA 490
              + F N    +     + +S    P +I  ++F  ++ K LA++ + F   + +D D 
Sbjct: 259 EGDDEFCNVLLPQYNAKCIYLSDAFPPDLIEKSDFKGYQFKSLAIIASSFKNLLLLDADN 318

Query: 491 ISYVSIEDYFETSEYKDSGTVFFKD 515
                ++  FE   YKD+G + + D
Sbjct: 319 FPIKPLDGIFEEKSYKDTGLILWPD 343

>CAGL0G09867g complement(942215..944149) similar to sp|Q06623
           Saccharomyces cerevisiae YPR179c PLO1, start by
           similarity
          Length = 644

 Score = 33.9 bits (76), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 19/75 (25%), Positives = 39/75 (52%), Gaps = 4/75 (5%)

Query: 470 NKWLAVVFNLFDEFVFIDVDAISYVSIEDYFETSEYKDSGTVFFKDRSLGYGSDAKC--- 526
           N WL    +L+ + +   + ++ Y  I  YFET++YK+   +    ++L + S+      
Sbjct: 30  NYWLPTTMSLYQKELTDQIVSLHYSDILRYFETTDYKED-VILESMKTLCHNSELVATHP 88

Query: 527 FAVFSTLMPKALESK 541
           F +   +MPK+L ++
Sbjct: 89  FLLIDHMMPKSLGTR 103

>Sklu_2306.4 , Contig c2306 6263-8488 reverse complement
          Length = 741

 Score = 33.1 bits (74), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 44/218 (20%), Positives = 87/218 (39%), Gaps = 28/218 (12%)

Query: 429 AEFDIPPNSFDNTTDVKQELWFVD---------VSTTLNPSVINEFDRFKNKWLAVVFNL 479
            E  IPP+  ++    K  L  VD          S      ++ +   ++ K LA++ + 
Sbjct: 288 VEIMIPPSDDEDVEFCKNVLPKVDPTGLTRCVFFSDIFEEEILKDIKGYQLKALALLVSS 347

Query: 480 FDEFVFIDVDAISYVSIEDYFETSEYKDSGTVFFKD--RSLGYGSDAKCFAVFSTLMPKA 537
           F + + +D D     SIE++F++  + + G V + D  R L +    K + +        
Sbjct: 348 FRKVLMLDADNYVVNSIENFFDSPVFNEKGLVLWPDFWRRLHH---PKFYEII------G 398

Query: 538 LESKYFQSFSMIDDDYVFDQCHKYLTPEEKIFKNFFENNHQHQMESGLVAIDKSQHIMPL 597
           ++    +S     D+    + ++    +   F +   +      ESG + +DK +H+  L
Sbjct: 399 IDVNRNESIRYSIDNVTPPEVYRDNDDDSIPFHDLANSIPDISTESGQLLVDKQKHLDTL 458

Query: 598 VISTILNMSKKI--------GGCGHGDKEFFWLGFMVS 627
           ++S   N +           G  G GDK+ F     V+
Sbjct: 459 LLSCYYNYNGPSFYYPLLGQGYAGEGDKDTFIAAAHVT 496

>KLLA0F24574g complement(2285387..2287522) weakly similar to
           sp|P38069 Saccharomyces cerevisiae YBR015c TTP1 type II
           membrane protein, start by similarity
          Length = 711

 Score = 32.7 bits (73), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 33/160 (20%), Positives = 65/160 (40%), Gaps = 16/160 (10%)

Query: 480 FDEFVFIDVDAISYVSIEDYFETSEYKDSGTVFFKDRSLGYGSDAKCFAVFSTLMPKALE 539
           F++ + +D D     S+ ++F+   ++++G + + D    Y        ++  +  K  +
Sbjct: 308 FEKVLLLDADNYVINSLGNFFDGDIFRETGLILWPD----YWRRVHSPKLYDIVDIKVQD 363

Query: 540 SKYFQSFSMIDDDYVFDQCHKYLTPEEKIFKNFFENNHQHQMESGLVAIDKSQHIMPLVI 599
                S   I +  +F +      P +  F +          ESG + ++K+ H+  L++
Sbjct: 364 KLARYSTDYITNSRLFPESD----PAKIPFHDLEGAIPDGSTESGQLLVNKASHLDALIL 419

Query: 600 STILNMSKKI--------GGCGHGDKEFFWLGFMVSGHRY 631
           S   N +           G  G GDK+ F L   V  HRY
Sbjct: 420 SLYYNYNGPSYYYRLLGQGISGEGDKDTFILAATVLKHRY 459

>Kwal_56.23117
          Length = 607

 Score = 32.0 bits (71), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 17/65 (26%), Positives = 32/65 (49%), Gaps = 2/65 (3%)

Query: 453 VSTTLNPSVIN--EFDRFKNKWLAVVFNLFDEFVFIDVDAISYVSIEDYFETSEYKDSGT 510
           +S  L   +I+  EF  ++ K +A++ + FD  + +D D      +++ F    YK  G 
Sbjct: 242 ISDVLPQEIIDNFEFKGYQFKSIAIIASSFDNLLLLDADNFPIKDLDNVFNEEPYKSKGM 301

Query: 511 VFFKD 515
           V + D
Sbjct: 302 VLWPD 306

>YJL186W (MNN5) [2738] chr10 (80153..81913) Mannosyltransferase
           required for forming and extending the mannose branches
           of the outer chain mannans [1761 bp, 586 aa]
          Length = 586

 Score = 32.0 bits (71), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 65/319 (20%), Positives = 124/319 (38%), Gaps = 71/319 (22%)

Query: 341 HNRKTGVAESFEQ--HKYDKSKSFWWNWNAISRKTAKRGI--VISLGNGQVD-YGIKLLA 395
           +N    V ES  +   K+  + S   N++   R+    G   ++++G G+       ++ 
Sbjct: 110 YNLNKTVQESLREVHSKFTDTLSGKLNFSIPQREALFSGSEGIVTIGGGKYSVLAYTMIK 169

Query: 396 TLRFQGNKLPIQVI-HKGDLSEDSVRKLTDVAQAAEFDIPPNSFDNTTDVKQELWFVDVS 454
            LR  G  LPI+VI    D  ED   K        +F+             + ++F D+ 
Sbjct: 170 KLRDTGTTLPIEVIIPPQDEGEDDFCK----NWLPKFN------------GKCIYFSDIV 213

Query: 455 TTLNPSVINEFDRFKNKWLAVVFNLFDEFVFIDVDAISYVSIEDYFETSEYKDSGTVFFK 514
            +  P    +   F+ K   ++ + F   +F+D D  +  +++  F T+ + D+G + + 
Sbjct: 214 PS-KPLSDLKLTHFQLKVFGLIISSFKRIIFLDADNYAVKNLDLAFNTTSFNDTGLILWP 272

Query: 515 D---------------RSLGYGSDAKCFAVFSTLMPKALESKYFQSFSMIDDDYVFDQCH 559
           D                S+  G   +   V   + P +     +  F    +DY      
Sbjct: 273 DFWRRVTPPAFYNIIGSSINIGKRVRF--VSDDISPVS----RYDPFVSNSNDY------ 320

Query: 560 KYLTPEEKIFKNFFENNHQHQM---------ESGLVAIDKSQHIMPLVISTILNMSKKI- 609
              TP+E+  ++F ++   H +         ESG + IDK +H   L+++   N+     
Sbjct: 321 ---TPKERQ-EHFLKHVPLHDLDGTMPDLSSESGQMVIDKIRHFNTLLLALYYNVYGPTW 376

Query: 610 -------GGCGHGDKEFFW 621
                  G  G GDK+ F+
Sbjct: 377 YYKMISQGTAGEGDKDTFF 395

>AEL082W [2424] [Homologous to ScYBR015C - NSH]
           complement(474072..476117) [2046 bp, 681 aa]
          Length = 681

 Score = 31.2 bits (69), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 30/146 (20%), Positives = 61/146 (41%), Gaps = 23/146 (15%)

Query: 377 GIVISLGNGQVDYGIKLLATLRFQG-----NKLPIQVIHKGDLSEDSV--RKLTDVAQAA 429
           GIVI  G  +    I  + ++R        N +PI+V+  G   E+ V   K+  V    
Sbjct: 180 GIVILGGGHKTIAAIPAIRSIRENSGITVRNSMPIEVVIPGPADEEKVFCSKILPV---- 235

Query: 430 EFDIPPNSFDNTTDVKQELWFVDVSTTLNPSVINEFDRFKNKWLAVVFNLFDEFVFIDVD 489
              + P+              V +  T++ S++++     ++ LA++ + F   +++D  
Sbjct: 236 ---LDPSGLTRC---------VHLGDTISSSLLSKVKPSDHRTLALLASSFSRVLYLDSS 283

Query: 490 AISYVSIEDYFETSEYKDSGTVFFKD 515
                +I+ YF    + + G V + D
Sbjct: 284 VQVINAIDGYFHHELFNERGLVLWPD 309

>CAGL0A00869g 87841..90396 similar to sp|Q06163 Saccharomyces
           cerevisiae YLR318w EST2 catalytic subunit of the
           telomerase, hypothetical start
          Length = 851

 Score = 30.8 bits (68), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 20/84 (23%), Positives = 42/84 (50%), Gaps = 6/84 (7%)

Query: 168 FYFRTLYNMNAKWSNDHHLYTFDINEEIEGEKLKDMSDKDGVSLVNKESLGLHKRLHDIS 227
           FY R++  +N K  N+   Y   +N  I     + M D    + + KE +     L +  
Sbjct: 536 FYVRSVTILNTK--NNEVRYDTIVNGHINIRDFEIMVDNSTTTFLTKEDI---MDLIEFE 590

Query: 228 LALERMRIYDECFIQNDSVDFEGI 251
           + +  +R++D+C+++ D + F+G+
Sbjct: 591 MEMTSIRLFDKCYLRKDGL-FQGL 613

>ABR099C [690] [Homologous to ScYMR047C (NUP116) - SH; ScYKL068W
           (NUP100) - SH] (562151..565510) [3360 bp, 1119 aa]
          Length = 1119

 Score = 30.8 bits (68), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 12/30 (40%), Positives = 16/30 (53%)

Query: 546 FSMIDDDYVFDQCHKYLTPEEKIFKNFFEN 575
           FS   D+ +   CHK   P++K FKN   N
Sbjct: 875 FSSETDEIILASCHKLFNPDKKSFKNLVLN 904

>YBR015C (MNN2) [208] chr2 complement(267672..269465)
           Mannosyltransferase required for forming and extending
           the mannose branches of the outer chain mannans [1794
           bp, 597 aa]
          Length = 597

 Score = 30.0 bits (66), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 34/149 (22%), Positives = 58/149 (38%), Gaps = 23/149 (15%)

Query: 371 RKTAKRGIVISLGNGQVDY-GIKLLATLRFQGNKLPIQV-IHKGDLSEDSVRKLTDVAQA 428
           + T K   + ++G G+       ++ TLR  G  LP++V I  GD  E            
Sbjct: 165 KGTYKGSGIATVGGGKFSLMAFLIIKTLRNMGTTLPVEVLIPPGDEGE------------ 212

Query: 429 AEFDIPPNSFDNTTDVKQELWFVDVSTTLNPSVINE--FDRFKNKWLAVVFNLFDEFVFI 486
                    F N    K     + VS  L    I +  F  ++ K LA++ + F+  + +
Sbjct: 213 -------TEFCNKILPKYNSKCIYVSDILPRETIEKFVFKGYQFKSLALIASSFENLLLL 265

Query: 487 DVDAISYVSIEDYFETSEYKDSGTVFFKD 515
           D D      +++ F    Y  +G V + D
Sbjct: 266 DADNFPIKPLDNIFNEEPYVSTGLVMWPD 294

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.319    0.135    0.416 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 27,751,890
Number of extensions: 1289269
Number of successful extensions: 4104
Number of sequences better than 10.0: 67
Number of HSP's gapped: 4041
Number of HSP's successfully gapped: 76
Length of query: 797
Length of database: 16,596,109
Length adjustment: 110
Effective length of query: 687
Effective length of database: 12,788,129
Effective search space: 8785444623
Effective search space used: 8785444623
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 66 (30.0 bits)