Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Sklu_2193.31281286633e-91
Kwal_23.58041411286045e-82
KLLA0C08349g1401285967e-81
ADL077C1421285446e-73
Scas_704.341481275447e-73
Scas_715.531281285253e-70
YIL051C (MMF1)1451285212e-69
CAGL0M12386g1421264771e-62
YER057C (HMF1)1291284515e-59
Kwal_23.28071291071546e-14
Kwal_47.16590126991537e-14
Kwal_55.212471341031416e-12
KLLA0B14817g1311161242e-09
KLLA0E03894g1371031075e-07
CAGL0M04521g688891035e-06
AGL164W68679973e-05
YLR143W68587956e-05
KLLA0D16984g69681850.001
Kwal_27.1131068887850.002
Scas_715.33101851660.53
CAGL0M08448g92173612.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Sklu_2193.3
         (128 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Sklu_2193.3 YIL051C, Contig c2193 5846-6232 reverse complement        259   3e-91
Kwal_23.5804                                                          237   5e-82
KLLA0C08349g 731629..732051 highly similar to sp|P40185 Saccharo...   234   7e-81
ADL077C [1664] [Homologous to ScYIL051C (MMF1) - SH; ScYER057C (...   214   6e-73
Scas_704.34                                                           214   7e-73
Scas_715.53                                                           206   3e-70
YIL051C (MMF1) [2616] chr9 complement(257842..258279) Protein im...   205   2e-69
CAGL0M12386g 1234993..1235421 similar to sp|P40037 Saccharomyces...   188   1e-62
YER057C (HMF1) [1487] chr5 complement(270735..271124) Protein th...   178   5e-59
Kwal_23.2807                                                           64   6e-14
Kwal_47.16590                                                          64   7e-14
Kwal_55.21247                                                          59   6e-12
KLLA0B14817g 1301705..1302100 similar to sp|Q8XCD0 Escherichia c...    52   2e-09
KLLA0E03894g complement(364475..364888) some similarities with s...    46   5e-07
CAGL0M04521g 496157..498223 similar to tr|Q12429 Saccharomyces c...    44   5e-06
AGL164W [4148] [Homologous to ScYLR143W - SH] complement(388842....    42   3e-05
YLR143W (YLR143W) [3552] chr12 (427330..429387) Protein containi...    41   6e-05
KLLA0D16984g 1439669..1441759 similar to sgd|S0004133 Saccharomy...    37   0.001
Kwal_27.11310                                                          37   0.002
Scas_715.33                                                            30   0.53 
CAGL0M08448g complement(841439..844204) highly similar to sp|P36...    28   2.3  

>Sklu_2193.3 YIL051C, Contig c2193 5846-6232 reverse complement
          Length = 128

 Score =  259 bits (663), Expect = 3e-91,   Method: Compositional matrix adjust.
 Identities = 128/128 (100%), Positives = 128/128 (100%)

Query: 1   MSTLTPVRTQLAPPPAASYSQAIKVNNMVFVSGQIPYTHENKPVEGSIADKAEQVIQNVK 60
           MSTLTPVRTQLAPPPAASYSQAIKVNNMVFVSGQIPYTHENKPVEGSIADKAEQVIQNVK
Sbjct: 1   MSTLTPVRTQLAPPPAASYSQAIKVNNMVFVSGQIPYTHENKPVEGSIADKAEQVIQNVK 60

Query: 61  NILEEANSSLNKIVKVNVFLADINDFAEFNGVYAKYFNEHKPARSCVAVKSLPLNVDLEM 120
           NILEEANSSLNKIVKVNVFLADINDFAEFNGVYAKYFNEHKPARSCVAVKSLPLNVDLEM
Sbjct: 61  NILEEANSSLNKIVKVNVFLADINDFAEFNGVYAKYFNEHKPARSCVAVKSLPLNVDLEM 120

Query: 121 EVIAVEKD 128
           EVIAVEKD
Sbjct: 121 EVIAVEKD 128

>Kwal_23.5804
          Length = 141

 Score =  237 bits (604), Expect = 5e-82,   Method: Compositional matrix adjust.
 Identities = 112/128 (87%), Positives = 122/128 (95%)

Query: 1   MSTLTPVRTQLAPPPAASYSQAIKVNNMVFVSGQIPYTHENKPVEGSIADKAEQVIQNVK 60
           MSTLTPVRTQL+PPPAASYSQA++VN MVFVSGQIPYT ENK VEG+IADKAEQVIQNV+
Sbjct: 14  MSTLTPVRTQLSPPPAASYSQAMRVNKMVFVSGQIPYTAENKRVEGTIADKAEQVIQNVR 73

Query: 61  NILEEANSSLNKIVKVNVFLADINDFAEFNGVYAKYFNEHKPARSCVAVKSLPLNVDLEM 120
           NILEEANS L+KIVKVN+FLADI DFAEFNGVY KYFNEHKPARSCVAVK+LPL+VDLEM
Sbjct: 74  NILEEANSGLDKIVKVNIFLADIKDFAEFNGVYGKYFNEHKPARSCVAVKALPLDVDLEM 133

Query: 121 EVIAVEKD 128
           EV+AVEKD
Sbjct: 134 EVVAVEKD 141

>KLLA0C08349g 731629..732051 highly similar to sp|P40185
           Saccharomyces cerevisiae YIL051c MMD1 required for
           maintenance of mitochondrial DNA, start by similarity
          Length = 140

 Score =  234 bits (596), Expect = 7e-81,   Method: Compositional matrix adjust.
 Identities = 114/128 (89%), Positives = 121/128 (94%)

Query: 1   MSTLTPVRTQLAPPPAASYSQAIKVNNMVFVSGQIPYTHENKPVEGSIADKAEQVIQNVK 60
           M+TLTPV+TQLAPPPAASYSQAIKVNN++FVSGQIPYT ENKPVEGSIADKAEQVIQNVK
Sbjct: 13  MNTLTPVKTQLAPPPAASYSQAIKVNNLIFVSGQIPYTAENKPVEGSIADKAEQVIQNVK 72

Query: 61  NILEEANSSLNKIVKVNVFLADINDFAEFNGVYAKYFNEHKPARSCVAVKSLPLNVDLEM 120
           NIL EANS L+KIVKVN+FLADIN FAEFN VYAKYFN HKPARSCVA K+LPLNVDLEM
Sbjct: 73  NILVEANSDLDKIVKVNIFLADINSFAEFNSVYAKYFNVHKPARSCVAAKALPLNVDLEM 132

Query: 121 EVIAVEKD 128
           EVIAVEKD
Sbjct: 133 EVIAVEKD 140

>ADL077C [1664] [Homologous to ScYIL051C (MMF1) - SH; ScYER057C
           (HMF1) - SH] (549526..549954) [429 bp, 142 aa]
          Length = 142

 Score =  214 bits (544), Expect = 6e-73,   Method: Compositional matrix adjust.
 Identities = 98/128 (76%), Positives = 114/128 (89%)

Query: 1   MSTLTPVRTQLAPPPAASYSQAIKVNNMVFVSGQIPYTHENKPVEGSIADKAEQVIQNVK 60
           MS+LTPVRT  APPPAASYSQA++ N MVFVSGQIPYT +NKPVEGS+ADK EQVI NV+
Sbjct: 15  MSSLTPVRTTAAPPPAASYSQAMRANGMVFVSGQIPYTPDNKPVEGSVADKTEQVIANVR 74

Query: 61  NILEEANSSLNKIVKVNVFLADINDFAEFNGVYAKYFNEHKPARSCVAVKSLPLNVDLEM 120
           N+LE +NS L+++ KVNVFLAD+  FAEFN VYAKYF EHKPARSCVAV++LPLNVDLEM
Sbjct: 75  NVLEASNSGLDRVAKVNVFLADMAYFAEFNSVYAKYFGEHKPARSCVAVRALPLNVDLEM 134

Query: 121 EVIAVEKD 128
           EVIA+E+D
Sbjct: 135 EVIALERD 142

>Scas_704.34
          Length = 148

 Score =  214 bits (544), Expect = 7e-73,   Method: Compositional matrix adjust.
 Identities = 103/127 (81%), Positives = 117/127 (92%)

Query: 1   MSTLTPVRTQLAPPPAASYSQAIKVNNMVFVSGQIPYTHENKPVEGSIADKAEQVIQNVK 60
           ++TLTPV T+LAPP AASYSQA+K NN V+VSGQIPYT ENKPVEG+I+DKAEQV QN+K
Sbjct: 18  LTTLTPVSTKLAPPAAASYSQAMKANNFVYVSGQIPYTPENKPVEGTISDKAEQVFQNIK 77

Query: 61  NILEEANSSLNKIVKVNVFLADINDFAEFNGVYAKYFNEHKPARSCVAVKSLPLNVDLEM 120
           NIL+E+ SS++KIVKVNVFLADIN+F EFNGVYAKYFN HKPARSCVAVK LPLNVDLE+
Sbjct: 78  NILKESGSSMDKIVKVNVFLADINNFKEFNGVYAKYFNVHKPARSCVAVKDLPLNVDLEV 137

Query: 121 EVIAVEK 127
           EVIAVEK
Sbjct: 138 EVIAVEK 144

>Scas_715.53
          Length = 128

 Score =  206 bits (525), Expect = 3e-70,   Method: Compositional matrix adjust.
 Identities = 100/128 (78%), Positives = 111/128 (86%)

Query: 1   MSTLTPVRTQLAPPPAASYSQAIKVNNMVFVSGQIPYTHENKPVEGSIADKAEQVIQNVK 60
           M+TLTPV  + AP  AASYS A+K NN++F+SGQIP T ENKPVEGSIADKAEQVIQN+K
Sbjct: 1   MTTLTPVTCKNAPSAAASYSHAMKANNLIFLSGQIPMTAENKPVEGSIADKAEQVIQNIK 60

Query: 61  NILEEANSSLNKIVKVNVFLADINDFAEFNGVYAKYFNEHKPARSCVAVKSLPLNVDLEM 120
           N+LE +NSSL KIVKVN+FLADIN FAEFN VYAKYFN HKPARSCVAV +LPLN DLEM
Sbjct: 61  NVLEASNSSLEKIVKVNIFLADINSFAEFNTVYAKYFNVHKPARSCVAVAALPLNADLEM 120

Query: 121 EVIAVEKD 128
           EVIAVE D
Sbjct: 121 EVIAVEND 128

>YIL051C (MMF1) [2616] chr9 complement(257842..258279) Protein
           important for maintenance of mitochondrial DNA, may be
           involved in isoleucine-dependent transaminase activity,
           member of the p14.5 family [438 bp, 145 aa]
          Length = 145

 Score =  205 bits (521), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 99/128 (77%), Positives = 115/128 (89%)

Query: 1   MSTLTPVRTQLAPPPAASYSQAIKVNNMVFVSGQIPYTHENKPVEGSIADKAEQVIQNVK 60
           ++TLTPV T+LAPP AASYSQA+K NN V+VSGQIPYT +NKPV+GSI++KAEQV QNVK
Sbjct: 18  ITTLTPVSTKLAPPAAASYSQAMKANNFVYVSGQIPYTPDNKPVQGSISEKAEQVFQNVK 77

Query: 61  NILEEANSSLNKIVKVNVFLADINDFAEFNGVYAKYFNEHKPARSCVAVKSLPLNVDLEM 120
           NIL E+NSSL+ IVKVNVFLAD+ +FAEFN VYAK+F+ HKPARSCV V SLPLNVDLEM
Sbjct: 78  NILAESNSSLDNIVKVNVFLADMKNFAEFNSVYAKHFHTHKPARSCVGVASLPLNVDLEM 137

Query: 121 EVIAVEKD 128
           EVIAVEK+
Sbjct: 138 EVIAVEKN 145

>CAGL0M12386g 1234993..1235421 similar to sp|P40037 Saccharomyces
           cerevisiae YER057c HIG1 Heat-shock induceable Inhibiter
           of cell Growth, hypothetical start
          Length = 142

 Score =  188 bits (477), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 96/126 (76%), Positives = 113/126 (89%)

Query: 1   MSTLTPVRTQLAPPPAASYSQAIKVNNMVFVSGQIPYTHENKPVEGSIADKAEQVIQNVK 60
           +S LTPV +  APP AASYS A+KVNN+++VSGQIPYT +NKPVEGSI+DKAEQVIQNV+
Sbjct: 15  LSKLTPVISANAPPAAASYSHAMKVNNLIYVSGQIPYTKDNKPVEGSISDKAEQVIQNVQ 74

Query: 61  NILEEANSSLNKIVKVNVFLADINDFAEFNGVYAKYFNEHKPARSCVAVKSLPLNVDLEM 120
           NIL+++NS LN+IVKVN+FLAD+N+FAEFN VYAKYFN HKPARSCVAV +LPL VDLEM
Sbjct: 75  NILKDSNSDLNRIVKVNIFLADMNNFAEFNKVYAKYFNVHKPARSCVAVAALPLGVDLEM 134

Query: 121 EVIAVE 126
           EVIA E
Sbjct: 135 EVIATE 140

>YER057C (HMF1) [1487] chr5 complement(270735..271124) Protein that
           inhibits cell growth and contributes to cell death at
           high temperature, member of the p14.5 family [390 bp,
           129 aa]
          Length = 129

 Score =  178 bits (451), Expect = 5e-59,   Method: Compositional matrix adjust.
 Identities = 93/128 (72%), Positives = 111/128 (86%)

Query: 1   MSTLTPVRTQLAPPPAASYSQAIKVNNMVFVSGQIPYTHENKPVEGSIADKAEQVIQNVK 60
           ++TLTPV  + AP  AASYS A+KVNN++F+SGQIP T +NK VEGSIADKAEQVIQN+K
Sbjct: 2   VTTLTPVICESAPAAAASYSHAMKVNNLIFLSGQIPVTPDNKLVEGSIADKAEQVIQNIK 61

Query: 61  NILEEANSSLNKIVKVNVFLADINDFAEFNGVYAKYFNEHKPARSCVAVKSLPLNVDLEM 120
           N+LE +NSSL+++VKVN+FLADIN FAEFN VYAKYFN HKPARSCVAV +LPL VD+EM
Sbjct: 62  NVLEASNSSLDRVVKVNIFLADINHFAEFNSVYAKYFNTHKPARSCVAVAALPLGVDMEM 121

Query: 121 EVIAVEKD 128
           E IA E+D
Sbjct: 122 EAIAAERD 129

>Kwal_23.2807
          Length = 129

 Score = 63.9 bits (154), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 39/107 (36%), Positives = 64/107 (59%), Gaps = 9/107 (8%)

Query: 22  AIKVNNMVFVSGQIPYTHENKPVEGSIADKAEQVI----QNVKNILEEANSSLNKIVKVN 77
           A K N++VF SG +       PV G++ +  EQ I    +N+KN+L  + SSL +++KV 
Sbjct: 25  ASKSNDLVFTSGCV----GTDPVTGNLPEDLEQQIINALENLKNVLHASGSSLERVLKVL 80

Query: 78  VFLADINDFAEFNGVYAKYFNEHKPARSCVAVKSLPLNVDLEMEVIA 124
           +F++D +  +  N VY++YF  + PARSC+ V      + +E+E IA
Sbjct: 81  LFVSDASYASTVNEVYSRYF-PNAPARSCIVVAFPAPALKVELECIA 126

>Kwal_47.16590
          Length = 126

 Score = 63.5 bits (153), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 36/99 (36%), Positives = 52/99 (52%), Gaps = 1/99 (1%)

Query: 26  NNMVFVSGQIPYTHENKPVEGSIADKAEQVIQNVKNILEEANSSLNKIVKVNVFLADIND 85
           N  VF SG I   +    V   I D+    I+N++ +L    SSL+K+ KV +F++  + 
Sbjct: 26  NGHVFTSGIIGANYGTGEVPHEIEDQVHLAIKNLETVLVAGGSSLSKVFKVTMFISHADY 85

Query: 86  FAEFNGVYAKYFNEHKPARSCVAVKSLPLNVDLEMEVIA 124
               N +Y  YF  HKPARSCV V  +   +  E+E IA
Sbjct: 86  SKVVNEIYGHYF-PHKPARSCVVVAFMDAAIKYELEAIA 123

>Kwal_55.21247
          Length = 134

 Score = 58.9 bits (141), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 35/103 (33%), Positives = 59/103 (57%), Gaps = 9/103 (8%)

Query: 26  NNMVFVSGQIPYTHENKPVEGSIADKAEQ----VIQNVKNILEEANSSLNKIVKVNVFLA 81
           +++VF SG +       PV G +    EQ     ++N+KN+L  + SSL +++KV +F++
Sbjct: 28  SDLVFTSGCV----GTDPVTGELPTDLEQQVRNALENLKNVLRASGSSLEQVIKVLLFVS 83

Query: 82  DINDFAEFNGVYAKYFNEHKPARSCVAVKSLPLNVDLEMEVIA 124
           D +     N VY++YF    PARSC+ V     ++ +E+E IA
Sbjct: 84  DGSYAPAVNKVYSEYF-PGAPARSCIVVSFPNASLKVELECIA 125

>KLLA0B14817g 1301705..1302100 similar to sp|Q8XCD0 Escherichia coli
           O157:H7 Orf, hypothetical protein, start by similarity
          Length = 131

 Score = 52.4 bits (124), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 33/116 (28%), Positives = 59/116 (50%), Gaps = 6/116 (5%)

Query: 9   TQLAPPPAASYSQAIKVNNMVFVSGQIPYTHENKPVEGSIADKAEQVIQNVKNILEEANS 68
           T LAP    S     K   +V+ SG +        +   +  +    + N+  +L+ +NS
Sbjct: 17  TFLAPAYVTS-----KDTELVYTSGCVGSDLLTGEIPEDLEKQVRNALDNLGRVLKASNS 71

Query: 69  SLNKIVKVNVFLADINDFAEFNGVYAKYFNEHKPARSCVAVKSLPLNVDLEMEVIA 124
           S + ++K+ +F+AD +  +  N VY +YF E +PARSC+ V      + +E+E +A
Sbjct: 72  SFDDVLKILLFVADGSYASTVNAVYKEYFPE-RPARSCIVVSFPDPTLKVELECVA 126

>KLLA0E03894g complement(364475..364888) some similarities with
           sp|Q87LF6 Vibrio parahaemolyticus Conserved hypothetical
           protein, hypothetical start
          Length = 137

 Score = 45.8 bits (107), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 32/103 (31%), Positives = 62/103 (60%), Gaps = 9/103 (8%)

Query: 26  NNMVFVSGQI---PYTHENKPVEGSIADKAEQVIQNVKNILEEANSSLNKIVKVNVFLAD 82
           N ++F SG +   P T+E   +   +  +A   + N+K +LE + SS++ ++K+ +F++D
Sbjct: 29  NQLLFSSGCVGTDPVTNE---LPEDLEQQARNSMINLKKVLEVSGSSVDSVLKILLFVSD 85

Query: 83  INDFAEFNGVYAKYFNEHKPARSCVAVKSLPLN-VDLEMEVIA 124
            +     N V+ ++F  ++PARSC+ V + P N + +E+E IA
Sbjct: 86  GSYAGIVNKVFKEFF-PNQPARSCIVV-AFPNNKLKVELECIA 126

>CAGL0M04521g 496157..498223 similar to tr|Q12429 Saccharomyces
           cerevisiae YLR143w, hypothetical start
          Length = 688

 Score = 44.3 bits (103), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 22/89 (24%), Positives = 52/89 (58%), Gaps = 10/89 (11%)

Query: 24  KVNNMVFVSGQIPYTHENKPVEGSIADKAEQVIQNVKNILEEANSSLNKIVKVNVFLADI 83
           ++ N++++S   P     +  +G++ ++ + V+Q + NIL++ + +   ++  ++ L D+
Sbjct: 318 RIGNLLYISNIQP-----QYKDGTVQEQVKDVLQQLDNILKDNHLTAKNVLYSSLLLTDM 372

Query: 84  NDFAEFNGVYAKYFNEHK-----PARSCV 107
           + FA  N  Y+K+F+  K     PAR+C+
Sbjct: 373 SLFASVNQEYSKFFDIWKNGPLPPARACI 401

>AGL164W [4148] [Homologous to ScYLR143W - SH]
           complement(388842..390902) [2061 bp, 686 aa]
          Length = 686

 Score = 42.0 bits (97), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 24/79 (30%), Positives = 42/79 (53%), Gaps = 12/79 (15%)

Query: 57  QNVKNILEEANSSLNK--IVKVNVF-----LADINDFAEFNGVYAKYFNEHK-----PAR 104
           +  +++ ++ N SL +  +VK  V      LAD+  FAE N  Y  YF+  +     P+R
Sbjct: 331 KQARDVFDQLNESLTRHGVVKAQVLSSVLLLADMGTFAEINTAYNGYFSIQEIGPLPPSR 390

Query: 105 SCVAVKSLPLNVDLEMEVI 123
           +C+  KSL   + L++ V+
Sbjct: 391 ACIESKSLAPGIGLQLSVV 409

>YLR143W (YLR143W) [3552] chr12 (427330..429387) Protein containing
           an endoribonuclease L-PSP domain and a DUF71 domain of
           unknown function, has moderate similarity to
           uncharacterized C. albicans Orf6.3850p [2058 bp, 685 aa]
          Length = 685

 Score = 41.2 bits (95), Expect = 6e-05,   Method: Composition-based stats.
 Identities = 19/87 (21%), Positives = 46/87 (52%), Gaps = 5/87 (5%)

Query: 47  SIADKAEQVIQNVKNILEEANSSLNKIVKVNVFLADINDFAEFNGVYAKYFNEHK----- 101
           ++  ++E +   + +IL       N I+  ++ + D+++F + N +Y ++ +  K     
Sbjct: 334 TVEKQSEDIFTELADILHSNQIPRNHILSASLLIRDMSNFGKINKIYNEFLDLSKYGPLP 393

Query: 102 PARSCVAVKSLPLNVDLEMEVIAVEKD 128
           P+R+CV  K LP +  +++ V+   K+
Sbjct: 394 PSRACVGSKCLPEDCHVQLSVVVDVKN 420

>KLLA0D16984g 1439669..1441759 similar to sgd|S0004133 Saccharomyces
           cerevisiae YLR143w, start by similarity
          Length = 696

 Score = 37.4 bits (85), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 26/81 (32%), Positives = 43/81 (53%), Gaps = 6/81 (7%)

Query: 33  GQIPYTHENKPVEG-SIADKAEQVIQNVKNILEEANSSLNKIVKVNVFLADINDFAEFNG 91
           G++ Y     P +G S+ +K   V   + +IL   +    +I+  ++ L+D+N+F E N 
Sbjct: 322 GKLLYISNIAPSKGESLKEKCLDVFSQLTSILSSRSIFACQILSSSLLLSDMNNFQEVNS 381

Query: 92  VYAKYFNEHK-----PARSCV 107
            Y +YFN  K     PAR+CV
Sbjct: 382 YYNEYFNVTKIGPLPPARACV 402

>Kwal_27.11310
          Length = 688

 Score = 37.4 bits (85), Expect = 0.002,   Method: Composition-based stats.
 Identities = 26/87 (29%), Positives = 45/87 (51%), Gaps = 6/87 (6%)

Query: 43  PVEGSIAD-KAEQVIQNVKNILEEANSSLNKIVKVNVFLADINDFAEFNGVYAKYFNEHK 101
           P  GS  D K + V + + +IL +   S  +I+   V LAD+ DF++ N  Y ++F+  +
Sbjct: 326 PKGGSSPDEKVQDVFRQLSDILRDYELSPAQILSSLVLLADMGDFSKVNEHYNEFFHVAR 385

Query: 102 -----PARSCVAVKSLPLNVDLEMEVI 123
                P+R+CV    +     L++ VI
Sbjct: 386 NGPLPPSRACVGSSLVGSENILQLSVI 412

>Scas_715.33
          Length = 1018

 Score = 30.0 bits (66), Expect = 0.53,   Method: Composition-based stats.
 Identities = 15/51 (29%), Positives = 27/51 (52%), Gaps = 2/51 (3%)

Query: 14  PPAASYSQAI--KVNNMVFVSGQIPYTHENKPVEGSIADKAEQVIQNVKNI 62
           P   SYS+AI    N+++  + ++P   E +  +G     AE V+  +KN+
Sbjct: 341 PIKQSYSKAIFNYTNSLLIATAELPEIDEIRVSQGGTESNAENVVTTLKNL 391

>CAGL0M08448g complement(841439..844204) highly similar to sp|P36051
           Saccharomyces cerevisiae YKL165c sporulation protein,
           start by similarity
          Length = 921

 Score = 28.1 bits (61), Expect = 2.3,   Method: Composition-based stats.
 Identities = 20/73 (27%), Positives = 32/73 (43%), Gaps = 4/73 (5%)

Query: 16  AASYSQAIKVNNMVFVSGQIPYTHENKPVEGSIADKAEQVIQNVKNILEEANSSLNKIVK 75
           AA  S  I  N      G++P  +    +EGS   K E ++ N ++ILE+     N+++ 
Sbjct: 333 AALMSYLIGTNYPANSVGELPLAY----IEGSEGQKLEALLNNAESILEQYRVKENEVIN 388

Query: 76  VNVFLADINDFAE 88
                     FAE
Sbjct: 389 SQFVYKIYPKFAE 401

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.313    0.129    0.353 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 4,018,778
Number of extensions: 155552
Number of successful extensions: 492
Number of sequences better than 10.0: 40
Number of HSP's gapped: 486
Number of HSP's successfully gapped: 40
Length of query: 128
Length of database: 16,596,109
Length adjustment: 89
Effective length of query: 39
Effective length of database: 13,515,107
Effective search space: 527089173
Effective search space used: 527089173
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 55 (25.8 bits)