Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Sklu_2193.41021024501e-59
YER058W (PET117)1071033182e-39
KLLA0C08327g1031003112e-38
Scas_715.521071013061e-37
CAGL0J02926g1271012915e-35
ADL076W1131022862e-34
Kwal_23.5805102982816e-34
Kwal_27.1189273975650.33
CAGL0M06919g95649611.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Sklu_2193.4
         (102 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Sklu_2193.4 YER058W, Contig c2193 6568-6876                           177   1e-59
YER058W (PET117) [1488] chr5 (271766..272089) Protein involved i...   127   2e-39
KLLA0C08327g complement(730884..731195) similar to sp|Q02771 Sac...   124   2e-38
Scas_715.52                                                           122   1e-37
CAGL0J02926g 281301..281684 similar to sp|Q02771 Saccharomyces c...   116   5e-35
ADL076W [1665] [Homologous to ScYER058W (PET117) - SH] complemen...   114   2e-34
Kwal_23.5805                                                          112   6e-34
Kwal_27.11892                                                          30   0.33 
CAGL0M06919g complement(703702..706572) similar to sp|P53971 Sac...    28   1.1  

>Sklu_2193.4 YER058W, Contig c2193 6568-6876
          Length = 102

 Score =  177 bits (450), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 90/102 (88%), Positives = 90/102 (88%)

Query: 1   MSRASKIXXXXXXXXXXXXVIGVHIVQDMERQTLHQGPIKDAKRVAEKKLAKEEQNQDPS 60
           MSRASKI            VIGVHIVQDMERQTLHQGPIKDAKRVAEKKLAKEEQNQDPS
Sbjct: 1   MSRASKITLALSCLLTTTTVIGVHIVQDMERQTLHQGPIKDAKRVAEKKLAKEEQNQDPS 60

Query: 61  KQRMKLVNKGEHELQQELRKKYEAMQPLSGEVLTKDGEVVKK 102
           KQRMKLVNKGEHELQQELRKKYEAMQPLSGEVLTKDGEVVKK
Sbjct: 61  KQRMKLVNKGEHELQQELRKKYEAMQPLSGEVLTKDGEVVKK 102

>YER058W (PET117) [1488] chr5 (271766..272089) Protein involved in
           assembly of cytochrome oxidase [324 bp, 107 aa]
          Length = 107

 Score =  127 bits (318), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 65/103 (63%), Positives = 75/103 (72%), Gaps = 2/103 (1%)

Query: 1   MSRASKIXXXXXXXXXXXXVIGVHIVQDMERQTLHQGPIKDAKRVAEKKLAKEE--QNQD 58
           MSRASKI            V+GVH VQ+MER+TLHQGPIKDAKRV EK+L K     + D
Sbjct: 1   MSRASKITFAASCLITAATVVGVHYVQEMERETLHQGPIKDAKRVEEKRLRKTNGVASLD 60

Query: 59  PSKQRMKLVNKGEHELQQELRKKYEAMQPLSGEVLTKDGEVVK 101
           P+K+R +  N  EHE Q+ELRKKYE MQPLSGEV+TKDGEVVK
Sbjct: 61  PTKERKRYFNMSEHEEQKELRKKYETMQPLSGEVVTKDGEVVK 103

>KLLA0C08327g complement(730884..731195) similar to sp|Q02771
           Saccharomyces cerevisiae YER058w PET117 cytochrome c
           oxidase assembly factor singleton, start by similarity
          Length = 103

 Score =  124 bits (311), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 64/100 (64%), Positives = 75/100 (75%), Gaps = 1/100 (1%)

Query: 1   MSRASKIXXXXXXXXXXXXVIGVHIVQDMERQTLHQGPIKDAKRVAEKKLAKEEQNQDPS 60
           MSRASKI            V+GVH VQ++ERQTLHQGPIKDA+RVAEKKLA++    DP 
Sbjct: 1   MSRASKITLGLTTLFTATIVVGVHHVQELERQTLHQGPIKDAQRVAEKKLARQ-NGVDPE 59

Query: 61  KQRMKLVNKGEHELQQELRKKYEAMQPLSGEVLTKDGEVV 100
           K+R ++VNK EHE Q ELRKKYE MQPLSGEV TKD E++
Sbjct: 60  KERQRMVNKNEHEYQLELRKKYEQMQPLSGEVRTKDNELI 99

>Scas_715.52
          Length = 107

 Score =  122 bits (306), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 63/101 (62%), Positives = 74/101 (73%), Gaps = 1/101 (0%)

Query: 1   MSRASKIXXXXXXXXXXXXVIGVHIVQDMERQTLHQGPIKDAKRVAEKKLAKEEQNQDPS 60
           MSRASKI             +GVH VQ MER TLHQGPIKDAKRVAEKK  KE    DP+
Sbjct: 1   MSRASKITFALTCVFTITTTVGVHYVQGMERDTLHQGPIKDAKRVAEKKRLKE-SGLDPA 59

Query: 61  KQRMKLVNKGEHELQQELRKKYEAMQPLSGEVLTKDGEVVK 101
           K++ ++ N+ EHELQ+EL+K+YE  QPLSGEV+TKDGEVVK
Sbjct: 60  KEKKRMFNQSEHELQKELKKQYEQQQPLSGEVVTKDGEVVK 100

>CAGL0J02926g 281301..281684 similar to sp|Q02771 Saccharomyces
           cerevisiae YER058w PET117, start by similarity
          Length = 127

 Score =  116 bits (291), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 62/101 (61%), Positives = 72/101 (71%), Gaps = 5/101 (4%)

Query: 1   MSRASKIXXXXXXXXXXXXVIGVHIVQDMERQTLHQGPIKDAKRVAEKKLAKEEQNQDPS 60
           MSRASKI            +IGVH VQ++ER+TLHQGPIKDAKRVAEKK     +     
Sbjct: 32  MSRASKITFGVSCAVTLATIIGVHYVQELERETLHQGPIKDAKRVAEKK-----KLMPAG 86

Query: 61  KQRMKLVNKGEHELQQELRKKYEAMQPLSGEVLTKDGEVVK 101
               KL+N+ EHELQQELRKKYE+MQPLSGEV+T+DGE VK
Sbjct: 87  TDEKKLLNRSEHELQQELRKKYESMQPLSGEVVTQDGERVK 127

>ADL076W [1665] [Homologous to ScYER058W (PET117) - SH]
           complement(550058..550399) [342 bp, 113 aa]
          Length = 113

 Score =  114 bits (286), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 57/102 (55%), Positives = 71/102 (69%), Gaps = 3/102 (2%)

Query: 1   MSRASKIXXXXXXXXXXXXVIGVHIVQDMERQTLHQGPIKDAKRVAEKKLAKEEQNQDPS 60
           MSRASKI            V+ VH+VQ+MER  L QGPIKDA R AEK+    E++ DP 
Sbjct: 14  MSRASKITLALCTAASAATVVTVHLVQEMERDALKQGPIKDALRTAEKR---AERDADPE 70

Query: 61  KQRMKLVNKGEHELQQELRKKYEAMQPLSGEVLTKDGEVVKK 102
             R K++N  EHELQ ELR+KY AMQPLSGEV+T+DG+VV++
Sbjct: 71  AARKKMLNASEHELQLELRRKYAAMQPLSGEVVTQDGDVVER 112

>Kwal_23.5805
          Length = 102

 Score =  112 bits (281), Expect = 6e-34,   Method: Compositional matrix adjust.
 Identities = 59/98 (60%), Positives = 68/98 (69%), Gaps = 7/98 (7%)

Query: 1  MSRASKIXXXXXXXXXXXXVIGVHIVQDMERQTLHQGPIKDAKRVAEKKLAKEEQNQDPS 60
          MS ASKI            VIGVH VQ++ER TLHQGPIKDAKR+A++K   E       
Sbjct: 1  MSTASKITLALSCVLTTATVIGVHYVQELERDTLHQGPIKDAKRIADRKAEME------- 53

Query: 61 KQRMKLVNKGEHELQQELRKKYEAMQPLSGEVLTKDGE 98
           +R K  N+ EHELQQELR+KYEA+QPLSGEVLTKDGE
Sbjct: 54 NERKKRFNESEHELQQELRRKYEALQPLSGEVLTKDGE 91

>Kwal_27.11892
          Length = 739

 Score = 29.6 bits (65), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 35/75 (46%), Gaps = 11/75 (14%)

Query: 27  QDMERQTLHQGP--IKDAKRVAEKKLAKEEQNQDPSKQRMKLVNKGEHELQQELRKKY-- 82
           Q M+R  L   P  I +A+R AE K    E+N + S Q + L +KG   L+      Y  
Sbjct: 88  QKMDRADLQATPRSIPEAERSAETKSRSTEKNAERSVQLVNLSSKGSGGLKSSPWSPYKS 147

Query: 83  -------EAMQPLSG 90
                   ++QPL+G
Sbjct: 148 ERNATIRSSVQPLTG 162

>CAGL0M06919g complement(703702..706572) similar to sp|P53971
           Saccharomyces cerevisiae YNL023c FAP1, start by
           similarity
          Length = 956

 Score = 28.1 bits (61), Expect = 1.1,   Method: Composition-based stats.
 Identities = 15/49 (30%), Positives = 25/49 (51%), Gaps = 4/49 (8%)

Query: 25  IVQDMERQTLHQGPIKDAKRVAEKKLAKE----EQNQDPSKQRMKLVNK 69
           ++ D  R +LH  P++  +R   ++LAK      ++QDP   R   V K
Sbjct: 755 LIDDNNRTSLHFKPMRPPQRYFIRELAKAYNLYSESQDPEPNRSVFVKK 803

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.309    0.126    0.330 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 2,707,375
Number of extensions: 99854
Number of successful extensions: 1014
Number of sequences better than 10.0: 118
Number of HSP's gapped: 975
Number of HSP's successfully gapped: 139
Length of query: 102
Length of database: 16,596,109
Length adjustment: 73
Effective length of query: 29
Effective length of database: 14,068,995
Effective search space: 408000855
Effective search space used: 408000855
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.7 bits)
S2: 54 (25.4 bits)